F410129

General Info

Members Datasets Scaffolds Average Seq Length
330 181 660 115

Family's Representative Sequence

Representative Sequence 3300025972|Ga0207668_10004533|Ga0207668_100045334
Length 113
Sequence MKQILRAIRGVILWSYERTTWQWDLLCVVILIFIFLTPKTWFETGELRGAEGHQRTITSTLLLTTDVVGNEPDNAAIERQVRSIIGRSDVEITGVRRRLDAKGNLAAYEVDIR

Samples

Sample ID Description Type Environment
1 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
57 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
68 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
69 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
118 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
119 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
120 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
121 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
122 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
123 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
124 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
125 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
126 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
129 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
130 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
131 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
132 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
133 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
134 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
135 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
136 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
137 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
138 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
139 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
140 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
141 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
142 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
143 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
144 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
147 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
148 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
149 3300049549 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
151 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
152 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
153 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
154 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
155 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
156 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
157 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
158 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
159 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
160 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
161 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
162 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
163 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
164 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
165 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
166 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
167 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
168 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
169 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
170 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
171 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
172 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
173 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
174 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
175 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
176 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
177 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
178 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
179 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
180 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
181 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.7
Metatranscriptomes 0.3
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.06
Rhizosphere 93.94
Stem 0
Stem Tuber 0
Unclassified 7.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207668_10004533 3300025972 Bacteria 8172
2 Ga0065704_10001798 3300005289 Bacteria 6520
3 Ga0065704_10266794 3300005289 Unclassified 952
4 Ga0065704_10731825 3300005289 Unclassified 549
5 Ga0065712_10202211 3300005290 Bacteria 1104
6 Ga0065712_10284164 3300005290 Bacteria 890
7 Ga0065715_10100599 3300005293 Bacteria 3287
8 Ga0065715_10112250 3300005293 Bacteria 2538
9 Ga0065715_10135344 3300005293 Bacteria 1940
10 Ga0065715_10158398 3300005293 Bacteria 1653
11 Ga0065715_10402339 3300005293 Bacteria 875
12 Ga0065707_10003391 3300005295 Bacteria 3796
13 Ga0065707_10131984 3300005295 Bacteria 1904
14 Ga0065707_10315325 3300005295 Bacteria 976
15 Ga0070676_10453856 3300005328 Unclassified 902
16 Ga0070690_100113392 3300005330 Bacteria 1811
17 Ga0068869_100029718 3300005334 Bacteria 3832
18 Ga0068869_100802849 3300005334 Bacteria 809
19 Ga0070680_100039864 3300005336 Unclassified 3801
20 Ga0070660_100094414 3300005339 Bacteria 2363
21 Ga0070689_101047429 3300005340 Bacteria 727
22 Ga0070687_100083662 3300005343 Bacteria 1748
23 Ga0070687_100133325 3300005343 Bacteria 1437
24 Ga0070692_10102853 3300005345 Bacteria 1568
25 Ga0070692_10489812 3300005345 Unclassified 795
26 Ga0070668_100007396 3300005347 Bacteria 8150
27 Ga0070669_100090175 3300005353 Bacteria 2297
28 Ga0070673_100166793 3300005364 Bacteria 1877
29 Ga0070673_100619400 3300005364 Bacteria 988
30 Ga0070659_100000353 3300005366 Bacteria 35063
31 Ga0070659_100218027 3300005366 Bacteria 1574
32 Ga0070705_100284856 3300005440 Bacteria 1177
33 Ga0070705_101185240 3300005440 Unclassified 629
34 Ga0070694_100022443 3300005444 Bacteria 4043
35 Ga0070694_100055897 3300005444 Bacteria 2678
36 Ga0070694_100094285 3300005444 Unclassified 2105
37 Ga0070694_100515183 3300005444 Bacteria 954
38 Ga0070708_100103151 3300005445 Bacteria 2614
39 Ga0070681_10013042 3300005458 Bacteria 8253
40 Ga0068867_100295943 3300005459 Bacteria 1332
41 Ga0068867_101021370 3300005459 Bacteria 751
42 Ga0070679_100013568 3300005530 Bacteria 7808
43 Ga0070697_100966511 3300005536 Unclassified 757
44 Ga0068853_100169839 3300005539 Bacteria 1973
45 Ga0068853_100534983 3300005539 Bacteria 1109
46 Ga0068853_100621835 3300005539 Bacteria 1027
47 Ga0070672_101534695 3300005543 Bacteria 597
48 Ga0070695_100107906 3300005545 Bacteria 1885
49 Ga0070695_101328084 3300005545 Bacteria 595
50 Ga0070696_100019819 3300005546 Bacteria 4558
51 Ga0070696_100057892 3300005546 Bacteria 2706
52 Ga0070693_100000878 3300005547 Bacteria 13388
53 Ga0070693_100034009 3300005547 Bacteria 2818
54 Ga0070693_100281065 3300005547 Bacteria 1115
55 Ga0070665_101817380 3300005548 Bacteria 616
56 Ga0070704_100030619 3300005549 Bacteria 3608
57 Ga0068855_101662339 3300005563 Bacteria 652
58 Ga0070664_100000399 3300005564 Bacteria 32416
59 Ga0068857_100003943 3300005577 Bacteria 12490
60 Ga0068854_100200687 3300005578 Bacteria 1568
61 Ga0068854_101230631 3300005578 Unclassified 672
62 Ga0068856_100001146 3300005614 Bacteria 27859
63 Ga0070702_100024137 3300005615 Bacteria 3240
64 Ga0070702_100040080 3300005615 Bacteria 2618
65 Ga0070702_100051595 3300005615 Bacteria 2355
66 Ga0068852_100924885 3300005616 Bacteria 890
67 Ga0068852_101291310 3300005616 Bacteria 751
68 Ga0068852_102661446 3300005616 Bacteria 520
69 Ga0068859_100208009 3300005617 Bacteria 2043
70 Ga0068859_100741393 3300005617 Bacteria 1071
71 Ga0068859_101506293 3300005617 Bacteria 742
72 Ga0068861_100218251 3300005719 Bacteria 1610
73 Ga0068861_101714943 3300005719 Bacteria 621
74 Ga0068851_10002032 3300005834 Bacteria 8924
75 Ga0068858_100294124 3300005842 Bacteria 1548
76 Ga0068858_101001733 3300005842 Bacteria 819
77 Ga0068860_100019122 3300005843 Bacteria 6651
78 Ga0068860_100094765 3300005843 Bacteria 2845
79 Ga0068860_100118499 3300005843 Bacteria 2534
80 Ga0081455_10134441 3300005937 Bacteria 1929
81 Ga0070716_100100983 3300006173 Bacteria 1768
82 Ga0068871_100393851 3300006358 Bacteria 1232
83 Ga0075431_100046506 3300006847 Bacteria 4475
84 Ga0075433_10054727 3300006852 Bacteria 3481
85 Ga0075434_100035193 3300006871 Bacteria 4949
86 Ga0075434_100118962 3300006871 Bacteria 2656
87 Ga0075434_100530200 3300006871 Bacteria 1198
88 Ga0075434_101700695 3300006871 Bacteria 639
89 Ga0075429_100114146 3300006880 Bacteria 2361
90 Ga0097620_100208008 3300006931 Bacteria 2043
91 Ga0097620_100741355 3300006931 Bacteria 1071
92 Ga0097620_101506233 3300006931 Bacteria 742
93 Ga0075435_100199414 3300007076 Bacteria 1695
94 Ga0105251_10146788 3300009011 Bacteria 1066
95 Ga0105240_10971002 3300009093 Bacteria 910
96 Ga0111539_10001706 3300009094 Bacteria 29249
97 Ga0111539_10190992 3300009094 Bacteria 2390
98 Ga0105245_10348560 3300009098 Bacteria 1466
99 Ga0105245_10353297 3300009098 Bacteria 1457
100 Ga0105245_10565843 3300009098 Bacteria 1160
101 Ga0105245_12074835 3300009098 Bacteria 622
102 Ga0105247_10002274 3300009101 Bacteria 13192
103 Ga0105247_10042399 3300009101 Bacteria 2788
104 Ga0105247_10151370 3300009101 Bacteria 1529
105 Ga0105247_10162525 3300009101 Bacteria 1479
106 Ga0105247_10425680 3300009101 Bacteria 951
107 Ga0105247_11155535 3300009101 Bacteria 614
108 Ga0114129_10023494 3300009147 Bacteria 8740
109 Ga0114129_10168692 3300009147 Bacteria 2985
110 Ga0114129_10557828 3300009147 Bacteria 1489
111 Ga0114129_11390472 3300009147 Bacteria 866
112 Ga0105243_10063296 3300009148 Bacteria 2964
113 Ga0105243_10861748 3300009148 Unclassified 898
114 Ga0105243_12544096 3300009148 Unclassified 551
115 Ga0105241_10092888 3300009174 Bacteria 2383
116 Ga0105241_10120787 3300009174 Bacteria 2110
117 Ga0105241_10137304 3300009174 Bacteria 1987
118 Ga0105241_10633024 3300009174 Bacteria 970
119 Ga0105241_11587823 3300009174 Bacteria 632
120 Ga0105242_10217331 3300009176 Bacteria 1706
121 Ga0105242_10548354 3300009176 Bacteria 1108
122 Ga0105242_10687962 3300009176 Bacteria 999
123 Ga0105242_12453385 3300009176 Unclassified 569
124 Ga0105248_10014806 3300009177 Bacteria 8591
125 Ga0105248_10131214 3300009177 Bacteria 2827
126 Ga0105248_10373770 3300009177 Bacteria 1605
127 Ga0105248_10438751 3300009177 Bacteria 1471
128 Ga0105248_10682191 3300009177 Bacteria 1159
129 Ga0105237_10006325 3300009545 Bacteria 13163
130 Ga0105237_10010011 3300009545 Bacteria 10116
131 Ga0105237_10153361 3300009545 Bacteria 2300
132 Ga0105237_10532339 3300009545 Bacteria 1182
133 Ga0105238_10158447 3300009551 Bacteria 2239
134 Ga0105249_10000018 3300009553 Bacteria 275907
135 Ga0105249_10172144 3300009553 Bacteria 2101
136 Ga0105249_10216667 3300009553 Bacteria 1882
137 Ga0105239_10064893 3300010375 Bacteria 4008
138 Ga0105239_10771877 3300010375 Bacteria 1101
139 Ga0105246_10843225 3300011119 Bacteria 817
140 Ga0105246_10967300 3300011119 Unclassified 768
141 Ga0157373_10109408 3300013100 Bacteria 1943
142 Ga0157373_10182030 3300013100 Bacteria 1480
143 Ga0157373_11130761 3300013100 Unclassified 588
144 Ga0157371_10113964 3300013102 Bacteria 1920
145 Ga0157371_11307210 3300013102 Bacteria 561
146 Ga0157374_12688778 3300013296 Bacteria 525
147 Ga0157378_10227654 3300013297 Bacteria 1775
148 Ga0157378_10320264 3300013297 Bacteria 1506
149 Ga0157378_10535537 3300013297 Bacteria 1174
150 Ga0163162_10000001 3300013306 Bacteria 751833
151 Ga0163162_10005973 3300013306 Bacteria 11787
152 Ga0163162_10378391 3300013306 Bacteria 1549
153 Ga0163162_10583168 3300013306 Bacteria 1245
154 Ga0163162_12280753 3300013306 Bacteria 622
155 Ga0157372_10029226 3300013307 Bacteria 6017
156 Ga0157372_10643091 3300013307 Bacteria 1235
157 Ga0157372_11209641 3300013307 Bacteria 873
158 Ga0157372_12117616 3300013307 Bacteria 646
159 Ga0157375_10203987 3300013308 Bacteria 2133
160 Ga0157375_10355180 3300013308 Bacteria 1632
161 Ga0157375_10567446 3300013308 Bacteria 1296
162 Ga0157375_10579502 3300013308 Bacteria 1282
163 Ga0157375_11485264 3300013308 Bacteria 800
164 Ga0157375_11692215 3300013308 Bacteria 749
165 Ga0163163_10000298 3300014325 Bacteria 49128
166 Ga0163163_10118208 3300014325 Bacteria 2683
167 Ga0163163_10144399 3300014325 Bacteria 2423
168 Ga0163163_10421956 3300014325 Bacteria 1393
169 Ga0163163_10525490 3300014325 Bacteria 1246
170 Ga0163163_10678223 3300014325 Bacteria 1094
171 Ga0163163_11439222 3300014325 Unclassified 751
172 Ga0157380_10000396 3300014326 Bacteria 26239
173 Ga0157380_11030544 3300014326 Bacteria 858
174 Ga0157377_10346836 3300014745 Bacteria 995
175 Ga0157377_10561245 3300014745 Unclassified 808
176 Ga0157377_10833280 3300014745 Bacteria 683
177 Ga0157377_11102485 3300014745 Bacteria 608
178 Ga0157379_10072632 3300014968 Bacteria 3078
179 Ga0157379_10160228 3300014968 Bacteria 2031
180 Ga0157379_10416223 3300014968 Bacteria 1237
181 Ga0157379_10799389 3300014968 Bacteria 890
182 Ga0163161_11442485 3300017792 Bacteria 602
183 Ga0207656_10040404 3300025321 Bacteria 1977
184 Ga0207710_10000575 3300025900 Bacteria 21826
185 Ga0207710_10289663 3300025900 Bacteria 825
186 Ga0207688_10035806 3300025901 Bacteria 2750
187 Ga0207647_10163950 3300025904 Bacteria 1295
188 Ga0207645_10061504 3300025907 Bacteria 2398
189 Ga0207684_10527629 3300025910 Bacteria 1011
190 Ga0207654_10035589 3300025911 Bacteria 2776
191 Ga0207654_10194596 3300025911 Bacteria 1331
192 Ga0207707_10043224 3300025912 Bacteria 3931
193 Ga0207671_10004666 3300025914 Bacteria 12970
194 Ga0207660_10011501 3300025917 Bacteria 5764
195 Ga0207662_10085264 3300025918 Bacteria 1934
196 Ga0207662_10101392 3300025918 Bacteria 1784
197 Ga0207649_10830963 3300025920 Bacteria 722
198 Ga0207652_10032165 3300025921 Bacteria 4407
199 Ga0207694_10003281 3300025924 Bacteria 12887
200 Ga0207650_10664573 3300025925 Unclassified 879
201 Ga0207644_10311494 3300025931 Bacteria 1271
202 Ga0207690_10009856 3300025932 Bacteria 5674
203 Ga0207686_10493857 3300025934 Bacteria 949
204 Ga0207665_10059739 3300025939 Bacteria 2581
205 Ga0207691_10836535 3300025940 Bacteria 772
206 Ga0207711_10004098 3300025941 Bacteria 12495
207 Ga0207711_10008234 3300025941 Bacteria 8730
208 Ga0207711_10541146 3300025941 Bacteria 1086
209 Ga0207689_10197084 3300025942 Bacteria 1662
210 Ga0207689_10217748 3300025942 Bacteria 1577
211 Ga0207712_10000081 3300025961 Bacteria 114043
212 Ga0207712_10004444 3300025961 Bacteria 8855
213 Ga0207712_10936511 3300025961 Unclassified 767
214 Ga0207640_10493382 3300025981 Bacteria 1018
215 Ga0207677_10130902 3300026023 Bacteria 1904
216 Ga0207703_10080350 3300026035 Bacteria 2715
217 Ga0207703_10138943 3300026035 Bacteria 2106
218 Ga0207703_10615835 3300026035 Bacteria 1028
219 Ga0207639_11019800 3300026041 Bacteria 775
220 Ga0207708_10578476 3300026075 Bacteria 949
221 Ga0207702_10086434 3300026078 Bacteria 2735
222 Ga0207641_10452061 3300026088 Bacteria 1242
223 Ga0207641_12143763 3300026088 Bacteria 559
224 Ga0207648_10359957 3300026089 Bacteria 1313
225 Ga0207674_10000058 3300026116 Bacteria 113012
226 Ga0207675_100721959 3300026118 Bacteria 1006
227 Ga0207698_10039989 3300026142 Bacteria 3479
228 Ga0207698_10210122 3300026142 Bacteria 1750
229 Ga0207698_10655464 3300026142 Bacteria 1040
230 Ga0207698_12413755 3300026142 Bacteria 537
231 Ga0207428_10013108 3300027907 Bacteria 7259
232 Ga0268265_11471333 3300028380 Bacteria 684
233 Ga0268264_10027892 3300028381 Bacteria 4616
234 Ga0268264_10202188 3300028381 Bacteria 1818
235 Ga0307416_100131898 3300032002 Bacteria 2251
236 Ga0307416_100602207 3300032002 Bacteria 1179
237 Ga0307414_10012176 3300032004 Bacteria 5074
238 Ga0373930_0107937 3300034816 Bacteria 668
239 Ga0373940_0065483 3300035088 Bacteria 1048
240 Ga0373940_0353484 3300035088 Bacteria 516
241 Ga0373949_0047026 3300035090 Bacteria 1077
242 Ga0373951_0000344 3300035091 Bacteria 14204
243 Ga0373951_0019826 3300035091 Bacteria 1536
244 Ga0373951_0108191 3300035091 Bacteria 745
245 Ga0373952_0062884 3300035092 Bacteria 912
246 Ga0373941_0029872 3300035115 Bacteria 1611
247 Ga0373941_0195136 3300035115 Bacteria 767
248 Ga0373961_0060458 3300035241 Bacteria 1148
249 Ga0373931_0093776 3300035691 Bacteria 1677
250 Ga0373931_1061922 3300035691 Bacteria 550
251 Ga0395900_1232496 3300037418 Bacteria 663
252 Ga0395905_0595607 3300037471 Bacteria 1007
253 Ga0395901_0348840 3300038443 Bacteria 1528
254 Ga0242419_006144 3300038698 Bacteria 868
255 Ga0242422_00204 3300038699 Bacteria 3378
256 Ga0242420_013194 3300038996 Bacteria 1406
257 Ga0439448_0010185 3300042005 Bacteria 2782
258 Ga0439455_0043642 3300042012 Bacteria 1155
259 Ga0450914_063786 3300042118 Bacteria 504
260 Ga0439458_0004252 3300042157 Bacteria 3305
261 Ga0439464_0325351 3300042439 Unclassified 505
262 Ga0451576_0137768 3300045051 Bacteria 2546
263 Ga0496100_0434270 3300048903 Unclassified 1005
264 Ga0496100_0444088 3300048903 Bacteria 994
265 Ga0496102_0045769 3300048905 Bacteria 3973
266 Ga0496102_0734268 3300048905 Bacteria 910
267 Ga0496103_0230231 3300048906 Bacteria 1192
268 Ga0496103_0627378 3300048906 Bacteria 684
269 Ga0496106_0012081 3300048909 Bacteria 6373
270 Ga0496106_0084306 3300048909 Bacteria 2445
271 Ga0496106_0212545 3300048909 Bacteria 1541
272 Ga0496106_0875489 3300048909 Bacteria 710
273 Ga0496108_0289145 3300048911 Bacteria 1427
274 Ga0496108_1490617 3300048911 Bacteria 563
275 Ga0496109_0730862 3300048912 Bacteria 928
276 Ga0496109_0767525 3300048912 Bacteria 902
277 Ga0496112_0054171 3300048915 Bacteria 3941
278 Ga0496112_0114615 3300048915 Bacteria 2666
279 Ga0496112_0371164 3300048915 Bacteria 1372
280 Ga0496112_0647146 3300048915 Bacteria 987
281 Ga0496113_0531173 3300048916 Unclassified 944
282 Ga0496113_0545719 3300048916 Unclassified 930
283 Ga0501292_035965 3300049515 Bacteria 844
284 Ga0501298_016522 3300049521 Bacteria 1338
285 Ga0501333_021519 3300049549 Bacteria 516
286 Ga0501198_001047 3300049649 Bacteria 3523
287 Ga0501202_081079 3300049652 Bacteria 762
288 Ga0501207_029191 3300049654 Bacteria 921
289 Ga0501208_018593 3300049655 Bacteria 1109
290 Ga0501214_004274 3300049659 Bacteria 1315
291 Ga0501216_050770 3300049660 Bacteria 815
292 Ga0501217_002950 3300049661 Bacteria 3403
293 Ga0501223_096270 3300049663 Bacteria 606
294 Ga0501224_007072 3300049664 Bacteria 1632
295 Ga0501230_017296 3300049667 Bacteria 1218
296 Ga0501235_008778 3300049669 Bacteria 2205
297 Ga0501235_189226 3300049669 Bacteria 552
298 Ga0501236_140357 3300049670 Bacteria 505
299 Ga0501247_041244 3300049677 Bacteria 660
300 Ga0501249_011562 3300049679 Bacteria 1855
301 Ga0501257_008945 3300049686 Bacteria 2257
302 Ga0501257_038163 3300049686 Bacteria 1174
303 Ga0501258_021472 3300049687 Bacteria 762
304 Ga0501221_048290 3300049704 Bacteria 952
305 Ga0501229_007372 3300049706 Bacteria 1369
306 Ga0501234_003386 3300049707 Bacteria 2507
307 Ga0501245_159785 3300049708 Bacteria 504
308 Ga0501241_030509 3300049758 Bacteria 1018
309 Ga0501268_007928 3300049765 Bacteria 1595
310 Ga0501271_044953 3300049768 Bacteria 585
311 Ga0501273_040758 3300049770 Bacteria 686
312 nmdc:mga05p37_1039064_c1 3300050507 Bacteria 866
313 nmdc:mga05p37_143453_c1 3300050507 Unclassified 2925
314 nmdc:mga05p37_361908_c1 3300050507 Bacteria 1705
315 nmdc:mga05p37_401847_c1 3300050507 Bacteria 1599
316 nmdc:mga09592_1628217_c1 3300050508 Bacteria 522
317 nmdc:mga09592_165062_c1 3300050508 Bacteria 1914
318 nmdc:mga0qj67_19659_c1 3300050509 Bacteria 5163
319 nmdc:mga06r32_46958_c1 3300050510 Bacteria 4123
320 nmdc:mga08y16_27376_c1 3300050511 Bacteria 6007
321 nmdc:mga0n895_2069285_c1 3300050512 Unclassified 526
322 nmdc:mga0n895_41506_c1 3300050512 Bacteria 4474
323 nmdc:mga0n895_531085_c1 3300050512 Bacteria 1183
324 nmdc:mga0n895_761548_c1 3300050512 Bacteria 961
325 nmdc:mga0rr50_276986_c1 3300050513 Bacteria 1399
326 nmdc:mga0rr50_393733_c1 3300050513 Unclassified 1170
327 nmdc:mga0a205_14160_c1 3300050515 Bacteria 7441
328 nmdc:mga0a205_226852_c1 3300050515 Bacteria 1752
329 nmdc:mga0a205_269021_c1 3300050515 Bacteria 1581
330 nmdc:mga0a205_9020_c1 3300050515 Bacteria 9090
331 Ga0207668_10004533
332 Ga0065704_10001798
333 Ga0065704_10266794
334 Ga0065704_10731825
335 Ga0065712_10202211
336 Ga0065712_10284164
337 Ga0065715_10100599
338 Ga0065715_10112250
339 Ga0065715_10135344
340 Ga0065715_10158398
341 Ga0065715_10402339
342 Ga0065707_10003391
343 Ga0065707_10131984
344 Ga0065707_10315325
345 Ga0070676_10453856
346 Ga0070690_100113392
347 Ga0068869_100029718
348 Ga0068869_100802849
349 Ga0070680_100039864
350 Ga0070660_100094414
351 Ga0070689_101047429
352 Ga0070687_100083662
353 Ga0070687_100133325
354 Ga0070692_10102853
355 Ga0070692_10489812
356 Ga0070668_100007396
357 Ga0070669_100090175
358 Ga0070673_100166793
359 Ga0070673_100619400
360 Ga0070659_100000353
361 Ga0070659_100218027
362 Ga0070705_100284856
363 Ga0070705_101185240
364 Ga0070694_100022443
365 Ga0070694_100055897
366 Ga0070694_100094285
367 Ga0070694_100515183
368 Ga0070708_100103151
369 Ga0070681_10013042
370 Ga0068867_100295943
371 Ga0068867_101021370
372 Ga0070679_100013568
373 Ga0070697_100966511
374 Ga0068853_100169839
375 Ga0068853_100534983
376 Ga0068853_100621835
377 Ga0070672_101534695
378 Ga0070695_100107906
379 Ga0070695_101328084
380 Ga0070696_100019819
381 Ga0070696_100057892
382 Ga0070693_100000878
383 Ga0070693_100034009
384 Ga0070693_100281065
385 Ga0070665_101817380
386 Ga0070704_100030619
387 Ga0068855_101662339
388 Ga0070664_100000399
389 Ga0068857_100003943
390 Ga0068854_100200687
391 Ga0068854_101230631
392 Ga0068856_100001146
393 Ga0070702_100024137
394 Ga0070702_100040080
395 Ga0070702_100051595
396 Ga0068852_100924885
397 Ga0068852_101291310
398 Ga0068852_102661446
399 Ga0068859_100208009
400 Ga0068859_100741393
401 Ga0068859_101506293
402 Ga0068861_100218251
403 Ga0068861_101714943
404 Ga0068851_10002032
405 Ga0068858_100294124
406 Ga0068858_101001733
407 Ga0068860_100019122
408 Ga0068860_100094765
409 Ga0068860_100118499
410 Ga0081455_10134441
411 Ga0070716_100100983
412 Ga0068871_100393851
413 Ga0075431_100046506
414 Ga0075433_10054727
415 Ga0075434_100035193
416 Ga0075434_100118962
417 Ga0075434_100530200
418 Ga0075434_101700695
419 Ga0075429_100114146
420 Ga0097620_100208008
421 Ga0097620_100741355
422 Ga0097620_101506233
423 Ga0075435_100199414
424 Ga0105251_10146788
425 Ga0105240_10971002
426 Ga0111539_10001706
427 Ga0111539_10190992
428 Ga0105245_10348560
429 Ga0105245_10353297
430 Ga0105245_10565843
431 Ga0105245_12074835
432 Ga0105247_10002274
433 Ga0105247_10042399
434 Ga0105247_10151370
435 Ga0105247_10162525
436 Ga0105247_10425680
437 Ga0105247_11155535
438 Ga0114129_10023494
439 Ga0114129_10168692
440 Ga0114129_10557828
441 Ga0114129_11390472
442 Ga0105243_10063296
443 Ga0105243_10861748
444 Ga0105243_12544096
445 Ga0105241_10092888
446 Ga0105241_10120787
447 Ga0105241_10137304
448 Ga0105241_10633024
449 Ga0105241_11587823
450 Ga0105242_10217331
451 Ga0105242_10548354
452 Ga0105242_10687962
453 Ga0105242_12453385
454 Ga0105248_10014806
455 Ga0105248_10131214
456 Ga0105248_10373770
457 Ga0105248_10438751
458 Ga0105248_10682191
459 Ga0105237_10006325
460 Ga0105237_10010011
461 Ga0105237_10153361
462 Ga0105237_10532339
463 Ga0105238_10158447
464 Ga0105249_10000018
465 Ga0105249_10172144
466 Ga0105249_10216667
467 Ga0105239_10064893
468 Ga0105239_10771877
469 Ga0105246_10843225
470 Ga0105246_10967300
471 Ga0157373_10109408
472 Ga0157373_10182030
473 Ga0157373_11130761
474 Ga0157371_10113964
475 Ga0157371_11307210
476 Ga0157374_12688778
477 Ga0157378_10227654
478 Ga0157378_10320264
479 Ga0157378_10535537
480 Ga0163162_10000001
481 Ga0163162_10005973
482 Ga0163162_10378391
483 Ga0163162_10583168
484 Ga0163162_12280753
485 Ga0157372_10029226
486 Ga0157372_10643091
487 Ga0157372_11209641
488 Ga0157372_12117616
489 Ga0157375_10203987
490 Ga0157375_10355180
491 Ga0157375_10567446
492 Ga0157375_10579502
493 Ga0157375_11485264
494 Ga0157375_11692215
495 Ga0163163_10000298
496 Ga0163163_10118208
497 Ga0163163_10144399
498 Ga0163163_10421956
499 Ga0163163_10525490
500 Ga0163163_10678223
501 Ga0163163_11439222
502 Ga0157380_10000396
503 Ga0157380_11030544
504 Ga0157377_10346836
505 Ga0157377_10561245
506 Ga0157377_10833280
507 Ga0157377_11102485
508 Ga0157379_10072632
509 Ga0157379_10160228
510 Ga0157379_10416223
511 Ga0157379_10799389
512 Ga0163161_11442485
513 Ga0207656_10040404
514 Ga0207710_10000575
515 Ga0207710_10289663
516 Ga0207688_10035806
517 Ga0207647_10163950
518 Ga0207645_10061504
519 Ga0207684_10527629
520 Ga0207654_10035589
521 Ga0207654_10194596
522 Ga0207707_10043224
523 Ga0207671_10004666
524 Ga0207660_10011501
525 Ga0207662_10085264
526 Ga0207662_10101392
527 Ga0207649_10830963
528 Ga0207652_10032165
529 Ga0207694_10003281
530 Ga0207650_10664573
531 Ga0207644_10311494
532 Ga0207690_10009856
533 Ga0207686_10493857
534 Ga0207665_10059739
535 Ga0207691_10836535
536 Ga0207711_10004098
537 Ga0207711_10008234
538 Ga0207711_10541146
539 Ga0207689_10197084
540 Ga0207689_10217748
541 Ga0207712_10000081
542 Ga0207712_10004444
543 Ga0207712_10936511
544 Ga0207640_10493382
545 Ga0207677_10130902
546 Ga0207703_10080350
547 Ga0207703_10138943
548 Ga0207703_10615835
549 Ga0207639_11019800
550 Ga0207708_10578476
551 Ga0207702_10086434
552 Ga0207641_10452061
553 Ga0207641_12143763
554 Ga0207648_10359957
555 Ga0207674_10000058
556 Ga0207675_100721959
557 Ga0207698_10039989
558 Ga0207698_10210122
559 Ga0207698_10655464
560 Ga0207698_12413755
561 Ga0207428_10013108
562 Ga0268265_11471333
563 Ga0268264_10027892
564 Ga0268264_10202188
565 Ga0307416_100131898
566 Ga0307416_100602207
567 Ga0307414_10012176
568 Ga0373930_0107937
569 Ga0373940_0065483
570 Ga0373940_0353484
571 Ga0373949_0047026
572 Ga0373951_0000344
573 Ga0373951_0019826
574 Ga0373951_0108191
575 Ga0373952_0062884
576 Ga0373941_0029872
577 Ga0373941_0195136
578 Ga0373961_0060458
579 Ga0373931_0093776
580 Ga0373931_1061922
581 Ga0395900_1232496
582 Ga0395905_0595607
583 Ga0395901_0348840
584 Ga0242419_006144
585 Ga0242422_00204
586 Ga0242420_013194
587 Ga0439448_0010185
588 Ga0439455_0043642
589 Ga0450914_063786
590 Ga0439458_0004252
591 Ga0439464_0325351
592 Ga0451576_0137768
593 Ga0496100_0434270
594 Ga0496100_0444088
595 Ga0496102_0045769
596 Ga0496102_0734268
597 Ga0496103_0230231
598 Ga0496103_0627378
599 Ga0496106_0012081
600 Ga0496106_0084306
601 Ga0496106_0212545
602 Ga0496106_0875489
603 Ga0496108_0289145
604 Ga0496108_1490617
605 Ga0496109_0730862
606 Ga0496109_0767525
607 Ga0496112_0054171
608 Ga0496112_0114615
609 Ga0496112_0371164
610 Ga0496112_0647146
611 Ga0496113_0531173
612 Ga0496113_0545719
613 Ga0501292_035965
614 Ga0501298_016522
615 Ga0501333_021519
616 Ga0501198_001047
617 Ga0501202_081079
618 Ga0501207_029191
619 Ga0501208_018593
620 Ga0501214_004274
621 Ga0501216_050770
622 Ga0501217_002950
623 Ga0501223_096270
624 Ga0501224_007072
625 Ga0501230_017296
626 Ga0501235_008778
627 Ga0501235_189226
628 Ga0501236_140357
629 Ga0501247_041244
630 Ga0501249_011562
631 Ga0501257_008945
632 Ga0501257_038163
633 Ga0501258_021472
634 Ga0501221_048290
635 Ga0501229_007372
636 Ga0501234_003386
637 Ga0501245_159785
638 Ga0501241_030509
639 Ga0501268_007928
640 Ga0501271_044953
641 Ga0501273_040758
642 nmdc:mga05p37_1039064_c1
643 nmdc:mga05p37_143453_c1
644 nmdc:mga05p37_361908_c1
645 nmdc:mga05p37_401847_c1
646 nmdc:mga09592_1628217_c1
647 nmdc:mga09592_165062_c1
648 nmdc:mga0qj67_19659_c1
649 nmdc:mga06r32_46958_c1
650 nmdc:mga08y16_27376_c1
651 nmdc:mga0n895_2069285_c1
652 nmdc:mga0n895_41506_c1
653 nmdc:mga0n895_531085_c1
654 nmdc:mga0n895_761548_c1
655 nmdc:mga0rr50_276986_c1
656 nmdc:mga0rr50_393733_c1
657 nmdc:mga0a205_14160_c1
658 nmdc:mga0a205_226852_c1
659 nmdc:mga0a205_269021_c1
660 nmdc:mga0a205_9020_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map