F410065

General Info

Members Datasets Scaffolds Average Seq Length
330 204 660 323

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10000047|Ga0105238_1000004787
Length 352
Sequence MTKQVITLDPACYQRHVIHAQERQWAETNCYVDVWIELLHAWGFEPIAALPFTLAADFEGDQWTFFKFPLADLDELFGIDVQELMIWRPLIDDIEEQVRLGRPILVEMDSYFLPDTAGTAYQREHVKSTVAIVEINRAAQRLGYFHGQGYYHLSGDDFVNVLHLNGIPHSSVLPPYVEIAKRRAIKPLTGDALTQVSLQRLSAELSKLPDQNPFEKFKPRFAADLNWLTEQPIEIFHQYSFATLRQFGACYELSATYLKWLQSRGVTDLDRVTEQFASLSTGAKTMQFQLARAMARKRTLDISPIDQMSGVWRAATDELKSRFLSARVSDMTAPVRSSTAGSGSSPAIAQTV

Samples

Sample ID Description Type Environment
1 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
59 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
93 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
94 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
95 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
142 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
143 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
144 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
145 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
146 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
148 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
149 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
150 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
151 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
152 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
153 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
154 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
155 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
156 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
157 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
158 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
159 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
160 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
161 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
162 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
163 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
164 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
165 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
166 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
167 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
168 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
169 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
170 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
171 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
172 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
173 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
174 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
175 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
176 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
179 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
180 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
181 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
182 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
183 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
184 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
185 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
186 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
190 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
191 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
192 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
193 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
194 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
195 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
196 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
197 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
198 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
199 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
200 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
201 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
202 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
203 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
204 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.42
Nodule 0
Rhizoplane 2.73
Rhizosphere 90
Stem 0
Stem Tuber 0
Unclassified 4.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105238_10000047 3300009551 Bacteria 147271
2 Ga0065712_10072208 3300005290 Bacteria 4813
3 Ga0070658_10084601 3300005327 Bacteria 2608
4 Ga0070658_10147375 3300005327 Bacteria 1969
5 Ga0070676_10008360 3300005328 Bacteria 5576
6 Ga0070683_100007742 3300005329 Bacteria 9097
7 Ga0070683_100062502 3300005329 Bacteria 3463
8 Ga0070683_100141704 3300005329 Bacteria 2277
9 Ga0070683_100347606 3300005329 Unclassified 1412
10 Ga0070690_100022251 3300005330 Bacteria 3877
11 Ga0070677_10014705 3300005333 Bacteria 2760
12 Ga0070666_10058770 3300005335 Bacteria 2600
13 Ga0070680_100006396 3300005336 Bacteria 8950
14 Ga0070682_100009405 3300005337 Bacteria 5530
15 Ga0068868_100002075 3300005338 Bacteria 13781
16 Ga0070660_100018984 3300005339 Bacteria 5033
17 Ga0070689_100010317 3300005340 Bacteria 6659
18 Ga0070689_100030778 3300005340 Bacteria 4075
19 Ga0070689_100118709 3300005340 Bacteria 2111
20 Ga0070689_100183993 3300005340 Bacteria 1698
21 Ga0070687_100005570 3300005343 Bacteria 5107
22 Ga0070687_100044419 3300005343 Unclassified 2263
23 Ga0070661_100005842 3300005344 Bacteria 8461
24 Ga0070661_100006926 3300005344 Bacteria 7824
25 Ga0070661_100014322 3300005344 Bacteria 5586
26 Ga0070661_100078865 3300005344 Bacteria 2429
27 Ga0070668_100035970 3300005347 Bacteria 3779
28 Ga0070669_100009467 3300005353 Bacteria 6939
29 Ga0070669_100118681 3300005353 Bacteria 2015
30 Ga0070675_100045424 3300005354 Bacteria 3594
31 Ga0070675_100045634 3300005354 Bacteria 3586
32 Ga0070675_100378686 3300005354 Bacteria 1259
33 Ga0070671_100000013 3300005355 Bacteria 173287
34 Ga0070671_100001034 3300005355 Bacteria 20469
35 Ga0070671_100031131 3300005355 Bacteria 4406
36 Ga0070674_100180212 3300005356 Bacteria 1618
37 Ga0070674_100181741 3300005356 Bacteria 1611
38 Ga0070673_100014158 3300005364 Bacteria 5544
39 Ga0070673_100163159 3300005364 Bacteria 1896
40 Ga0070688_100003206 3300005365 Bacteria 8381
41 Ga0070659_100010502 3300005366 Bacteria 6813
42 Ga0070659_100153858 3300005366 Unclassified 1877
43 Ga0070659_100219428 3300005366 Unclassified 1569
44 Ga0070667_100021003 3300005367 Bacteria 5424
45 Ga0070709_10010459 3300005434 Bacteria 5142
46 Ga0070709_10303352 3300005434 Bacteria 1167
47 Ga0070713_100006944 3300005436 Bacteria 7903
48 Ga0070705_100043441 3300005440 Bacteria 2575
49 Ga0070705_100212606 3300005440 Unclassified 1334
50 Ga0070663_100131791 3300005455 Bacteria 1899
51 Ga0070678_100044812 3300005456 Bacteria 3161
52 Ga0070681_10022346 3300005458 Bacteria 6351
53 Ga0068867_100123878 3300005459 Bacteria 2001
54 Ga0068867_100256354 3300005459 Bacteria 1424
55 Ga0070685_10050311 3300005466 Bacteria 2407
56 Ga0070699_100136631 3300005518 Bacteria 2163
57 Ga0070679_100000757 3300005530 Bacteria 27998
58 Ga0070679_100006902 3300005530 Bacteria 10588
59 Ga0070684_100018670 3300005535 Bacteria 5719
60 Ga0068853_100028357 3300005539 Bacteria 4709
61 Ga0070672_100007686 3300005543 Bacteria 7340
62 Ga0070672_100070753 3300005543 Bacteria 2773
63 Ga0070686_100004353 3300005544 Bacteria 7802
64 Ga0070686_100074911 3300005544 Bacteria 2226
65 Ga0070696_100072639 3300005546 Bacteria 2423
66 Ga0070693_100013725 3300005547 Bacteria 4134
67 Ga0070693_100027858 3300005547 Bacteria 3066
68 Ga0070665_100061217 3300005548 Bacteria 3773
69 Ga0070704_100006772 3300005549 Bacteria 6785
70 Ga0070704_100047530 3300005549 Bacteria 3000
71 Ga0068855_100086357 3300005563 Bacteria 3628
72 Ga0070664_100005635 3300005564 Bacteria 10081
73 Ga0070664_100010247 3300005564 Bacteria 7601
74 Ga0068857_100109341 3300005577 Bacteria 2484
75 Ga0068854_100055182 3300005578 Bacteria 2859
76 Ga0068856_100009312 3300005614 Bacteria 9540
77 Ga0068852_100006847 3300005616 Bacteria 8280
78 Ga0068852_100036152 3300005616 Bacteria 4130
79 Ga0068852_100136305 3300005616 Bacteria 2267
80 Ga0068859_100058595 3300005617 Bacteria 3879
81 Ga0068859_100130393 3300005617 Bacteria 2585
82 Ga0068864_100315414 3300005618 Bacteria 1467
83 Ga0068861_100248457 3300005719 Bacteria 1517
84 Ga0068851_10056195 3300005834 Bacteria 2007
85 Ga0068870_10001164 3300005840 Bacteria 10522
86 Ga0068863_100006826 3300005841 Bacteria 11195
87 Ga0068863_100036388 3300005841 Bacteria 4689
88 Ga0068863_100064190 3300005841 Bacteria 3473
89 Ga0068858_100007720 3300005842 Bacteria 10384
90 Ga0068858_100027180 3300005842 Bacteria 5316
91 Ga0068858_100109530 3300005842 Bacteria 2578
92 Ga0068858_100363290 3300005842 Bacteria 1388
93 Ga0068860_100047706 3300005843 Bacteria 4082
94 Ga0068862_100014709 3300005844 Bacteria 6499
95 Ga0068862_100147481 3300005844 Bacteria 2092
96 Ga0068862_100201112 3300005844 Bacteria 1796
97 Ga0075365_10101138 3300006038 Bacteria 1974
98 Ga0075432_10031382 3300006058 Bacteria 1839
99 Ga0097621_100064198 3300006237 Bacteria 3019
100 Ga0068871_100023861 3300006358 Bacteria 4738
101 Ga0068871_100050732 3300006358 Bacteria 3357
102 Ga0075428_100008319 3300006844 Bacteria 11496
103 Ga0075428_100140711 3300006844 Bacteria 2624
104 Ga0075430_100038514 3300006846 Bacteria 4049
105 Ga0075431_100007456 3300006847 Bacteria 10896
106 Ga0075434_100002810 3300006871 Bacteria 15419
107 Ga0075429_100060872 3300006880 Unclassified 3288
108 Ga0068865_100020344 3300006881 Bacteria 4303
109 Ga0068865_100145410 3300006881 Bacteria 1793
110 Ga0097620_100058600 3300006931 Bacteria 3879
111 Ga0097620_100130383 3300006931 Bacteria 2585
112 Ga0105240_10153768 3300009093 Bacteria 2738
113 Ga0105240_10318984 3300009093 Bacteria 1772
114 Ga0111539_10013067 3300009094 Bacteria 10388
115 Ga0105245_10000790 3300009098 Bacteria 28717
116 Ga0105245_10113587 3300009098 Bacteria 2522
117 Ga0105245_10121075 3300009098 Bacteria 2445
118 Ga0105245_10181843 3300009098 Bacteria 2009
119 Ga0105245_10317897 3300009098 Bacteria 1533
120 Ga0105243_10077891 3300009148 Bacteria 2698
121 Ga0105243_10226525 3300009148 Bacteria 1656
122 Ga0105241_10321843 3300009174 Bacteria 1334
123 Ga0105242_10002639 3300009176 Bacteria 14057
124 Ga0105242_10026442 3300009176 Bacteria 4600
125 Ga0105248_10109343 3300009177 Bacteria 3117
126 Ga0105248_10111360 3300009177 Bacteria 3087
127 Ga0105248_10176434 3300009177 Bacteria 2408
128 Ga0105237_10296519 3300009545 Bacteria 1620
129 Ga0105237_10457648 3300009545 Unclassified 1282
130 Ga0105238_10014266 3300009551 Bacteria 8032
131 Ga0105238_10138247 3300009551 Bacteria 2414
132 Ga0105238_10151183 3300009551 Bacteria 2297
133 Ga0105249_10019231 3300009553 Bacteria 6091
134 Ga0105249_10146062 3300009553 Bacteria 2273
135 Ga0105249_10258033 3300009553 Bacteria 1731
136 Ga0105246_10061894 3300011119 Unclassified 2605
137 Ga0157371_10152327 3300013102 Bacteria 1649
138 Ga0157370_10021912 3300013104 Bacteria 6364
139 Ga0157370_10024376 3300013104 Bacteria 5992
140 Ga0157369_10000392 3300013105 Bacteria 58326
141 Ga0157369_10009807 3300013105 Bacteria 10954
142 Ga0157369_10027667 3300013105 Bacteria 6283
143 Ga0157374_10115084 3300013296 Bacteria 2590
144 Ga0157378_10276424 3300013297 Bacteria 1617
145 Ga0157378_10311690 3300013297 Bacteria 1526
146 Ga0163162_10006361 3300013306 Bacteria 11434
147 Ga0163162_10231614 3300013306 Bacteria 1978
148 Ga0163162_10474248 3300013306 Bacteria 1383
149 Ga0157372_10002907 3300013307 Bacteria 18530
150 Ga0157372_10009243 3300013307 Bacteria 10480
151 Ga0157372_10013505 3300013307 Bacteria 8729
152 Ga0157372_10015698 3300013307 Bacteria 8122
153 Ga0157375_10222348 3300013308 Bacteria 2047
154 Ga0157380_10038912 3300014326 Bacteria 3695
155 Ga0157380_10086611 3300014326 Bacteria 2574
156 Ga0157380_10150387 3300014326 Bacteria 2012
157 Ga0157380_10265513 3300014326 Bacteria 1561
158 Ga0157377_10016990 3300014745 Unclassified 3756
159 Ga0157379_10019761 3300014968 Bacteria 5952
160 Ga0157379_10053119 3300014968 Bacteria 3620
161 Ga0157379_10155003 3300014968 Bacteria 2066
162 Ga0157379_10188094 3300014968 Unclassified 1866
163 Ga0157376_10013800 3300014969 Bacteria 6040
164 Ga0157376_10144055 3300014969 Bacteria 2141
165 Ga0163161_10011903 3300017792 Bacteria 6038
166 Ga0213873_10000005 3300021358 Bacteria 416778
167 Ga0213874_10000122 3300021377 Bacteria 12962
168 Ga0213876_10000010 3300021384 Bacteria 492549
169 Ga0213876_10009302 3300021384 Bacteria 5293
170 Ga0213876_10018355 3300021384 Bacteria 3694
171 Ga0207697_10000885 3300025315 Bacteria 16956
172 Ga0207653_10042575 3300025885 Bacteria 1494
173 Ga0207699_10065423 3300025906 Bacteria 2204
174 Ga0207643_10001109 3300025908 Bacteria 15982
175 Ga0207705_10020968 3300025909 Bacteria 4662
176 Ga0207705_10047710 3300025909 Unclassified 3079
177 Ga0207654_10311545 3300025911 Bacteria 1073
178 Ga0207707_10218438 3300025912 Bacteria 1659
179 Ga0207663_10023586 3300025916 Bacteria 3533
180 Ga0207660_10034139 3300025917 Bacteria 3524
181 Ga0207662_10002846 3300025918 Bacteria 8750
182 Ga0207662_10057771 3300025918 Unclassified 2320
183 Ga0207649_10003416 3300025920 Bacteria 8682
184 Ga0207649_10004893 3300025920 Bacteria 7243
185 Ga0207649_10011407 3300025920 Bacteria 4900
186 Ga0207649_10014277 3300025920 Bacteria 4444
187 Ga0207652_10002812 3300025921 Bacteria 14607
188 Ga0207652_10008644 3300025921 Bacteria 8195
189 Ga0207646_10302616 3300025922 Bacteria 1445
190 Ga0207694_10001143 3300025924 Bacteria 23022
191 Ga0207659_10118053 3300025926 Bacteria 2028
192 Ga0207687_10015278 3300025927 Bacteria 5031
193 Ga0207687_10046524 3300025927 Bacteria 3004
194 Ga0207644_10000407 3300025931 Bacteria 28083
195 Ga0207644_10008501 3300025931 Bacteria 6717
196 Ga0207690_10039002 3300025932 Bacteria 3096
197 Ga0207706_10026512 3300025933 Bacteria 5187
198 Ga0207706_10190977 3300025933 Bacteria 1798
199 Ga0207686_10012791 3300025934 Bacteria 4622
200 Ga0207686_10021008 3300025934 Bacteria 3739
201 Ga0207670_10093223 3300025936 Bacteria 2133
202 Ga0207670_10129543 3300025936 Bacteria 1846
203 Ga0207669_10183462 3300025937 Bacteria 1503
204 Ga0207704_10039008 3300025938 Bacteria 2761
205 Ga0207691_10014161 3300025940 Bacteria 7608
206 Ga0207691_10044778 3300025940 Bacteria 4071
207 Ga0207711_10132766 3300025941 Bacteria 2234
208 Ga0207689_10001922 3300025942 Bacteria 19645
209 Ga0207689_10029722 3300025942 Bacteria 4559
210 Ga0207661_10000355 3300025944 Bacteria 29530
211 Ga0207679_10005134 3300025945 Bacteria 8195
212 Ga0207679_10354836 3300025945 Unclassified 1279
213 Ga0207667_10130395 3300025949 Bacteria 2590
214 Ga0207651_10022631 3300025960 Bacteria 3848
215 Ga0207651_10025201 3300025960 Bacteria 3694
216 Ga0207651_10330463 3300025960 Bacteria 1277
217 Ga0207712_10006777 3300025961 Bacteria 7224
218 Ga0207668_10095366 3300025972 Bacteria 2196
219 Ga0207677_10019669 3300026023 Bacteria 4083
220 Ga0207703_10012941 3300026035 Bacteria 6503
221 Ga0207703_10353043 3300026035 Bacteria 1354
222 Ga0207639_10009126 3300026041 Bacteria 6835
223 Ga0207639_10028511 3300026041 Bacteria 4077
224 Ga0207708_10266523 3300026075 Bacteria 1384
225 Ga0207702_10080390 3300026078 Bacteria 2828
226 Ga0207641_10008499 3300026088 Bacteria 8487
227 Ga0207641_10009756 3300026088 Bacteria 7907
228 Ga0207641_10268283 3300026088 Bacteria 1601
229 Ga0207648_10037038 3300026089 Bacteria 4297
230 Ga0207648_10174189 3300026089 Bacteria 1902
231 Ga0207674_10015698 3300026116 Bacteria 8310
232 Ga0207674_10054605 3300026116 Bacteria 4066
233 Ga0207674_10060282 3300026116 Bacteria 3838
234 Ga0207675_100001969 3300026118 Bacteria 20473
235 Ga0207683_10126467 3300026121 Bacteria 2297
236 Ga0207683_10196915 3300026121 Bacteria 1831
237 Ga0207698_10005779 3300026142 Bacteria 7677
238 Ga0207698_10044106 3300026142 Bacteria 3348
239 Ga0207428_10002759 3300027907 Bacteria 17463
240 Ga0268266_10067936 3300028379 Bacteria 3086
241 Ga0268264_10059908 3300028381 Bacteria 3190
242 Ga0265327_10000504 3300031251 Bacteria 67749
243 Ga0265327_10008453 3300031251 Bacteria 7660
244 Ga0307509_10146523 3300031507 Bacteria 2286
245 Ga0373948_0001128 3300034817 Bacteria 3615
246 Ga0373955_0118046 3300035172 Bacteria 1539
247 Ga0373931_0000010 3300035691 Bacteria 334069
248 Ga0373937_0077763 3300036401 Bacteria 3066
249 Ga0395905_0014288 3300037471 Bacteria 7586
250 Ga0395905_0379486 3300037471 Bacteria 1307
251 Ga0400483_131995 3300039062 Bacteria 1486
252 Ga0400483_212396 3300039062 Bacteria 2453
253 Ga0436365_0356386 3300039437 Bacteria 16795
254 Ga0436365_0433300 3300039437 Bacteria 9449
255 Ga0436365_1098988 3300039437 Bacteria 1716
256 Ga0436365_1910716 3300039437 Bacteria 133047
257 Ga0436360_0280457 3300039438 Bacteria 2067
258 Ga0436363_0983181 3300039450 Bacteria 38641
259 Ga0436363_1386081 3300039450 Bacteria 1999
260 Ga0436362_0270001 3300039453 Bacteria 1647
261 Ga0436362_0270182 3300039453 Bacteria 2377
262 Ga0436362_0273161 3300039453 Bacteria 561309
263 Ga0451807_0636809 3300041486 Bacteria 1094
264 Ga0466969_0054421 3300044656 Bacteria 1960
265 Ga0466966_0075804 3300044684 Bacteria 2101
266 Ga0466961_0002844 3300044693 Bacteria 10736
267 Ga0466961_0027266 3300044693 Bacteria 3673
268 Ga0466963_0000966 3300044694 Bacteria 14757
269 Ga0466963_0055156 3300044694 Bacteria 2642
270 Ga0466963_0122949 3300044694 Bacteria 1787
271 Ga0466964_0002575 3300044706 Bacteria 6473
272 Ga0453684_0007951 3300044712 Bacteria 19225
273 Ga0466971_0005184 3300044719 Bacteria 5641
274 Ga0466968_0008976 3300044735 Bacteria 3842
275 Ga0466970_0050334 3300044765 Bacteria 2222
276 Ga0466970_0112723 3300044765 Bacteria 1486
277 Ga0466957_0002654 3300044842 Bacteria 9651
278 Ga0466959_0004711 3300045049 Bacteria 9186
279 Ga0451576_0033241 3300045051 Bacteria 5482
280 Ga0451576_0628041 3300045051 Bacteria 1129
281 Ga0466958_0005778 3300045836 Bacteria 6688
282 Ga0466958_0071064 3300045836 Bacteria 2131
283 Ga0466967_0009792 3300045976 Bacteria 7146
284 Ga0466967_0077053 3300045976 Bacteria 3000
285 Ga0466967_0545887 3300045976 Bacteria 1141
286 Ga0495592_0018076 3300046454 Bacteria 5356
287 Ga0495651_0200264 3300046462 Bacteria 1398
288 Ga0495628_0082024 3300046516 Unclassified 2505
289 Ga0495652_0073453 3300046529 Bacteria 2848
290 Ga0495645_0004824 3300046543 Bacteria 9215
291 Ga0495657_0074814 3300046675 Bacteria 2203
292 Ga0495599_0022980 3300046678 Bacteria 3895
293 Ga0495623_0014429 3300046679 Bacteria 5114
294 Ga0495684_0214971 3300047471 Bacteria 1412
295 Ga0496104_0024572 3300048907 Bacteria 5544
296 Ga0496108_0024229 3300048911 Bacteria 4997
297 Ga0496109_0002552 3300048912 Bacteria 15259
298 Ga0496109_0339700 3300048912 Unclassified 1418
299 Ga0496110_0009963 3300048913 Bacteria 7708
300 Ga0496111_0002101 3300048914 Bacteria 11888
301 Ga0496112_0006139 3300048915 Bacteria 10502
302 Ga0496112_0388654 3300048915 Bacteria 1336
303 Ga0496119_0001237 3300048922 Bacteria 31763
304 Ga0496120_0025995 3300048923 Bacteria 3624
305 Ga0496124_0024290 3300048927 Bacteria 5515
306 Ga0501033_0000342 3300049570 Bacteria 44372
307 Ga0501034_0004329 3300049571 Bacteria 15833
308 Ga0501036_0266639 3300049572 Bacteria 1434
309 Ga0501069_0046796 3300049585 Bacteria 2400
310 Ga0501044_0001396 3300049823 Bacteria 28299
311 nmdc:mga0yw44_143493_c1 3300050492 Bacteria 1553
312 nmdc:mga0yw44_3815_c1 3300050492 Bacteria 6770
313 nmdc:mga0yw44_44097_c1 3300050492 Bacteria 2666
314 nmdc:mga06z11_116682_c1 3300050494 Bacteria 1484
315 nmdc:mga05p37_328477_c1 3300050507 Bacteria 1807
316 nmdc:mga09592_868_c1 3300050508 Bacteria 23666
317 nmdc:mga0qj67_131475_c1 3300050509 Bacteria 2027
318 nmdc:mga0qj67_14886_c1 3300050509 Bacteria 5884
319 nmdc:mga06r32_6080_c1 3300050510 Bacteria 10846
320 nmdc:mga06r32_65119_c1 3300050510 Bacteria 3515
321 nmdc:mga0n895_75557_c1 3300050512 Bacteria 3349
322 nmdc:mga0n895_92016_c1 3300050512 Bacteria 3036
323 nmdc:mga0rr50_70181_c1 3300050513 Bacteria 2669
324 Ga0495595_0086612 3300053084 Bacteria 1499
325 Ga0495619_0043220 3300053085 Bacteria 2954
326 Ga0495619_0144477 3300053085 Bacteria 1640
327 Ga0500566_0000455 3300053094 Bacteria 22754
328 Ga0500595_002819 3300053119 Bacteria 8361
329 Ga0500564_000854 3300053138 Bacteria 9826
330 Ga0466962_0000126 3300061719 Bacteria 31190
331 Ga0105238_10000047
332 Ga0065712_10072208
333 Ga0070658_10084601
334 Ga0070658_10147375
335 Ga0070676_10008360
336 Ga0070683_100007742
337 Ga0070683_100062502
338 Ga0070683_100141704
339 Ga0070683_100347606
340 Ga0070690_100022251
341 Ga0070677_10014705
342 Ga0070666_10058770
343 Ga0070680_100006396
344 Ga0070682_100009405
345 Ga0068868_100002075
346 Ga0070660_100018984
347 Ga0070689_100010317
348 Ga0070689_100030778
349 Ga0070689_100118709
350 Ga0070689_100183993
351 Ga0070687_100005570
352 Ga0070687_100044419
353 Ga0070661_100005842
354 Ga0070661_100006926
355 Ga0070661_100014322
356 Ga0070661_100078865
357 Ga0070668_100035970
358 Ga0070669_100009467
359 Ga0070669_100118681
360 Ga0070675_100045424
361 Ga0070675_100045634
362 Ga0070675_100378686
363 Ga0070671_100000013
364 Ga0070671_100001034
365 Ga0070671_100031131
366 Ga0070674_100180212
367 Ga0070674_100181741
368 Ga0070673_100014158
369 Ga0070673_100163159
370 Ga0070688_100003206
371 Ga0070659_100010502
372 Ga0070659_100153858
373 Ga0070659_100219428
374 Ga0070667_100021003
375 Ga0070709_10010459
376 Ga0070709_10303352
377 Ga0070713_100006944
378 Ga0070705_100043441
379 Ga0070705_100212606
380 Ga0070663_100131791
381 Ga0070678_100044812
382 Ga0070681_10022346
383 Ga0068867_100123878
384 Ga0068867_100256354
385 Ga0070685_10050311
386 Ga0070699_100136631
387 Ga0070679_100000757
388 Ga0070679_100006902
389 Ga0070684_100018670
390 Ga0068853_100028357
391 Ga0070672_100007686
392 Ga0070672_100070753
393 Ga0070686_100004353
394 Ga0070686_100074911
395 Ga0070696_100072639
396 Ga0070693_100013725
397 Ga0070693_100027858
398 Ga0070665_100061217
399 Ga0070704_100006772
400 Ga0070704_100047530
401 Ga0068855_100086357
402 Ga0070664_100005635
403 Ga0070664_100010247
404 Ga0068857_100109341
405 Ga0068854_100055182
406 Ga0068856_100009312
407 Ga0068852_100006847
408 Ga0068852_100036152
409 Ga0068852_100136305
410 Ga0068859_100058595
411 Ga0068859_100130393
412 Ga0068864_100315414
413 Ga0068861_100248457
414 Ga0068851_10056195
415 Ga0068870_10001164
416 Ga0068863_100006826
417 Ga0068863_100036388
418 Ga0068863_100064190
419 Ga0068858_100007720
420 Ga0068858_100027180
421 Ga0068858_100109530
422 Ga0068858_100363290
423 Ga0068860_100047706
424 Ga0068862_100014709
425 Ga0068862_100147481
426 Ga0068862_100201112
427 Ga0075365_10101138
428 Ga0075432_10031382
429 Ga0097621_100064198
430 Ga0068871_100023861
431 Ga0068871_100050732
432 Ga0075428_100008319
433 Ga0075428_100140711
434 Ga0075430_100038514
435 Ga0075431_100007456
436 Ga0075434_100002810
437 Ga0075429_100060872
438 Ga0068865_100020344
439 Ga0068865_100145410
440 Ga0097620_100058600
441 Ga0097620_100130383
442 Ga0105240_10153768
443 Ga0105240_10318984
444 Ga0111539_10013067
445 Ga0105245_10000790
446 Ga0105245_10113587
447 Ga0105245_10121075
448 Ga0105245_10181843
449 Ga0105245_10317897
450 Ga0105243_10077891
451 Ga0105243_10226525
452 Ga0105241_10321843
453 Ga0105242_10002639
454 Ga0105242_10026442
455 Ga0105248_10109343
456 Ga0105248_10111360
457 Ga0105248_10176434
458 Ga0105237_10296519
459 Ga0105237_10457648
460 Ga0105238_10014266
461 Ga0105238_10138247
462 Ga0105238_10151183
463 Ga0105249_10019231
464 Ga0105249_10146062
465 Ga0105249_10258033
466 Ga0105246_10061894
467 Ga0157371_10152327
468 Ga0157370_10021912
469 Ga0157370_10024376
470 Ga0157369_10000392
471 Ga0157369_10009807
472 Ga0157369_10027667
473 Ga0157374_10115084
474 Ga0157378_10276424
475 Ga0157378_10311690
476 Ga0163162_10006361
477 Ga0163162_10231614
478 Ga0163162_10474248
479 Ga0157372_10002907
480 Ga0157372_10009243
481 Ga0157372_10013505
482 Ga0157372_10015698
483 Ga0157375_10222348
484 Ga0157380_10038912
485 Ga0157380_10086611
486 Ga0157380_10150387
487 Ga0157380_10265513
488 Ga0157377_10016990
489 Ga0157379_10019761
490 Ga0157379_10053119
491 Ga0157379_10155003
492 Ga0157379_10188094
493 Ga0157376_10013800
494 Ga0157376_10144055
495 Ga0163161_10011903
496 Ga0213873_10000005
497 Ga0213874_10000122
498 Ga0213876_10000010
499 Ga0213876_10009302
500 Ga0213876_10018355
501 Ga0207697_10000885
502 Ga0207653_10042575
503 Ga0207699_10065423
504 Ga0207643_10001109
505 Ga0207705_10020968
506 Ga0207705_10047710
507 Ga0207654_10311545
508 Ga0207707_10218438
509 Ga0207663_10023586
510 Ga0207660_10034139
511 Ga0207662_10002846
512 Ga0207662_10057771
513 Ga0207649_10003416
514 Ga0207649_10004893
515 Ga0207649_10011407
516 Ga0207649_10014277
517 Ga0207652_10002812
518 Ga0207652_10008644
519 Ga0207646_10302616
520 Ga0207694_10001143
521 Ga0207659_10118053
522 Ga0207687_10015278
523 Ga0207687_10046524
524 Ga0207644_10000407
525 Ga0207644_10008501
526 Ga0207690_10039002
527 Ga0207706_10026512
528 Ga0207706_10190977
529 Ga0207686_10012791
530 Ga0207686_10021008
531 Ga0207670_10093223
532 Ga0207670_10129543
533 Ga0207669_10183462
534 Ga0207704_10039008
535 Ga0207691_10014161
536 Ga0207691_10044778
537 Ga0207711_10132766
538 Ga0207689_10001922
539 Ga0207689_10029722
540 Ga0207661_10000355
541 Ga0207679_10005134
542 Ga0207679_10354836
543 Ga0207667_10130395
544 Ga0207651_10022631
545 Ga0207651_10025201
546 Ga0207651_10330463
547 Ga0207712_10006777
548 Ga0207668_10095366
549 Ga0207677_10019669
550 Ga0207703_10012941
551 Ga0207703_10353043
552 Ga0207639_10009126
553 Ga0207639_10028511
554 Ga0207708_10266523
555 Ga0207702_10080390
556 Ga0207641_10008499
557 Ga0207641_10009756
558 Ga0207641_10268283
559 Ga0207648_10037038
560 Ga0207648_10174189
561 Ga0207674_10015698
562 Ga0207674_10054605
563 Ga0207674_10060282
564 Ga0207675_100001969
565 Ga0207683_10126467
566 Ga0207683_10196915
567 Ga0207698_10005779
568 Ga0207698_10044106
569 Ga0207428_10002759
570 Ga0268266_10067936
571 Ga0268264_10059908
572 Ga0265327_10000504
573 Ga0265327_10008453
574 Ga0307509_10146523
575 Ga0373948_0001128
576 Ga0373955_0118046
577 Ga0373931_0000010
578 Ga0373937_0077763
579 Ga0395905_0014288
580 Ga0395905_0379486
581 Ga0400483_131995
582 Ga0400483_212396
583 Ga0436365_0356386
584 Ga0436365_0433300
585 Ga0436365_1098988
586 Ga0436365_1910716
587 Ga0436360_0280457
588 Ga0436363_0983181
589 Ga0436363_1386081
590 Ga0436362_0270001
591 Ga0436362_0270182
592 Ga0436362_0273161
593 Ga0451807_0636809
594 Ga0466969_0054421
595 Ga0466966_0075804
596 Ga0466961_0002844
597 Ga0466961_0027266
598 Ga0466963_0000966
599 Ga0466963_0055156
600 Ga0466963_0122949
601 Ga0466964_0002575
602 Ga0453684_0007951
603 Ga0466971_0005184
604 Ga0466968_0008976
605 Ga0466970_0050334
606 Ga0466970_0112723
607 Ga0466957_0002654
608 Ga0466959_0004711
609 Ga0451576_0033241
610 Ga0451576_0628041
611 Ga0466958_0005778
612 Ga0466958_0071064
613 Ga0466967_0009792
614 Ga0466967_0077053
615 Ga0466967_0545887
616 Ga0495592_0018076
617 Ga0495651_0200264
618 Ga0495628_0082024
619 Ga0495652_0073453
620 Ga0495645_0004824
621 Ga0495657_0074814
622 Ga0495599_0022980
623 Ga0495623_0014429
624 Ga0495684_0214971
625 Ga0496104_0024572
626 Ga0496108_0024229
627 Ga0496109_0002552
628 Ga0496109_0339700
629 Ga0496110_0009963
630 Ga0496111_0002101
631 Ga0496112_0006139
632 Ga0496112_0388654
633 Ga0496119_0001237
634 Ga0496120_0025995
635 Ga0496124_0024290
636 Ga0501033_0000342
637 Ga0501034_0004329
638 Ga0501036_0266639
639 Ga0501069_0046796
640 Ga0501044_0001396
641 nmdc:mga0yw44_143493_c1
642 nmdc:mga0yw44_3815_c1
643 nmdc:mga0yw44_44097_c1
644 nmdc:mga06z11_116682_c1
645 nmdc:mga05p37_328477_c1
646 nmdc:mga09592_868_c1
647 nmdc:mga0qj67_131475_c1
648 nmdc:mga0qj67_14886_c1
649 nmdc:mga06r32_6080_c1
650 nmdc:mga06r32_65119_c1
651 nmdc:mga0n895_75557_c1
652 nmdc:mga0n895_92016_c1
653 nmdc:mga0rr50_70181_c1
654 Ga0495595_0086612
655 Ga0495619_0043220
656 Ga0495619_0144477
657 Ga0500566_0000455
658 Ga0500595_002819
659 Ga0500564_000854
660 Ga0466962_0000126

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08893

DUF1839

Domain of unknown function (DUF1839)

9

321

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7wux-assembly1.cif.gz_D crystal structure of aziu3/u2 complexed with (5s,6s)-o7-sulfo dadh from streptomyces sahachiroi 0.6334 30 323
7yn2-assembly1.cif.gz_A crystal structure of ccbd with methylthiolincosamide 0.6176 26 323
7wux-assembly1.cif.gz_D crystal structure of aziu3/u2 complexed with (5s,6s)-o7-sulfo dadh from streptomyces sahachiroi 0.5827 30 323
7yn2-assembly1.cif.gz_A crystal structure of ccbd with methylthiolincosamide 0.5757 26 323
6o5c-assembly1.cif.gz_B-2 x-ray crystal structure of metal-dependent transcriptional regulator mtsr 0.5494 102 176
ID Description Score Start End Superfamily
af_M0R6B5_1_137_3.90.70.10 Alpha Beta;Alpha-Beta Complex;Cathepsin B; Chain A;Cysteine proteinases 0.6794 83 165 3.90.70.10
af_Q9R0C8_786_847_2.30.30.40 Mainly Beta;Roll;SH3 type barrels.;SH3 Domains 0.6096 105 153 2.30.30.40
af_Q8BZI6_27_234_3.90.70.10 Alpha Beta;Alpha-Beta Complex;Cathepsin B; Chain A;Cysteine proteinases 0.6049 90 177 3.90.70.10
af_D3ZSU4_76_168_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.5959 248 323 1.20.140.150
af_Q2G2L0_142_214_2.30.30.90 Mainly Beta;Roll;SH3 type barrels.;Ferrous iron transport protein A (FeoA) 0.5855 104 153 2.30.30.90
ID Description Score Start End GO Terms
AF-A0A1M7IHB9-F1-model_v4 Succinylarginine dihydrolase 0.9855 1 324
AF-A0A1M7IHB9-F1-model_v4 Succinylarginine dihydrolase 0.9825 1 324
AF-A0A3D4JDB1-F1-model_v4 DUF1839 domain-containing protein 0.9806 2 224
AF-A0A7T2WYR4-F1-model_v4 merged 0.9694 9 320
AF-A0A556UK98-F1-model_v4 deleted 0.9693 14 324

Map