F409803

General Info

Members Datasets Scaffolds Average Seq Length
329 150 658 175

Family's Representative Sequence

Representative Sequence 3300046460|Ga0495638_0027087|Ga0495638_0027087_1428_2006
Length 192
Sequence MVGWDHRLFSSLPGSMLLNTLIVVATVVFMEVFSIVAHKYIMHGFGWGWHRSHHEPNVKPSGWFEKNDLYAVVFAGVAIALIWFGTEGRWPLQWIGAGMTAYGFLYFVAHDGLVHRRWPFRYTPRSGYPKRLYQAHRMHHAVEGREGAVSFGFLYAPPVATLKRRLQALHGGAPQRPLRPPGDAATGRRDAA

Samples

Sample ID Description Type Environment
1 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
2 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
3 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
11 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
12 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
13 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
14 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
15 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
16 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
17 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
18 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
19 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
20 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
21 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
22 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
25 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
26 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
27 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
28 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
29 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
30 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
31 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
32 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
33 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
34 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
35 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
36 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
37 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
38 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
39 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
40 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
41 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
42 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
43 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
44 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
45 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
46 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
47 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
48 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
49 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
50 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
51 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
52 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
53 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
54 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
55 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
56 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
57 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
58 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
59 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
60 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
61 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
62 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
63 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
64 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
65 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
66 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
67 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
68 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
69 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
70 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
71 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
72 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
73 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
74 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
75 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
76 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
77 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
78 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
79 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
80 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
81 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
82 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
83 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
84 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
85 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
86 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
87 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
88 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
89 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
90 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
91 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
92 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
93 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
94 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
95 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
96 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
97 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
98 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
99 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
100 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
101 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
102 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
103 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
104 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
105 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
106 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
107 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
108 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
109 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
110 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
111 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
112 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
113 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
114 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
115 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
116 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
117 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
118 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
119 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
120 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
121 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
122 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
123 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
124 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
125 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
126 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
127 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
128 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
129 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
130 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
131 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
132 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
133 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
134 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
135 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
136 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
137 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
138 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
139 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
140 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
141 2904424332 Duganella sp. 1411 Isolate Rhizosphere
142 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
143 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
144 3000405567 Rhodobacteraceae bacterium LNNU 3342 Isolate Rhizosphere
145 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
146 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
147 640427133 Stutzerimonas stutzeri A1501 Isolate Rhizosphere
148 651053060 Stutzerimonas stutzeri CMT.A.9 Isolate Rhizosphere
149 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
150 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.74
Metatranscriptomes 0
Isolates 4.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.13
Nodule 0
Rhizoplane 4.56
Rhizosphere 86.93
Stem 0
Stem Tuber 0
Unclassified 2.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495638_0027087 3300046460 Bacteria 3712
2 Ga0058692_1016364 3300003856 Bacteria 1649
3 Ga0065165_1001722 3300005262 Bacteria 21921
4 Ga0065714_10085389 3300005288 Bacteria 2151
5 Ga0070666_10498799 3300005335 Bacteria 882
6 Ga0070680_100000253 3300005336 Bacteria 35261
7 Ga0070682_100268172 3300005337 Bacteria 1239
8 Ga0070660_100001148 3300005339 Bacteria 17873
9 Ga0070661_100000009 3300005344 Bacteria 181351
10 Ga0070681_10049194 3300005458 Bacteria 4211
11 Ga0070679_100000015 3300005530 Bacteria 142672
12 Ga0075364_10000478 3300006051 Bacteria 20305
13 Ga0075362_10017922 3300006177 Bacteria 2924
14 Ga0105244_10176219 3300009036 Bacteria 1016
15 Ga0157372_11084534 3300013307 Bacteria 927
16 Ga0182007_10027258 3300015262 Bacteria 1971
17 Ga0182007_10258842 3300015262 Bacteria 627
18 Ga0163161_10288655 3300017792 Bacteria 1289
19 Ga0213876_10000004 3300021384 Bacteria 943822
20 Ga0209050_1038160 3300025298 Bacteria 1374
21 Ga0209257_1000231 3300025304 Bacteria 131226
22 Ga0207655_1001542 3300025728 Bacteria 20809
23 Ga0207655_1075848 3300025728 Bacteria 1232
24 Ga0207707_10041785 3300025912 Bacteria 4004
25 Ga0207660_10000573 3300025917 Bacteria 24729
26 Ga0207657_10003060 3300025919 Bacteria 17896
27 Ga0207649_10000035 3300025920 Bacteria 134650
28 Ga0207652_10000021 3300025921 Bacteria 159712
29 Ga0207679_10118101 3300025945 Bacteria 2106
30 Ga0209371_1000310 3300027312 Bacteria 54149
31 Ga0209996_1025991 3300027395 Bacteria 839
32 Ga0209983_1007121 3300027665 Bacteria 2297
33 Ga0209974_10179550 3300027876 Bacteria 775
34 Ga0268256_1000267 3300030500 Bacteria 54149
35 Ga0316181_1109543 3300030744 Bacteria 1852
36 Ga0307413_10459524 3300031824 Bacteria 1012
37 Ga0307518_10007057 3300031838 Bacteria 8035
38 Ga0307414_10051426 3300032004 Bacteria 2860
39 Ga0395898_0283050 3300037466 Bacteria 1582
40 Ga0395898_0915332 3300037466 Bacteria 815
41 Ga0395905_0276355 3300037471 Bacteria 1565
42 Ga0395905_0364375 3300037471 Bacteria 1338
43 Ga0395901_0904371 3300038443 Bacteria 864
44 Ga0436365_0192103 3300039437 Bacteria 182879
45 Ga0436362_1073687 3300039453 Bacteria 111211
46 Ga0439438_000050 3300041405 Bacteria 57662
47 Ga0439438_000415 3300041405 Bacteria 19202
48 Ga0439466_0042488 3300041411 Bacteria 1513
49 Ga0451855_1746782 3300041511 Bacteria 591
50 Ga0439445_0039910 3300042004 Bacteria 1245
51 Ga0439448_0059437 3300042005 Bacteria 1262
52 Ga0439432_182783 3300042006 Bacteria 610
53 Ga0450902_000196 3300042137 Bacteria 7089
54 Ga0450902_004014 3300042137 Bacteria 2178
55 Ga0450902_014588 3300042137 Bacteria 1272
56 Ga0450904_000055 3300042139 Bacteria 25247
57 Ga0450905_011619 3300042142 Bacteria 1232
58 Ga0450905_050428 3300042142 Bacteria 678
59 Ga0439464_0002275 3300042439 Bacteria 4698
60 Ga0450901_000514 3300042533 Bacteria 4619
61 Ga0450901_002393 3300042533 Bacteria 2027
62 Ga0466966_0104310 3300044684 Bacteria 1751
63 Ga0466968_0322937 3300044735 Bacteria 746
64 Ga0466970_0137686 3300044765 Bacteria 1344
65 Ga0466957_0000040 3300044842 Bacteria 47080
66 Ga0466959_0049396 3300045049 Bacteria 3091
67 Ga0495617_000108 3300046452 Bacteria 60724
68 Ga0495617_040059 3300046452 Bacteria 1567
69 Ga0495617_097744 3300046452 Bacteria 955
70 Ga0495627_000249 3300046453 Bacteria 55885
71 Ga0495627_000408 3300046453 Bacteria 37948
72 Ga0495627_024133 3300046453 Bacteria 1984
73 Ga0495603_0060483 3300046455 Bacteria 2238
74 Ga0495590_0000132 3300046457 Bacteria 44154
75 Ga0495591_000132 3300046458 Bacteria 81947
76 Ga0495638_0359746 3300046460 Bacteria 766
77 Ga0495650_0000248 3300046471 Bacteria 106527
78 Ga0495650_0005024 3300046471 Bacteria 8784
79 Ga0495650_0009056 3300046471 Bacteria 5711
80 Ga0495650_0014256 3300046471 Bacteria 4148
81 Ga0495605_0000407 3300046474 Bacteria 39381
82 Ga0495605_0002576 3300046474 Bacteria 11153
83 Ga0495605_0007876 3300046474 Bacteria 6031
84 Ga0495584_0000850 3300046491 Bacteria 19728
85 Ga0495584_0004710 3300046491 Bacteria 7308
86 Ga0495585_0012721 3300046492 Bacteria 4953
87 Ga0495585_0025903 3300046492 Bacteria 3354
88 Ga0495585_0105035 3300046492 Bacteria 1507
89 Ga0495594_0213105 3300046499 Bacteria 1101
90 Ga0495596_0001472 3300046500 Bacteria 13468
91 Ga0495596_0002469 3300046500 Bacteria 9931
92 Ga0495596_0006109 3300046500 Bacteria 5600
93 Ga0495596_0009641 3300046500 Bacteria 4243
94 Ga0495596_0010220 3300046500 Bacteria 4095
95 Ga0495596_0011742 3300046500 Bacteria 3763
96 Ga0495596_0081932 3300046500 Bacteria 1252
97 Ga0495596_0111848 3300046500 Bacteria 1060
98 Ga0495607_0000240 3300046501 Bacteria 58564
99 Ga0495607_0000290 3300046501 Bacteria 53251
100 Ga0495607_0006433 3300046501 Bacteria 8270
101 Ga0495607_0007814 3300046501 Bacteria 7361
102 Ga0495607_0021620 3300046501 Bacteria 4046
103 Ga0495607_0031503 3300046501 Bacteria 3246
104 Ga0495607_0131357 3300046501 Bacteria 1302
105 Ga0495583_0000839 3300046506 Bacteria 37397
106 Ga0495583_0002281 3300046506 Bacteria 16780
107 Ga0495583_0003602 3300046506 Bacteria 11610
108 Ga0495583_0004057 3300046506 Bacteria 10761
109 Ga0495583_0014051 3300046506 Bacteria 4431
110 Ga0495583_0032390 3300046506 Bacteria 2523
111 Ga0495606_0022956 3300046507 Bacteria 4533
112 Ga0495606_0040147 3300046507 Bacteria 3147
113 Ga0495606_0132279 3300046507 Bacteria 1482
114 Ga0495606_0176341 3300046507 Bacteria 1236
115 Ga0495610_0000413 3300046512 Bacteria 43813
116 Ga0495610_0023589 3300046512 Bacteria 3339
117 Ga0495616_0000611 3300046513 Bacteria 26961
118 Ga0495616_0007569 3300046513 Bacteria 6499
119 Ga0495616_0019849 3300046513 Bacteria 3663
120 Ga0495616_0038539 3300046513 Bacteria 2453
121 Ga0495616_0132055 3300046513 Bacteria 1143
122 Ga0495616_0202421 3300046513 Bacteria 872
123 Ga0495631_0000497 3300046518 Bacteria 26215
124 Ga0495631_0001660 3300046518 Bacteria 13235
125 Ga0495631_0002174 3300046518 Bacteria 11315
126 Ga0495631_0004501 3300046518 Bacteria 7407
127 Ga0495631_0006036 3300046518 Bacteria 6296
128 Ga0495631_0012314 3300046518 Bacteria 4183
129 Ga0495631_0016445 3300046518 Bacteria 3525
130 Ga0495631_0074227 3300046518 Bacteria 1468
131 Ga0495631_0225039 3300046518 Bacteria 800
132 Ga0495632_0000264 3300046519 Bacteria 52194
133 Ga0495632_0000674 3300046519 Bacteria 31134
134 Ga0495632_0005606 3300046519 Bacteria 8261
135 Ga0495632_0008902 3300046519 Bacteria 6099
136 Ga0495632_0019198 3300046519 Bacteria 3730
137 Ga0495632_0041532 3300046519 Bacteria 2311
138 Ga0495632_0042434 3300046519 Bacteria 2279
139 Ga0495632_0057809 3300046519 Bacteria 1892
140 Ga0495637_0000028 3300046520 Bacteria 144203
141 Ga0495637_0032799 3300046520 Bacteria 2286
142 Ga0495637_0058699 3300046520 Bacteria 1585
143 Ga0495643_0002158 3300046522 Bacteria 16135
144 Ga0495643_0034109 3300046522 Bacteria 2810
145 Ga0495643_0068960 3300046522 Bacteria 1860
146 Ga0495643_0081772 3300046522 Bacteria 1679
147 Ga0495643_0090645 3300046522 Bacteria 1577
148 Ga0495643_0210068 3300046522 Bacteria 929
149 Ga0495644_0001710 3300046523 Bacteria 8882
150 Ga0495644_0004431 3300046523 Bacteria 5515
151 Ga0495644_0054586 3300046523 Bacteria 1500
152 Ga0495644_0118021 3300046523 Bacteria 1008
153 Ga0495644_0196869 3300046523 Bacteria 776
154 Ga0495648_0000311 3300046524 Bacteria 53614
155 Ga0495648_0008203 3300046524 Bacteria 8238
156 Ga0495648_0016647 3300046524 Bacteria 5291
157 Ga0495648_0031473 3300046524 Bacteria 3492
158 Ga0495642_0000501 3300046528 Bacteria 20141
159 Ga0495642_0001230 3300046528 Bacteria 11771
160 Ga0495642_0010629 3300046528 Bacteria 3523
161 Ga0495642_0121168 3300046528 Bacteria 1122
162 Ga0495642_0166010 3300046528 Bacteria 958
163 Ga0495654_0000015 3300046530 Bacteria 307873
164 Ga0495654_0005405 3300046530 Bacteria 7424
165 Ga0495654_0009924 3300046530 Bacteria 5204
166 Ga0495654_0010476 3300046530 Bacteria 5041
167 Ga0495654_0098881 3300046530 Bacteria 1345
168 Ga0495609_0002258 3300046538 Bacteria 12022
169 Ga0495609_0008267 3300046538 Bacteria 5106
170 Ga0495609_0015692 3300046538 Bacteria 3542
171 Ga0495597_0001604 3300046542 Bacteria 15872
172 Ga0495597_0120385 3300046542 Bacteria 1094
173 Ga0495597_0274192 3300046542 Bacteria 658
174 Ga0495633_0004054 3300046558 Bacteria 9468
175 Ga0495633_0064103 3300046558 Bacteria 1718
176 Ga0495656_0019908 3300046615 Bacteria 2596
177 Ga0495656_0038891 3300046615 Bacteria 1973
178 Ga0495656_0333237 3300046615 Bacteria 784
179 Ga0495668_0000972 3300046616 Bacteria 31521
180 Ga0495668_0001176 3300046616 Bacteria 26639
181 Ga0495668_0001197 3300046616 Bacteria 26357
182 Ga0495668_0014012 3300046616 Bacteria 4712
183 Ga0495668_0165877 3300046616 Bacteria 1210
184 Ga0495668_0207592 3300046616 Bacteria 1072
185 Ga0495668_0237325 3300046616 Bacteria 998
186 Ga0495668_0456267 3300046616 Bacteria 703
187 Ga0495611_0000744 3300046648 Bacteria 18344
188 Ga0495611_0002007 3300046648 Bacteria 9633
189 Ga0495611_0019394 3300046648 Bacteria 2921
190 Ga0495611_0052780 3300046648 Bacteria 1834
191 Ga0495625_0013005 3300046660 Bacteria 6713
192 Ga0495625_0033827 3300046660 Bacteria 3776
193 Ga0495661_0000497 3300046665 Bacteria 40919
194 Ga0495661_0004118 3300046665 Bacteria 10591
195 Ga0495661_0169334 3300046665 Bacteria 1166
196 Ga0495661_0187369 3300046665 Bacteria 1092
197 Ga0495661_0199560 3300046665 Bacteria 1048
198 Ga0495588_0012994 3300046674 Bacteria 3955
199 Ga0495588_0105739 3300046674 Bacteria 1481
200 Ga0495669_0019803 3300046684 Bacteria 2906
201 Ga0495670_0007838 3300046691 Bacteria 5253
202 Ga0495670_0073379 3300046691 Bacteria 1734
203 Ga0495670_0335583 3300046691 Bacteria 812
204 Ga0495670_0536276 3300046691 Bacteria 636
205 Ga0495671_0001032 3300046692 Bacteria 19378
206 Ga0495671_0003661 3300046692 Bacteria 9361
207 Ga0495671_0004056 3300046692 Bacteria 8843
208 Ga0495671_0010221 3300046692 Bacteria 5212
209 Ga0495671_0036955 3300046692 Bacteria 2472
210 Ga0495671_0074060 3300046692 Bacteria 1671
211 Ga0495649_0000185 3300046694 Bacteria 54619
212 Ga0495649_0002394 3300046694 Bacteria 13247
213 Ga0495649_0011316 3300046694 Bacteria 5238
214 Ga0495649_0011532 3300046694 Bacteria 5179
215 Ga0495649_0063714 3300046694 Bacteria 1980
216 Ga0495649_0083335 3300046694 Bacteria 1708
217 Ga0495589_0000266 3300046794 Bacteria 42658
218 Ga0495589_0000705 3300046794 Bacteria 21771
219 Ga0495589_0001349 3300046794 Bacteria 14387
220 Ga0495589_0033035 3300046794 Bacteria 2599
221 Ga0495589_0049057 3300046794 Bacteria 2089
222 Ga0495660_0003147 3300046810 Bacteria 10280
223 Ga0495660_0006434 3300046810 Bacteria 6948
224 Ga0495660_0007443 3300046810 Bacteria 6429
225 Ga0495660_0009371 3300046810 Bacteria 5710
226 Ga0495660_0010306 3300046810 Bacteria 5434
227 Ga0495660_0022395 3300046810 Bacteria 3607
228 Ga0495660_0031836 3300046810 Bacteria 2963
229 Ga0495672_0000019 3300047320 Bacteria 448153
230 Ga0495672_0000305 3300047320 Bacteria 66204
231 Ga0495672_0002236 3300047320 Bacteria 18009
232 Ga0495672_0165954 3300047320 Bacteria 1130
233 Ga0495672_0219731 3300047320 Bacteria 939
234 Ga0495683_0000263 3300047323 Bacteria 47152
235 Ga0495683_0001773 3300047323 Bacteria 13605
236 Ga0495683_0116043 3300047323 Bacteria 1274
237 Ga0495687_000637 3300047443 Bacteria 40184
238 Ga0495687_008017 3300047443 Bacteria 6110
239 Ga0495677_0000193 3300047445 Bacteria 28150
240 Ga0495677_0000212 3300047445 Bacteria 26667
241 Ga0495677_0008224 3300047445 Bacteria 3877
242 Ga0495677_0008295 3300047445 Bacteria 3861
243 Ga0495679_006044 3300047446 Bacteria 5289
244 Ga0495685_002738 3300047447 Bacteria 5555
245 Ga0495673_0139287 3300047469 Bacteria 947
246 Ga0495681_0000317 3300047470 Bacteria 38608
247 Ga0495681_0040938 3300047470 Bacteria 2252
248 Ga0495681_0056723 3300047470 Bacteria 1821
249 Ga0495681_0075185 3300047470 Bacteria 1521
250 Ga0495686_0000735 3300047472 Bacteria 43727
251 Ga0495686_0001510 3300047472 Bacteria 25040
252 Ga0495686_0058112 3300047472 Bacteria 2412
253 Ga0495686_0060306 3300047472 Bacteria 2358
254 Ga0495686_0169019 3300047472 Bacteria 1272
255 Ga0495686_0182839 3300047472 Bacteria 1214
256 Ga0495686_0220712 3300047472 Bacteria 1078
257 Ga0495626_0001008 3300048091 Bacteria 24189
258 Ga0495626_0004947 3300048091 Bacteria 7994
259 Ga0495626_0026767 3300048091 Bacteria 2807
260 Ga0495626_0030464 3300048091 Bacteria 2602
261 Ga0495626_0037746 3300048091 Bacteria 2294
262 Ga0495626_0054466 3300048091 Bacteria 1836
263 Ga0495626_0066369 3300048091 Bacteria 1631
264 Ga0495626_0084458 3300048091 Bacteria 1405
265 Ga0495626_0265251 3300048091 Bacteria 685
266 Ga0495626_0298895 3300048091 Bacteria 636
267 Ga0496101_0072652 3300048904 Bacteria 2525
268 Ga0496102_0000849 3300048905 Bacteria 29319
269 Ga0496102_0196794 3300048905 Bacteria 1899
270 Ga0496103_0002834 3300048906 Bacteria 10786
271 Ga0496103_0059490 3300048906 Bacteria 2373
272 Ga0496105_0687660 3300048908 Bacteria 786
273 Ga0496108_0106875 3300048911 Bacteria 2390
274 Ga0496109_0007449 3300048912 Bacteria 9267
275 Ga0496110_0001412 3300048913 Bacteria 17364
276 Ga0496110_0040846 3300048913 Bacteria 4044
277 Ga0496111_0097699 3300048914 Bacteria 2156
278 Ga0496112_0177724 3300048915 Bacteria 2093
279 Ga0496113_0001197 3300048916 Bacteria 14215
280 Ga0496115_0267524 3300048918 Bacteria 1405
281 Ga0496119_0000189 3300048922 Bacteria 87262
282 Ga0496120_0001997 3300048923 Bacteria 22204
283 Ga0496122_0001184 3300048925 Bacteria 44630
284 Ga0496123_0004100 3300048926 Bacteria 15636
285 Ga0496124_0000118 3300048927 Bacteria 164259
286 Ga0496124_0014615 3300048927 Bacteria 7581
287 Ga0496124_0018152 3300048927 Bacteria 6601
288 Ga0496124_0042046 3300048927 Bacteria 3937
289 Ga0496124_0104301 3300048927 Bacteria 2292
290 Ga0496124_0147094 3300048927 Bacteria 1853
291 Ga0496124_0274864 3300048927 Bacteria 1231
292 Ga0496125_0000991 3300048928 Bacteria 44272
293 Ga0495678_000001 3300049459 Bacteria 1060340
294 Ga0495678_000188 3300049459 Bacteria 72283
295 Ga0495678_000264 3300049459 Bacteria 58107
296 Ga0495678_000368 3300049459 Bacteria 46143
297 Ga0495678_001434 3300049459 Bacteria 18756
298 Ga0495678_004064 3300049459 Bacteria 8678
299 Ga0495678_024797 3300049459 Bacteria 2584
300 Ga0495682_0000262 3300049460 Bacteria 41629
301 Ga0495682_0004084 3300049460 Bacteria 6344
302 Ga0495682_0073063 3300049460 Bacteria 1234
303 Ga0501198_007115 3300049649 Unclassified 1605
304 Ga0501207_049358 3300049654 Unclassified 748
305 Ga0501208_008313 3300049655 Unclassified 1396
306 Ga0501223_008126 3300049663 Unclassified 2141
307 Ga0501227_119217 3300049665 Unclassified 712
308 Ga0501249_000160 3300049679 Bacteria 20848
309 Ga0501259_093772 3300049688 Unclassified 678
310 Ga0501269_000029 3300049766 Bacteria 46771
311 Ga0501204_001049 3300049850 Unclassified 2614
312 nmdc:mga00v17_107773_c1 3300050491 Bacteria 1765
313 nmdc:mga00v17_19481_c1 3300050491 Bacteria 3875
314 Ga0466962_0103495 3300061719 Bacteria 1368
315 Ga0466962_0183572 3300061719 Bacteria 1020
316 2601623852 2600255283 Bacteria 6061572
317 2738691195 2738541271 Bacteria 5657310
318 2739266969 2738543016 Bacteria 5657564
319 2809147420 2808606418 Bacteria 6724496
320 2904429924 2904424332 Bacteria 7633521
321 2919159097 2919155634 Bacteria 4860545
322 2945932467 2945928738 Bacteria 6053221
323 3000405909 3000405567 Bacteria 3779330
324 3007252796 3007252601 Bacteria 4559114
325 3007318549 3007315729 Bacteria 5076637
326 640489813 640427133 Bacteria 4567418
327 651177836 651053060 Bacteria 4689946
328 8047676598 8047673197 Bacteria 7395230
329 8056161960 8056161164 Bacteria 6106669
330 Ga0495638_0027087
331 Ga0058692_1016364
332 Ga0065165_1001722
333 Ga0065714_10085389
334 Ga0070666_10498799
335 Ga0070680_100000253
336 Ga0070682_100268172
337 Ga0070660_100001148
338 Ga0070661_100000009
339 Ga0070681_10049194
340 Ga0070679_100000015
341 Ga0075364_10000478
342 Ga0075362_10017922
343 Ga0105244_10176219
344 Ga0157372_11084534
345 Ga0182007_10027258
346 Ga0182007_10258842
347 Ga0163161_10288655
348 Ga0213876_10000004
349 Ga0209050_1038160
350 Ga0209257_1000231
351 Ga0207655_1001542
352 Ga0207655_1075848
353 Ga0207707_10041785
354 Ga0207660_10000573
355 Ga0207657_10003060
356 Ga0207649_10000035
357 Ga0207652_10000021
358 Ga0207679_10118101
359 Ga0209371_1000310
360 Ga0209996_1025991
361 Ga0209983_1007121
362 Ga0209974_10179550
363 Ga0268256_1000267
364 Ga0316181_1109543
365 Ga0307413_10459524
366 Ga0307518_10007057
367 Ga0307414_10051426
368 Ga0395898_0283050
369 Ga0395898_0915332
370 Ga0395905_0276355
371 Ga0395905_0364375
372 Ga0395901_0904371
373 Ga0436365_0192103
374 Ga0436362_1073687
375 Ga0439438_000050
376 Ga0439438_000415
377 Ga0439466_0042488
378 Ga0451855_1746782
379 Ga0439445_0039910
380 Ga0439448_0059437
381 Ga0439432_182783
382 Ga0450902_000196
383 Ga0450902_004014
384 Ga0450902_014588
385 Ga0450904_000055
386 Ga0450905_011619
387 Ga0450905_050428
388 Ga0439464_0002275
389 Ga0450901_000514
390 Ga0450901_002393
391 Ga0466966_0104310
392 Ga0466968_0322937
393 Ga0466970_0137686
394 Ga0466957_0000040
395 Ga0466959_0049396
396 Ga0495617_000108
397 Ga0495617_040059
398 Ga0495617_097744
399 Ga0495627_000249
400 Ga0495627_000408
401 Ga0495627_024133
402 Ga0495603_0060483
403 Ga0495590_0000132
404 Ga0495591_000132
405 Ga0495638_0359746
406 Ga0495650_0000248
407 Ga0495650_0005024
408 Ga0495650_0009056
409 Ga0495650_0014256
410 Ga0495605_0000407
411 Ga0495605_0002576
412 Ga0495605_0007876
413 Ga0495584_0000850
414 Ga0495584_0004710
415 Ga0495585_0012721
416 Ga0495585_0025903
417 Ga0495585_0105035
418 Ga0495594_0213105
419 Ga0495596_0001472
420 Ga0495596_0002469
421 Ga0495596_0006109
422 Ga0495596_0009641
423 Ga0495596_0010220
424 Ga0495596_0011742
425 Ga0495596_0081932
426 Ga0495596_0111848
427 Ga0495607_0000240
428 Ga0495607_0000290
429 Ga0495607_0006433
430 Ga0495607_0007814
431 Ga0495607_0021620
432 Ga0495607_0031503
433 Ga0495607_0131357
434 Ga0495583_0000839
435 Ga0495583_0002281
436 Ga0495583_0003602
437 Ga0495583_0004057
438 Ga0495583_0014051
439 Ga0495583_0032390
440 Ga0495606_0022956
441 Ga0495606_0040147
442 Ga0495606_0132279
443 Ga0495606_0176341
444 Ga0495610_0000413
445 Ga0495610_0023589
446 Ga0495616_0000611
447 Ga0495616_0007569
448 Ga0495616_0019849
449 Ga0495616_0038539
450 Ga0495616_0132055
451 Ga0495616_0202421
452 Ga0495631_0000497
453 Ga0495631_0001660
454 Ga0495631_0002174
455 Ga0495631_0004501
456 Ga0495631_0006036
457 Ga0495631_0012314
458 Ga0495631_0016445
459 Ga0495631_0074227
460 Ga0495631_0225039
461 Ga0495632_0000264
462 Ga0495632_0000674
463 Ga0495632_0005606
464 Ga0495632_0008902
465 Ga0495632_0019198
466 Ga0495632_0041532
467 Ga0495632_0042434
468 Ga0495632_0057809
469 Ga0495637_0000028
470 Ga0495637_0032799
471 Ga0495637_0058699
472 Ga0495643_0002158
473 Ga0495643_0034109
474 Ga0495643_0068960
475 Ga0495643_0081772
476 Ga0495643_0090645
477 Ga0495643_0210068
478 Ga0495644_0001710
479 Ga0495644_0004431
480 Ga0495644_0054586
481 Ga0495644_0118021
482 Ga0495644_0196869
483 Ga0495648_0000311
484 Ga0495648_0008203
485 Ga0495648_0016647
486 Ga0495648_0031473
487 Ga0495642_0000501
488 Ga0495642_0001230
489 Ga0495642_0010629
490 Ga0495642_0121168
491 Ga0495642_0166010
492 Ga0495654_0000015
493 Ga0495654_0005405
494 Ga0495654_0009924
495 Ga0495654_0010476
496 Ga0495654_0098881
497 Ga0495609_0002258
498 Ga0495609_0008267
499 Ga0495609_0015692
500 Ga0495597_0001604
501 Ga0495597_0120385
502 Ga0495597_0274192
503 Ga0495633_0004054
504 Ga0495633_0064103
505 Ga0495656_0019908
506 Ga0495656_0038891
507 Ga0495656_0333237
508 Ga0495668_0000972
509 Ga0495668_0001176
510 Ga0495668_0001197
511 Ga0495668_0014012
512 Ga0495668_0165877
513 Ga0495668_0207592
514 Ga0495668_0237325
515 Ga0495668_0456267
516 Ga0495611_0000744
517 Ga0495611_0002007
518 Ga0495611_0019394
519 Ga0495611_0052780
520 Ga0495625_0013005
521 Ga0495625_0033827
522 Ga0495661_0000497
523 Ga0495661_0004118
524 Ga0495661_0169334
525 Ga0495661_0187369
526 Ga0495661_0199560
527 Ga0495588_0012994
528 Ga0495588_0105739
529 Ga0495669_0019803
530 Ga0495670_0007838
531 Ga0495670_0073379
532 Ga0495670_0335583
533 Ga0495670_0536276
534 Ga0495671_0001032
535 Ga0495671_0003661
536 Ga0495671_0004056
537 Ga0495671_0010221
538 Ga0495671_0036955
539 Ga0495671_0074060
540 Ga0495649_0000185
541 Ga0495649_0002394
542 Ga0495649_0011316
543 Ga0495649_0011532
544 Ga0495649_0063714
545 Ga0495649_0083335
546 Ga0495589_0000266
547 Ga0495589_0000705
548 Ga0495589_0001349
549 Ga0495589_0033035
550 Ga0495589_0049057
551 Ga0495660_0003147
552 Ga0495660_0006434
553 Ga0495660_0007443
554 Ga0495660_0009371
555 Ga0495660_0010306
556 Ga0495660_0022395
557 Ga0495660_0031836
558 Ga0495672_0000019
559 Ga0495672_0000305
560 Ga0495672_0002236
561 Ga0495672_0165954
562 Ga0495672_0219731
563 Ga0495683_0000263
564 Ga0495683_0001773
565 Ga0495683_0116043
566 Ga0495687_000637
567 Ga0495687_008017
568 Ga0495677_0000193
569 Ga0495677_0000212
570 Ga0495677_0008224
571 Ga0495677_0008295
572 Ga0495679_006044
573 Ga0495685_002738
574 Ga0495673_0139287
575 Ga0495681_0000317
576 Ga0495681_0040938
577 Ga0495681_0056723
578 Ga0495681_0075185
579 Ga0495686_0000735
580 Ga0495686_0001510
581 Ga0495686_0058112
582 Ga0495686_0060306
583 Ga0495686_0169019
584 Ga0495686_0182839
585 Ga0495686_0220712
586 Ga0495626_0001008
587 Ga0495626_0004947
588 Ga0495626_0026767
589 Ga0495626_0030464
590 Ga0495626_0037746
591 Ga0495626_0054466
592 Ga0495626_0066369
593 Ga0495626_0084458
594 Ga0495626_0265251
595 Ga0495626_0298895
596 Ga0496101_0072652
597 Ga0496102_0000849
598 Ga0496102_0196794
599 Ga0496103_0002834
600 Ga0496103_0059490
601 Ga0496105_0687660
602 Ga0496108_0106875
603 Ga0496109_0007449
604 Ga0496110_0001412
605 Ga0496110_0040846
606 Ga0496111_0097699
607 Ga0496112_0177724
608 Ga0496113_0001197
609 Ga0496115_0267524
610 Ga0496119_0000189
611 Ga0496120_0001997
612 Ga0496122_0001184
613 Ga0496123_0004100
614 Ga0496124_0000118
615 Ga0496124_0014615
616 Ga0496124_0018152
617 Ga0496124_0042046
618 Ga0496124_0104301
619 Ga0496124_0147094
620 Ga0496124_0274864
621 Ga0496125_0000991
622 Ga0495678_000001
623 Ga0495678_000188
624 Ga0495678_000264
625 Ga0495678_000368
626 Ga0495678_001434
627 Ga0495678_004064
628 Ga0495678_024797
629 Ga0495682_0000262
630 Ga0495682_0004084
631 Ga0495682_0073063
632 Ga0501198_007115
633 Ga0501207_049358
634 Ga0501208_008313
635 Ga0501223_008126
636 Ga0501227_119217
637 Ga0501249_000160
638 Ga0501259_093772
639 Ga0501269_000029
640 Ga0501204_001049
641 nmdc:mga00v17_107773_c1
642 nmdc:mga00v17_19481_c1
643 Ga0466962_0103495
644 Ga0466962_0183572
645 2601623852
646 2738691195
647 2739266969
648 2809147420
649 2904429924
650 2919159097
651 2945932467
652 3000405909
653 3007252796
654 3007318549
655 640489813
656 651177836
657 8047676598
658 8056161960

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04116

FA_hydroxylase

Fatty acid hydroxylase

23

156

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
7sau-assembly1.cif.gz_D structure of gldlm, the proton-powered motor that drives type ix protein secretion and gliding motility in schleiferia thermophila 0.6292 56 122
7sau-assembly1.cif.gz_D structure of gldlm, the proton-powered motor that drives type ix protein secretion and gliding motility in schleiferia thermophila 0.5643 56 122
6s7t-assembly1.cif.gz_H cryo-em structure of human oligosaccharyltransferase complex ost-b 0.4841 21 117
1x59-assembly1.cif.gz_A solution structures of the whep-trs domain of human histidyl-trna synthetase 0.435 52 121
6s7t-assembly1.cif.gz_H cryo-em structure of human oligosaccharyltransferase complex ost-b 0.4267 21 117
ID Description Score Start End Superfamily
af_Q494G1_10_223_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4687 13 115 1.20.1250.20
af_Q4DPY1_242_431_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.448 3 113 1.20.1250.20
af_D3ZXZ4_111_345_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4113 19 165 1.20.1250.20
af_P9WJW9_258_425_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.403 21 168 1.20.1250.20
af_A0A1D6JC26_303_424_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.3773 4 118 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A4Q3KWV0-F1-model_v4 Beta-carotene hydroxylase 0.9216 18 165 GO:0005506
GO:0010291
GO:0016020
GO:0016119
GO:0016123
AF-A0A6N2ZMX7-F1-model_v4 Fatty acid hydroxylase superfamily protein 0.9176 18 165 GO:0005506
GO:0010291
GO:0016020
GO:0016119
GO:0016123
AF-A0A0N0E5X2-F1-model_v4 Fatty acid hydroxylase-like protein (EC 1.14.13.129) 0.9175 17 165 GO:0005506
GO:0010291
GO:0016020
GO:0016119
GO:0016123
AF-A0A315WS55-F1-model_v4 Beta-carotene hydroxylase 0.9164 17 164 GO:0005506
GO:0010291
GO:0016020
GO:0016119
GO:0016123
AF-A0A7Y7Y5S8-F1-model_v4 Sterol desaturase family protein 0.9157 17 166 GO:0005506
GO:0010291
GO:0016020
GO:0016119
GO:0016123

Map