F409727

General Info

Members Datasets Scaffolds Average Seq Length
329 136 658 68

Family's Representative Sequence

Representative Sequence 3300031712|Ga0265342_10519988|Ga0265342_105199882
Length 82
Sequence MLAANENNQQIKNIMTTLEIKGDWNITKGKLKQKWAKLTDDDLQYADGKQEELFGRIQKRTGETREAVEKAVKESCSSCNCN

Samples

Sample ID Description Type Environment
1 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
2 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
25 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
29 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
30 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
31 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
32 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
33 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
34 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
35 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
36 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
37 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
38 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
39 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
46 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
47 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
48 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
53 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
57 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
61 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
63 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
86 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
87 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
88 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
89 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
90 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
91 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
92 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
93 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
94 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
95 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
96 3300030762 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
97 3300030880 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
98 3300031043 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
99 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
100 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
101 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
102 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
103 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
104 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
105 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
106 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
107 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
108 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
109 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
110 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
111 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
112 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
113 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
114 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
115 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
116 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
117 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
118 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
119 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
120 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
121 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
123 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
124 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
125 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
126 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
127 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
128 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
129 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
130 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
131 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
132 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
133 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
134 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
135 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.27
Metatranscriptomes 9.73
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.3
Rhizosphere 99.09
Stem 0
Stem Tuber 0
Unclassified 17.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265342_10519988 3300031712 Bacteria 606
2 Ga0058859_11667519 3300004798 Unclassified 670
3 Ga0065707_10608111 3300005295 Bacteria 677
4 Ga0070658_11010999 3300005327 Bacteria 723
5 Ga0070690_100227867 3300005330 Bacteria 1309
6 Ga0070690_101030981 3300005330 Bacteria 649
7 Ga0070670_101271763 3300005331 Bacteria 673
8 Ga0070666_11256949 3300005335 Bacteria 552
9 Ga0070689_100437276 3300005340 Bacteria 1111
10 Ga0070689_100938297 3300005340 Bacteria 767
11 Ga0070689_100941945 3300005340 Bacteria 766
12 Ga0070689_101155123 3300005340 Bacteria 694
13 Ga0070689_102163928 3300005340 Bacteria 510
14 Ga0070673_101634465 3300005364 Unclassified 609
15 Ga0070688_100058231 3300005365 Unclassified 2432
16 Ga0070688_100584891 3300005365 Bacteria 853
17 Ga0070688_100966783 3300005365 Unclassified 675
18 Ga0070709_11128721 3300005434 Bacteria 628
19 Ga0070714_100127123 3300005435 Unclassified 2274
20 Ga0070713_100700661 3300005436 Bacteria 967
21 Ga0070713_101031858 3300005436 Bacteria 794
22 Ga0070713_101768064 3300005436 Bacteria 600
23 Ga0070701_10011281 3300005438 Bacteria 3989
24 Ga0070711_101969717 3300005439 Bacteria 514
25 Ga0070694_100019571 3300005444 Bacteria 4307
26 Ga0070662_101116256 3300005457 Bacteria 677
27 Ga0070685_10086165 3300005466 Bacteria 1893
28 Ga0070706_100653813 3300005467 Bacteria 976
29 Ga0070707_101723688 3300005468 Bacteria 594
30 Ga0070679_100750340 3300005530 Unclassified 919
31 Ga0070672_100661682 3300005543 Bacteria 913
32 Ga0070686_100005984 3300005544 Bacteria 6749
33 Ga0068856_100039017 3300005614 Bacteria 4663
34 Ga0068856_102134469 3300005614 Bacteria 570
35 Ga0068859_100062867 3300005617 Unclassified 3743
36 Ga0068859_102999325 3300005617 Bacteria 516
37 Ga0068861_100859310 3300005719 Unclassified 856
38 Ga0068858_100022512 3300005842 Bacteria 5880
39 Ga0068858_100306608 3300005842 Bacteria 1515
40 Ga0070716_100442572 3300006173 Bacteria 945
41 Ga0097621_100460783 3300006237 Bacteria 1146
42 Ga0097621_102244725 3300006237 Bacteria 522
43 Ga0075431_101657303 3300006847 Bacteria 597
44 Ga0068865_101209909 3300006881 Bacteria 669
45 Ga0097620_100062865 3300006931 Unclassified 3743
46 Ga0097620_102998793 3300006931 Bacteria 516
47 Ga0105250_10500984 3300009092 Bacteria 551
48 Ga0105240_11012749 3300009093 Bacteria 888
49 Ga0105245_13155920 3300009098 Bacteria 511
50 Ga0105241_11539007 3300009174 Unclassified 641
51 Ga0105248_12473113 3300009177 Bacteria 592
52 Ga0105248_13048796 3300009177 Bacteria 533
53 Ga0105248_13176554 3300009177 Bacteria 523
54 Ga0105237_10166548 3300009545 Bacteria 2203
55 Ga0105237_11541433 3300009545 Bacteria 671
56 Ga0105237_12074873 3300009545 Bacteria 577
57 Ga0105238_10005770 3300009551 Bacteria 12250
58 Ga0105238_10100901 3300009551 Bacteria 2869
59 Ga0105238_11855426 3300009551 Bacteria 635
60 Ga0105249_10944856 3300009553 Unclassified 930
61 Ga0105239_10446252 3300010375 Bacteria 1467
62 Ga0157371_10610933 3300013102 Bacteria 812
63 Ga0157370_10419454 3300013104 Bacteria 1231
64 Ga0157369_12650040 3300013105 Unclassified 506
65 Ga0157374_10386942 3300013296 Bacteria 1394
66 Ga0157374_12668412 3300013296 Unclassified 527
67 Ga0163162_10606815 3300013306 Bacteria 1220
68 Ga0163162_12101728 3300013306 Bacteria 648
69 Ga0157372_11708668 3300013307 Bacteria 724
70 Ga0157375_10115245 3300013308 Bacteria 2790
71 Ga0157375_10508658 3300013308 Bacteria 1368
72 Ga0157375_11307891 3300013308 Bacteria 852
73 Ga0163163_10914908 3300014325 Unclassified 940
74 Ga0157380_11259048 3300014326 Unclassified 785
75 Ga0157379_11266985 3300014968 Unclassified 711
76 Ga0157376_10155522 3300014969 Bacteria 2067
77 Ga0157376_12496688 3300014969 Bacteria 556
78 Ga0197907_10636500 3300020069 Bacteria 535
79 Ga0197907_11308702 3300020069 Unclassified 837
80 Ga0206356_10996321 3300020070 Bacteria 631
81 Ga0206356_11818611 3300020070 Unclassified 921
82 Ga0206349_1264808 3300020075 Bacteria 814
83 Ga0206355_1427140 3300020076 Unclassified 580
84 Ga0206351_10903536 3300020077 Unclassified 572
85 Ga0206352_10293521 3300020078 Bacteria 772
86 Ga0206352_10666242 3300020078 Unclassified 515
87 Ga0206350_10150639 3300020080 Unclassified 592
88 Ga0206350_11128161 3300020080 Unclassified 662
89 Ga0206354_10273480 3300020081 Bacteria 628
90 Ga0206353_10641391 3300020082 Unclassified 603
91 Ga0154015_1484965 3300020610 Bacteria 517
92 Ga0154015_1598348 3300020610 Unclassified 686
93 Ga0224712_10408769 3300022467 Unclassified 648
94 Ga0207707_10469162 3300025912 Bacteria 1076
95 Ga0207695_10349417 3300025913 Bacteria 1366
96 Ga0207662_10471353 3300025918 Bacteria 861
97 Ga0207652_10179807 3300025921 Bacteria 1900
98 Ga0207694_10063674 3300025924 Bacteria 2873
99 Ga0207694_10098221 3300025924 Bacteria 2318
100 Ga0207650_10877076 3300025925 Bacteria 762
101 Ga0207687_10635565 3300025927 Bacteria 902
102 Ga0207700_10815704 3300025928 Unclassified 835
103 Ga0207664_10031701 3300025929 Unclassified 4046
104 Ga0207664_10429022 3300025929 Bacteria 1178
105 Ga0207706_11329357 3300025933 Bacteria 593
106 Ga0207686_11270180 3300025934 Bacteria 604
107 Ga0207670_10769937 3300025936 Bacteria 800
108 Ga0207670_11633332 3300025936 Bacteria 548
109 Ga0207665_11365772 3300025939 Bacteria 564
110 Ga0207691_10398107 3300025940 Bacteria 1175
111 Ga0207661_11362321 3300025944 Bacteria 651
112 Ga0207658_11798529 3300025986 Bacteria 559
113 Ga0207703_10030474 3300026035 Bacteria 4264
114 Ga0207703_10933616 3300026035 Bacteria 831
115 Ga0207702_10008106 3300026078 Bacteria 8890
116 Ga0207641_10821614 3300026088 Bacteria 920
117 Ga0207641_12605406 3300026088 Bacteria 503
118 Ga0207675_101149391 3300026118 Unclassified 796
119 Ga0268266_11321338 3300028379 Unclassified 696
120 Ga0268266_11455694 3300028379 Unclassified 661
121 Ga0265337_1000361 3300028556 Bacteria 24382
122 Ga0265337_1000968 3300028556 Bacteria 15051
123 Ga0265337_1003987 3300028556 Bacteria 6247
124 Ga0265337_1004354 3300028556 Bacteria 5888
125 Ga0265337_1005052 3300028556 Bacteria 5333
126 Ga0265337_1008104 3300028556 Bacteria 3857
127 Ga0265337_1024264 3300028556 Bacteria 1857
128 Ga0265337_1038575 3300028556 Bacteria 1385
129 Ga0265337_1045797 3300028556 Bacteria 1243
130 Ga0265337_1060449 3300028556 Bacteria 1051
131 Ga0265337_1148676 3300028556 Bacteria 634
132 Ga0265337_1155182 3300028556 Bacteria 620
133 Ga0265326_10017420 3300028558 Bacteria 2072
134 Ga0265319_1000016 3300028563 Bacteria 176245
135 Ga0265319_1000031 3300028563 Bacteria 124456
136 Ga0265319_1006756 3300028563 Bacteria 5259
137 Ga0265319_1010013 3300028563 Bacteria 3983
138 Ga0265319_1016381 3300028563 Bacteria 2844
139 Ga0265319_1021448 3300028563 Bacteria 2372
140 Ga0265319_1045103 3300028563 Bacteria 1475
141 Ga0265334_10018157 3300028573 Bacteria 2900
142 Ga0265334_10019796 3300028573 Bacteria 2763
143 Ga0265334_10058701 3300028573 Unclassified 1455
144 Ga0265334_10066149 3300028573 Bacteria 1354
145 Ga0265334_10094194 3300028573 Bacteria 1090
146 Ga0265334_10108548 3300028573 Bacteria 999
147 Ga0265334_10311727 3300028573 Bacteria 538
148 Ga0265318_10001448 3300028577 Bacteria 13963
149 Ga0265318_10077403 3300028577 Bacteria 1230
150 Ga0265318_10122486 3300028577 Bacteria 956
151 Ga0265318_10309551 3300028577 Bacteria 576
152 Ga0265323_10002683 3300028653 Bacteria 8041
153 Ga0265323_10015467 3300028653 Bacteria 3000
154 Ga0265323_10019850 3300028653 Bacteria 2591
155 Ga0265323_10034981 3300028653 Bacteria 1854
156 Ga0265323_10036479 3300028653 Unclassified 1807
157 Ga0265323_10046985 3300028653 Bacteria 1545
158 Ga0265323_10150972 3300028653 Bacteria 744
159 Ga0265323_10172240 3300028653 Bacteria 687
160 Ga0265323_10233674 3300028653 Unclassified 574
161 Ga0265322_10000951 3300028654 Bacteria 10089
162 Ga0265322_10034616 3300028654 Bacteria 1439
163 Ga0265322_10066284 3300028654 Bacteria 1023
164 Ga0265322_10091031 3300028654 Unclassified 867
165 Ga0265336_10000769 3300028666 Bacteria 16973
166 Ga0265336_10023488 3300028666 Bacteria 1954
167 Ga0265336_10220869 3300028666 Unclassified 563
168 Ga0265338_10000864 3300028800 Bacteria 51319
169 Ga0265338_10001263 3300028800 Bacteria 41705
170 Ga0265338_10002166 3300028800 Bacteria 30168
171 Ga0265338_10002480 3300028800 Bacteria 27570
172 Ga0265338_10003392 3300028800 Bacteria 22479
173 Ga0265338_10004117 3300028800 Bacteria 19918
174 Ga0265338_10004814 3300028800 Bacteria 18043
175 Ga0265338_10004967 3300028800 Bacteria 17611
176 Ga0265338_10009359 3300028800 Bacteria 11700
177 Ga0265338_10015483 3300028800 Bacteria 8371
178 Ga0265338_10027572 3300028800 Bacteria 5695
179 Ga0265338_10038267 3300028800 Bacteria 4548
180 Ga0265338_10046149 3300028800 Bacteria 3995
181 Ga0265338_10052127 3300028800 Bacteria 3676
182 Ga0265338_10056575 3300028800 Bacteria 3477
183 Ga0265338_10062588 3300028800 Bacteria 3250
184 Ga0265338_10262730 3300028800 Bacteria 1268
185 Ga0265338_10277459 3300028800 Bacteria 1226
186 Ga0265338_10281667 3300028800 Bacteria 1214
187 Ga0265338_10298493 3300028800 Bacteria 1172
188 Ga0265338_10311132 3300028800 Bacteria 1142
189 Ga0265338_10344181 3300028800 Bacteria 1074
190 Ga0265338_10353490 3300028800 Bacteria 1056
191 Ga0265338_10387624 3300028800 Bacteria 998
192 Ga0265338_10512324 3300028800 Bacteria 843
193 Ga0265338_10707583 3300028800 Bacteria 695
194 Ga0265338_10714516 3300028800 Bacteria 691
195 Ga0265324_10011416 3300029957 Bacteria 3383
196 Ga0265324_10037798 3300029957 Bacteria 1676
197 Ga0265324_10047253 3300029957 Bacteria 1481
198 Ga0265324_10069750 3300029957 Bacteria 1198
199 Ga0265324_10080802 3300029957 Bacteria 1106
200 Ga0265324_10109472 3300029957 Bacteria 938
201 Ga0265324_10114044 3300029957 Unclassified 918
202 Ga0265324_10232338 3300029957 Bacteria 626
203 Ga0265324_10310954 3300029957 Bacteria 536
204 Ga0307511_10116770 3300030521 Bacteria 1671
205 Ga0265775_100815 3300030762 Bacteria 1357
206 Ga0265775_104706 3300030762 Unclassified 773
207 Ga0265776_100740 3300030880 Unclassified 1241
208 Ga0265776_102537 3300030880 Unclassified 844
209 Ga0265776_112050 3300030880 Bacteria 526
210 Ga0265779_100688 3300031043 Bacteria 1326
211 Ga0265779_106458 3300031043 Bacteria 658
212 Ga0265779_106789 3300031043 Bacteria 648
213 Ga0265760_10269678 3300031090 Bacteria 595
214 Ga0265330_10467133 3300031235 Unclassified 536
215 Ga0265330_10493321 3300031235 Bacteria 521
216 Ga0265332_10119619 3300031238 Bacteria 1107
217 Ga0265332_10218742 3300031238 Bacteria 790
218 Ga0265328_10463903 3300031239 Bacteria 502
219 Ga0265320_10000048 3300031240 Bacteria 118683
220 Ga0265320_10000602 3300031240 Bacteria 27546
221 Ga0265320_10001668 3300031240 Bacteria 15795
222 Ga0265320_10001695 3300031240 Bacteria 15656
223 Ga0265320_10008029 3300031240 Bacteria 6498
224 Ga0265320_10014774 3300031240 Bacteria 4430
225 Ga0265320_10017974 3300031240 Bacteria 3906
226 Ga0265320_10024693 3300031240 Bacteria 3174
227 Ga0265320_10089092 3300031240 Unclassified 1431
228 Ga0265320_10127128 3300031240 Bacteria 1159
229 Ga0265320_10137646 3300031240 Unclassified 1107
230 Ga0265320_10164147 3300031240 Bacteria 999
231 Ga0265320_10221271 3300031240 Bacteria 843
232 Ga0265320_10326182 3300031240 Bacteria 678
233 Ga0265325_10018830 3300031241 Bacteria 3826
234 Ga0265325_10041624 3300031241 Bacteria 2406
235 Ga0265329_10150484 3300031242 Bacteria 754
236 Ga0265340_10001431 3300031247 Bacteria 13680
237 Ga0265340_10015225 3300031247 Bacteria 4000
238 Ga0265340_10037702 3300031247 Bacteria 2394
239 Ga0265340_10143078 3300031247 Bacteria 1093
240 Ga0265340_10145791 3300031247 Bacteria 1081
241 Ga0265340_10215875 3300031247 Bacteria 860
242 Ga0265339_10001788 3300031249 Bacteria 15810
243 Ga0265339_10417667 3300031249 Bacteria 625
244 Ga0265339_10433937 3300031249 Unclassified 611
245 Ga0265339_10438688 3300031249 Bacteria 607
246 Ga0265331_10055064 3300031250 Bacteria 1892
247 Ga0265331_10101498 3300031250 Unclassified 1323
248 Ga0265331_10283303 3300031250 Bacteria 743
249 Ga0265327_10000091 3300031251 Bacteria 196369
250 Ga0265327_10000335 3300031251 Bacteria 89427
251 Ga0265327_10013670 3300031251 Bacteria 5375
252 Ga0265327_10025751 3300031251 Bacteria 3423
253 Ga0265327_10052334 3300031251 Bacteria 2127
254 Ga0265327_10110697 3300031251 Bacteria 1313
255 Ga0265327_10381957 3300031251 Bacteria 613
256 Ga0265316_10002407 3300031344 Bacteria 19458
257 Ga0265316_10005498 3300031344 Bacteria 12301
258 Ga0265316_10017661 3300031344 Bacteria 6154
259 Ga0265316_10054164 3300031344 Unclassified 3141
260 Ga0265316_10063506 3300031344 Bacteria 2863
261 Ga0265316_10106366 3300031344 Bacteria 2128
262 Ga0265316_10185910 3300031344 Bacteria 1546
263 Ga0265316_10243864 3300031344 Bacteria 1321
264 Ga0265316_10362625 3300031344 Bacteria 1048
265 Ga0265316_10373080 3300031344 Bacteria 1030
266 Ga0265316_10375901 3300031344 Bacteria 1026
267 Ga0265316_10388946 3300031344 Bacteria 1006
268 Ga0265316_10701451 3300031344 Bacteria 713
269 Ga0265316_11062748 3300031344 Unclassified 562
270 Ga0265316_11128777 3300031344 Bacteria 543
271 Ga0265313_10001314 3300031595 Bacteria 23441
272 Ga0265313_10003038 3300031595 Bacteria 13944
273 Ga0265313_10031342 3300031595 Bacteria 2727
274 Ga0265313_10187545 3300031595 Unclassified 866
275 Ga0265314_10010045 3300031711 Bacteria 7934
276 Ga0265314_10016315 3300031711 Bacteria 5870
277 Ga0265314_10445313 3300031711 Bacteria 691
278 Ga0265314_10450976 3300031711 Bacteria 685
279 Ga0265314_10685249 3300031711 Bacteria 520
280 Ga0265342_10015384 3300031712 Bacteria 5034
281 Ga0265342_10046074 3300031712 Bacteria 2622
282 Ga0265342_10105754 3300031712 Bacteria 1598
283 Ga0265342_10145793 3300031712 Bacteria 1318
284 Ga0265342_10214565 3300031712 Unclassified 1039
285 Ga0307412_11678083 3300031911 Unclassified 582
286 Ga0307414_10582044 3300032004 Bacteria 1002
287 Ga0307414_10706309 3300032004 Bacteria 913
288 Ga0373954_0269667 3300035118 Bacteria 839
289 Ga0373956_0482915 3300035119 Unclassified 591
290 Ga0373943_0128924 3300035170 Bacteria 1352
291 Ga0373955_0748255 3300035172 Unclassified 600
292 Ga0373955_0798551 3300035172 Unclassified 580
293 Ga0373933_0703326 3300035724 Bacteria 665
294 Ga0373937_0252992 3300036401 Bacteria 1661
295 Ga0373937_0599393 3300036401 Bacteria 1046
296 Ga0373937_0881353 3300036401 Bacteria 844
297 Ga0373937_1520364 3300036401 Bacteria 617
298 Ga0373937_1612922 3300036401 Bacteria 596
299 Ga0373937_1846579 3300036401 Bacteria 551
300 Ga0265778_004400 3300036457 Bacteria 1457
301 Ga0265778_019610 3300036457 Bacteria 828
302 Ga0265778_030612 3300036457 Bacteria 695
303 Ga0265778_048208 3300036457 Bacteria 579
304 Ga0265778_054918 3300036457 Bacteria 550
305 Ga0373925_0500758 3300037068 Bacteria 997
306 Ga0451807_1002028 3300041486 Unclassified 1446
307 Ga0451577_0002504 3300042876 Bacteria 21787
308 Ga0451577_0004953 3300042876 Bacteria 13844
309 Ga0451577_0264511 3300042876 Unclassified 1557
310 Ga0453684_0018775 3300044712 Bacteria 10583
311 Ga0453684_0024259 3300044712 Bacteria 8874
312 Ga0453684_1483404 3300044712 Unclassified 700
313 Ga0453684_1563031 3300044712 Unclassified 678
314 Ga0451576_0331253 3300045051 Bacteria 1593
315 Ga0451576_0443323 3300045051 Bacteria 1363
316 Ga0451576_1120970 3300045051 Bacteria 823
317 Ga0451576_1824786 3300045051 Bacteria 628
318 Ga0451576_1877373 3300045051 Bacteria 618
319 Ga0495592_0835050 3300046454 Bacteria 545
320 Ga0495580_0954560 3300046472 Bacteria 549
321 Ga0495582_0600704 3300046473 Bacteria 637
322 Ga0495582_0691469 3300046473 Bacteria 590
323 Ga0495618_0933427 3300046514 Bacteria 500
324 Ga0495630_0689555 3300046517 Bacteria 782
325 Ga0495634_0659262 3300046642 Unclassified 604
326 Ga0495680_1033300 3300047322 Bacteria 523
327 Ga0501308_038067 3300049128 Bacteria 669
328 Ga0501047_0131958 3300049581 Unclassified 2378
329 Ga0501035_0078992 3300049822 Bacteria 2906
330 Ga0265342_10519988
331 Ga0058859_11667519
332 Ga0065707_10608111
333 Ga0070658_11010999
334 Ga0070690_100227867
335 Ga0070690_101030981
336 Ga0070670_101271763
337 Ga0070666_11256949
338 Ga0070689_100437276
339 Ga0070689_100938297
340 Ga0070689_100941945
341 Ga0070689_101155123
342 Ga0070689_102163928
343 Ga0070673_101634465
344 Ga0070688_100058231
345 Ga0070688_100584891
346 Ga0070688_100966783
347 Ga0070709_11128721
348 Ga0070714_100127123
349 Ga0070713_100700661
350 Ga0070713_101031858
351 Ga0070713_101768064
352 Ga0070701_10011281
353 Ga0070711_101969717
354 Ga0070694_100019571
355 Ga0070662_101116256
356 Ga0070685_10086165
357 Ga0070706_100653813
358 Ga0070707_101723688
359 Ga0070679_100750340
360 Ga0070672_100661682
361 Ga0070686_100005984
362 Ga0068856_100039017
363 Ga0068856_102134469
364 Ga0068859_100062867
365 Ga0068859_102999325
366 Ga0068861_100859310
367 Ga0068858_100022512
368 Ga0068858_100306608
369 Ga0070716_100442572
370 Ga0097621_100460783
371 Ga0097621_102244725
372 Ga0075431_101657303
373 Ga0068865_101209909
374 Ga0097620_100062865
375 Ga0097620_102998793
376 Ga0105250_10500984
377 Ga0105240_11012749
378 Ga0105245_13155920
379 Ga0105241_11539007
380 Ga0105248_12473113
381 Ga0105248_13048796
382 Ga0105248_13176554
383 Ga0105237_10166548
384 Ga0105237_11541433
385 Ga0105237_12074873
386 Ga0105238_10005770
387 Ga0105238_10100901
388 Ga0105238_11855426
389 Ga0105249_10944856
390 Ga0105239_10446252
391 Ga0157371_10610933
392 Ga0157370_10419454
393 Ga0157369_12650040
394 Ga0157374_10386942
395 Ga0157374_12668412
396 Ga0163162_10606815
397 Ga0163162_12101728
398 Ga0157372_11708668
399 Ga0157375_10115245
400 Ga0157375_10508658
401 Ga0157375_11307891
402 Ga0163163_10914908
403 Ga0157380_11259048
404 Ga0157379_11266985
405 Ga0157376_10155522
406 Ga0157376_12496688
407 Ga0197907_10636500
408 Ga0197907_11308702
409 Ga0206356_10996321
410 Ga0206356_11818611
411 Ga0206349_1264808
412 Ga0206355_1427140
413 Ga0206351_10903536
414 Ga0206352_10293521
415 Ga0206352_10666242
416 Ga0206350_10150639
417 Ga0206350_11128161
418 Ga0206354_10273480
419 Ga0206353_10641391
420 Ga0154015_1484965
421 Ga0154015_1598348
422 Ga0224712_10408769
423 Ga0207707_10469162
424 Ga0207695_10349417
425 Ga0207662_10471353
426 Ga0207652_10179807
427 Ga0207694_10063674
428 Ga0207694_10098221
429 Ga0207650_10877076
430 Ga0207687_10635565
431 Ga0207700_10815704
432 Ga0207664_10031701
433 Ga0207664_10429022
434 Ga0207706_11329357
435 Ga0207686_11270180
436 Ga0207670_10769937
437 Ga0207670_11633332
438 Ga0207665_11365772
439 Ga0207691_10398107
440 Ga0207661_11362321
441 Ga0207658_11798529
442 Ga0207703_10030474
443 Ga0207703_10933616
444 Ga0207702_10008106
445 Ga0207641_10821614
446 Ga0207641_12605406
447 Ga0207675_101149391
448 Ga0268266_11321338
449 Ga0268266_11455694
450 Ga0265337_1000361
451 Ga0265337_1000968
452 Ga0265337_1003987
453 Ga0265337_1004354
454 Ga0265337_1005052
455 Ga0265337_1008104
456 Ga0265337_1024264
457 Ga0265337_1038575
458 Ga0265337_1045797
459 Ga0265337_1060449
460 Ga0265337_1148676
461 Ga0265337_1155182
462 Ga0265326_10017420
463 Ga0265319_1000016
464 Ga0265319_1000031
465 Ga0265319_1006756
466 Ga0265319_1010013
467 Ga0265319_1016381
468 Ga0265319_1021448
469 Ga0265319_1045103
470 Ga0265334_10018157
471 Ga0265334_10019796
472 Ga0265334_10058701
473 Ga0265334_10066149
474 Ga0265334_10094194
475 Ga0265334_10108548
476 Ga0265334_10311727
477 Ga0265318_10001448
478 Ga0265318_10077403
479 Ga0265318_10122486
480 Ga0265318_10309551
481 Ga0265323_10002683
482 Ga0265323_10015467
483 Ga0265323_10019850
484 Ga0265323_10034981
485 Ga0265323_10036479
486 Ga0265323_10046985
487 Ga0265323_10150972
488 Ga0265323_10172240
489 Ga0265323_10233674
490 Ga0265322_10000951
491 Ga0265322_10034616
492 Ga0265322_10066284
493 Ga0265322_10091031
494 Ga0265336_10000769
495 Ga0265336_10023488
496 Ga0265336_10220869
497 Ga0265338_10000864
498 Ga0265338_10001263
499 Ga0265338_10002166
500 Ga0265338_10002480
501 Ga0265338_10003392
502 Ga0265338_10004117
503 Ga0265338_10004814
504 Ga0265338_10004967
505 Ga0265338_10009359
506 Ga0265338_10015483
507 Ga0265338_10027572
508 Ga0265338_10038267
509 Ga0265338_10046149
510 Ga0265338_10052127
511 Ga0265338_10056575
512 Ga0265338_10062588
513 Ga0265338_10262730
514 Ga0265338_10277459
515 Ga0265338_10281667
516 Ga0265338_10298493
517 Ga0265338_10311132
518 Ga0265338_10344181
519 Ga0265338_10353490
520 Ga0265338_10387624
521 Ga0265338_10512324
522 Ga0265338_10707583
523 Ga0265338_10714516
524 Ga0265324_10011416
525 Ga0265324_10037798
526 Ga0265324_10047253
527 Ga0265324_10069750
528 Ga0265324_10080802
529 Ga0265324_10109472
530 Ga0265324_10114044
531 Ga0265324_10232338
532 Ga0265324_10310954
533 Ga0307511_10116770
534 Ga0265775_100815
535 Ga0265775_104706
536 Ga0265776_100740
537 Ga0265776_102537
538 Ga0265776_112050
539 Ga0265779_100688
540 Ga0265779_106458
541 Ga0265779_106789
542 Ga0265760_10269678
543 Ga0265330_10467133
544 Ga0265330_10493321
545 Ga0265332_10119619
546 Ga0265332_10218742
547 Ga0265328_10463903
548 Ga0265320_10000048
549 Ga0265320_10000602
550 Ga0265320_10001668
551 Ga0265320_10001695
552 Ga0265320_10008029
553 Ga0265320_10014774
554 Ga0265320_10017974
555 Ga0265320_10024693
556 Ga0265320_10089092
557 Ga0265320_10127128
558 Ga0265320_10137646
559 Ga0265320_10164147
560 Ga0265320_10221271
561 Ga0265320_10326182
562 Ga0265325_10018830
563 Ga0265325_10041624
564 Ga0265329_10150484
565 Ga0265340_10001431
566 Ga0265340_10015225
567 Ga0265340_10037702
568 Ga0265340_10143078
569 Ga0265340_10145791
570 Ga0265340_10215875
571 Ga0265339_10001788
572 Ga0265339_10417667
573 Ga0265339_10433937
574 Ga0265339_10438688
575 Ga0265331_10055064
576 Ga0265331_10101498
577 Ga0265331_10283303
578 Ga0265327_10000091
579 Ga0265327_10000335
580 Ga0265327_10013670
581 Ga0265327_10025751
582 Ga0265327_10052334
583 Ga0265327_10110697
584 Ga0265327_10381957
585 Ga0265316_10002407
586 Ga0265316_10005498
587 Ga0265316_10017661
588 Ga0265316_10054164
589 Ga0265316_10063506
590 Ga0265316_10106366
591 Ga0265316_10185910
592 Ga0265316_10243864
593 Ga0265316_10362625
594 Ga0265316_10373080
595 Ga0265316_10375901
596 Ga0265316_10388946
597 Ga0265316_10701451
598 Ga0265316_11062748
599 Ga0265316_11128777
600 Ga0265313_10001314
601 Ga0265313_10003038
602 Ga0265313_10031342
603 Ga0265313_10187545
604 Ga0265314_10010045
605 Ga0265314_10016315
606 Ga0265314_10445313
607 Ga0265314_10450976
608 Ga0265314_10685249
609 Ga0265342_10015384
610 Ga0265342_10046074
611 Ga0265342_10105754
612 Ga0265342_10145793
613 Ga0265342_10214565
614 Ga0307412_11678083
615 Ga0307414_10582044
616 Ga0307414_10706309
617 Ga0373954_0269667
618 Ga0373956_0482915
619 Ga0373943_0128924
620 Ga0373955_0748255
621 Ga0373955_0798551
622 Ga0373933_0703326
623 Ga0373937_0252992
624 Ga0373937_0599393
625 Ga0373937_0881353
626 Ga0373937_1520364
627 Ga0373937_1612922
628 Ga0373937_1846579
629 Ga0265778_004400
630 Ga0265778_019610
631 Ga0265778_030612
632 Ga0265778_048208
633 Ga0265778_054918
634 Ga0373925_0500758
635 Ga0451807_1002028
636 Ga0451577_0002504
637 Ga0451577_0004953
638 Ga0451577_0264511
639 Ga0453684_0018775
640 Ga0453684_0024259
641 Ga0453684_1483404
642 Ga0453684_1563031
643 Ga0451576_0331253
644 Ga0451576_0443323
645 Ga0451576_1120970
646 Ga0451576_1824786
647 Ga0451576_1877373
648 Ga0495592_0835050
649 Ga0495580_0954560
650 Ga0495582_0600704
651 Ga0495582_0691469
652 Ga0495618_0933427
653 Ga0495630_0689555
654 Ga0495634_0659262
655 Ga0495680_1033300
656 Ga0501308_038067
657 Ga0501047_0131958
658 Ga0501035_0078992

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05532

CsbD

CsbD-like

19

70

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3st9-assembly1.cif.gz_D crystal structure of clpp in heptameric form from staphylococcus aureus 0.946 35 59
4emm-assembly1.cif.gz_C crystal structure of staphylococcus aureus clpp in compact conformation 0.7813 30 59
1yww-assembly1.cif.gz_A nmr structure of p. aeruginosa protein pa4738: northeast structural genomics consortium target pap2 0.6289 6 63
1yww-assembly1.cif.gz_A nmr structure of p. aeruginosa protein pa4738: northeast structural genomics consortium target pap2 0.5748 6 63
1qb2-assembly1.cif.gz_B crystal structure of the conserved subdomain of human protein srp54m at 2.1a resolution: evidence for the mechanism of signal peptide binding 0.5605 15 63
ID Description Score Start End Superfamily
af_Q9VQD6_261_374_1.10.10.2590 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;BEN domain 0.6516 21 65 1.10.10.2590
1ywwA00 Mainly Alpha;Orthogonal Bundle;Protein Yjbj; Chain: A;;YjbJ 0.6289 6 63 1.10.1470.10
2ecbA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.6126 11 64 1.10.10.60
af_Q8C0C0_441_501_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.603 12 65 1.10.10.60
af_E9PXC0_312_437_1.10.260.30 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);Signal recognition particle, SRP54 subunit, M-domain 0.5933 13 63 1.10.260.30
ID Description Score Start End GO Terms
AF-A0A5C6LZL7-F1-model_v4 General stress protein CsbD 0.9593 10 63
AF-A0A372DY90-F1-model_v4 General stress protein CsbD 0.958 4 60
AF-W0EVJ8-F1-model_v4 General stress protein CsbD 0.9563 8 61
AF-A0A1M5BYD2-F1-model_v4 CsbD-like 0.9545 10 60
AF-A0A7T9DBW1-F1-model_v4 deleted 0.9493 10 60

Map