F409681

General Info

Members Datasets Scaffolds Average Seq Length
329 226 315 97

Family's Representative Sequence

Representative Sequence 3300021358|Ga0213873_10053622|Ga0213873_100536222
Length 113
Sequence MRAAGRFWATVRSGITMFAQFAASLAAVCSACERHFRCHLRSGAALALASTLLAGCLPATVPVSGADPTDPAAKVADINYRSTIAPYASLRPTTPAPWRDRNDNVAPSPRSDR

Samples

Sample ID Description Type Environment
1 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
2 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
3 2643221651 Afipia sp. Root123D2 Isolate Unclassified
4 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
5 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
6 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
7 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
8 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
9 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
10 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
11 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
12 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
28 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
42 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
46 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
52 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
57 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
58 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
59 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
60 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
61 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
62 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
86 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
87 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
88 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
91 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
92 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
93 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
94 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
95 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
96 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
97 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
98 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
99 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
100 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
101 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
102 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
103 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
104 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
105 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
106 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
107 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
108 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
109 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
110 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
114 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
115 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
116 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
119 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
120 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
121 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
122 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
123 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
124 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
125 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
126 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
127 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
128 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
129 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
130 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
131 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
132 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
133 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
134 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
135 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
136 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
137 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
138 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
139 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
140 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
141 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
142 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
143 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
144 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
145 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
146 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
147 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
148 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
149 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
150 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
151 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
152 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
153 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
154 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
155 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
156 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
157 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
158 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
159 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
160 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
161 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
162 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
163 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
164 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
165 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
166 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
167 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
168 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
169 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
170 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
182 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
183 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
185 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
186 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
187 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
188 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
189 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
190 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
191 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
192 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
193 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
194 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
195 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
196 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
197 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
198 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
199 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
200 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
201 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
202 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
203 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
204 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
205 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
206 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
207 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
208 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
209 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
210 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
211 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
212 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
213 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
214 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
215 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
216 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
217 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
218 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
219 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
220 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
221 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
222 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
223 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
224 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
225 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
226 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.74
Metatranscriptomes 0
Isolates 4.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.06
Nodule 2.43
Rhizoplane 1.22
Rhizosphere 62.01
Stem 0
Stem Tuber 0
Unclassified 14.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10007876 3300005327 Bacteria 8582
2 Ga0070658_10047142 3300005327 Bacteria 3487
3 Ga0070659_100585924 3300005366 Bacteria 957
4 Ga0070667_101808126 3300005367 Bacteria 575
5 Ga0070709_10000624 3300005434 Bacteria 20259
6 Ga0070714_100018303 3300005435 Bacteria 5688
7 Ga0070714_100225607 3300005435 Bacteria 1724
8 Ga0070713_100058471 3300005436 Bacteria 3215
9 Ga0070710_10005253 3300005437 Bacteria 6136
10 Ga0070711_100002089 3300005439 Bacteria 11290
11 Ga0070705_100585017 3300005440 Bacteria 861
12 Ga0070663_100115162 3300005455 Bacteria 2025
13 Ga0070678_100314175 3300005456 Bacteria 1336
14 Ga0070662_100547807 3300005457 Bacteria 969
15 Ga0070679_101070333 3300005530 Bacteria 751
16 Ga0070665_101716286 3300005548 Bacteria 635
17 Ga0070664_101246747 3300005564 Bacteria 702
18 Ga0068857_100899284 3300005577 Bacteria 849
19 Ga0068854_102204573 3300005578 Bacteria 510
20 Ga0068856_100917125 3300005614 Bacteria 895
21 Ga0068856_101611324 3300005614 Bacteria 662
22 Ga0068861_100274760 3300005719 Bacteria 1448
23 Ga0068858_100547530 3300005842 Bacteria 1120
24 Ga0070717_10835769 3300006028 Unclassified 838
25 Ga0075365_10040125 3300006038 Bacteria 3052
26 Ga0075365_10062692 3300006038 Bacteria 2487
27 Ga0075365_10124736 3300006038 Bacteria 1779
28 Ga0075363_100850067 3300006048 Bacteria 557
29 Ga0075364_10060149 3300006051 Bacteria 2491
30 Ga0075364_10204267 3300006051 Bacteria 1339
31 Ga0075364_11038553 3300006051 Bacteria 557
32 Ga0070715_10052455 3300006163 Bacteria 1759
33 Ga0070716_100001552 3300006173 Bacteria 10308
34 Ga0075362_10127315 3300006177 Bacteria 1209
35 Ga0075367_10229878 3300006178 Bacteria 1161
36 Ga0075369_10049341 3300006186 Bacteria 1818
37 Ga0075369_10103407 3300006186 Bacteria 1279
38 Ga0075366_10365415 3300006195 Bacteria 886
39 Ga0075428_100144117 3300006844 Bacteria 2589
40 Ga0068865_102199699 3300006881 Bacteria 502
41 Ga0099794_10000754 3300007265 Bacteria 10902
42 Ga0099794_10009159 3300007265 Bacteria 4145
43 Ga0099794_10180739 3300007265 Unclassified 1077
44 Ga0099794_10224611 3300007265 Bacteria 965
45 Ga0099794_10292211 3300007265 Bacteria 843
46 Ga0099795_10096439 3300007788 Bacteria 1154
47 Ga0105245_10287760 3300009098 Bacteria 1608
48 Ga0105247_10162358 3300009101 Bacteria 1480
49 Ga0105247_11180561 3300009101 Bacteria 608
50 Ga0114129_10263744 3300009147 Bacteria 2307
51 Ga0105243_10680900 3300009148 Bacteria 1000
52 Ga0105237_10179526 3300009545 Bacteria 2117
53 Ga0105249_10034081 3300009553 Bacteria 4612
54 Ga0157370_10567735 3300013104 Bacteria 1040
55 Ga0157370_10571889 3300013104 Bacteria 1036
56 Ga0163163_10994635 3300014325 Bacteria 902
57 Ga0157379_10331537 3300014968 Bacteria 1390
58 Ga0213873_10053622 3300021358 Bacteria 1074
59 Ga0213872_10047530 3300021361 Bacteria 1951
60 Ga0213876_10003801 3300021384 Bacteria 8559
61 Ga0213871_10023920 3300021441 Bacteria 1542
62 Ga0209564_1010320 3300025295 Bacteria 4320
63 Ga0209758_1000131 3300025297 Bacteria 184259
64 Ga0207692_10000311 3300025898 Bacteria 16862
65 Ga0207710_10294407 3300025900 Unclassified 819
66 Ga0207710_10537080 3300025900 Bacteria 608
67 Ga0207647_10153289 3300025904 Bacteria 1346
68 Ga0207685_10039732 3300025905 Bacteria 1748
69 Ga0207699_10000235 3300025906 Bacteria 30984
70 Ga0207705_10007025 3300025909 Bacteria 8304
71 Ga0207671_10927048 3300025914 Bacteria 688
72 Ga0207693_10116318 3300025915 Bacteria 2100
73 Ga0207663_10011922 3300025916 Bacteria 4682
74 Ga0207652_11380079 3300025921 Bacteria 608
75 Ga0207652_11615893 3300025921 Bacteria 552
76 Ga0207681_11392373 3300025923 Bacteria 589
77 Ga0207700_10087325 3300025928 Bacteria 2453
78 Ga0207664_10002194 3300025929 Bacteria 12852
79 Ga0207706_10157907 3300025933 Bacteria 1994
80 Ga0207665_10000706 3300025939 Bacteria 22642
81 Ga0207689_10015143 3300025942 Bacteria 6537
82 Ga0207712_10130632 3300025961 Bacteria 1914
83 Ga0207640_10830268 3300025981 Bacteria 803
84 Ga0207639_10030909 3300026041 Bacteria 3932
85 Ga0207678_10011700 3300026067 Bacteria 7701
86 Ga0207674_10457126 3300026116 Bacteria 1234
87 Ga0207675_100022544 3300026118 Bacteria 5864
88 Ga0207683_11540569 3300026121 Bacteria 614
89 Ga0209389_1000080 3300027296 Bacteria 89649
90 Ga0209489_100027 3300027361 Bacteria 188074
91 Ga0209700_100022 3300027363 Bacteria 229977
92 Ga0209179_1047279 3300027512 Bacteria 916
93 Ga0209588_1000255 3300027671 Bacteria 14073
94 Ga0209588_1016162 3300027671 Bacteria 2300
95 Ga0209588_1049273 3300027671 Bacteria 1363
96 Ga0209588_1077089 3300027671 Unclassified 1077
97 Ga0209588_1133703 3300027671 Bacteria 790
98 Ga0265337_1002332 3300028556 Bacteria 8801
99 Ga0265326_10063707 3300028558 Bacteria 1042
100 Ga0265319_1023634 3300028563 Bacteria 2225
101 Ga0265334_10014790 3300028573 Bacteria 3248
102 Ga0265323_10000051 3300028653 Bacteria 64400
103 Ga0265336_10000026 3300028666 Bacteria 182259
104 Ga0265338_10000018 3300028800 Bacteria 338910
105 Ga0265324_10000143 3300029957 Bacteria 55192
106 Ga0307509_10054051 3300031507 Bacteria 4277
107 Ga0307508_10012934 3300031616 Bacteria 7631
108 Ga0307508_10408454 3300031616 Unclassified 949
109 Ga0307516_10022534 3300031730 Bacteria 6464
110 Ga0307412_10171412 3300031911 Bacteria 1623
111 Ga0307416_103059105 3300032002 Bacteria 560
112 Ga0307510_10008042 3300033180 Bacteria 12553
113 Ga0307510_10015907 3300033180 Bacteria 8890
114 Ga0307510_10044181 3300033180 Bacteria 4830
115 Ga0307510_10156566 3300033180 Bacteria 1884
116 Ga0373923_0026106 3300035111 Bacteria 2322
117 Ga0373932_0065047 3300035112 Bacteria 1118
118 Ga0373953_0553102 3300035117 Bacteria 512
119 Ga0373924_0324920 3300035410 Bacteria 684
120 Ga0373935_0039459 3300035692 Bacteria 2961
121 Ga0373935_0181477 3300035692 Bacteria 1446
122 Ga0373927_0021898 3300035695 Bacteria 4189
123 Ga0373927_0029201 3300035695 Bacteria 3594
124 Ga0373927_0998634 3300035695 Unclassified 552
125 Ga0373947_0055982 3300035725 Bacteria 2383
126 Ga0373937_0144839 3300036401 Bacteria 2223
127 Ga0373925_0064334 3300037068 Bacteria 2761
128 Ga0373925_0359533 3300037068 Bacteria 1183
129 Ga0395899_0096512 3300037312 Bacteria 2137
130 Ga0395900_0735844 3300037418 Bacteria 917
131 Ga0395898_0550809 3300037466 Bacteria 1095
132 Ga0395898_0555996 3300037466 Bacteria 1090
133 Ga0395905_0007254 3300037471 Bacteria 11044
134 Ga0395901_0096239 3300038443 Bacteria 3103
135 Ga0395901_0438931 3300038443 Bacteria 1336
136 Ga0436365_0164427 3300039437 Bacteria 6702
137 Ga0436360_0757636 3300039438 Bacteria 768
138 Ga0436360_0858237 3300039438 Bacteria 1150
139 Ga0436361_0306743 3300039447 Bacteria 3613
140 Ga0436362_0408815 3300039453 Bacteria 1659
141 Ga0451797_0348983 3300041453 Unclassified 555
142 Ga0451797_0493476 3300041453 Bacteria 889
143 Ga0451843_0240243 3300041509 Bacteria 1085
144 Ga0466969_0074429 3300044656 Bacteria 1629
145 Ga0466972_0180607 3300044658 Bacteria 990
146 Ga0466965_0679065 3300044683 Unclassified 590
147 Ga0466964_0012218 3300044706 Bacteria 3249
148 Ga0466960_0098236 3300044901 Bacteria 1504
149 Ga0466960_0241098 3300044901 Bacteria 1001
150 Ga0466959_0086645 3300045049 Bacteria 2253
151 Ga0495603_0288780 3300046455 Unclassified 942
152 Ga0495603_0425367 3300046455 Bacteria 761
153 Ga0495638_0124050 3300046460 Bacteria 1523
154 Ga0495607_0071857 3300046501 Bacteria 1928
155 Ga0495583_0191078 3300046506 Bacteria 835
156 Ga0495606_0138793 3300046507 Bacteria 1437
157 Ga0495610_0034889 3300046512 Bacteria 2587
158 Ga0495616_0103184 3300046513 Bacteria 1335
159 Ga0495620_0081433 3300046515 Bacteria 1309
160 Ga0495632_0200864 3300046519 Bacteria 908
161 Ga0495637_0048828 3300046520 Bacteria 1781
162 Ga0495648_0001381 3300046524 Bacteria 23912
163 Ga0495648_0216010 3300046524 Bacteria 949
164 Ga0495652_1118469 3300046529 Unclassified 511
165 Ga0495654_0061854 3300046530 Bacteria 1796
166 Ga0495597_0081609 3300046542 Bacteria 1383
167 Ga0495622_0008270 3300046557 Bacteria 4819
168 Ga0495668_0694848 3300046616 Unclassified 563
169 Ga0495625_0022547 3300046660 Bacteria 4826
170 Ga0495659_0483776 3300046664 Bacteria 541
171 Ga0495661_0050507 3300046665 Bacteria 2517
172 Ga0495588_0004688 3300046674 Bacteria 6040
173 Ga0495588_0177327 3300046674 Bacteria 1126
174 Ga0495647_0276754 3300046681 Unclassified 752
175 Ga0495670_0116779 3300046691 Bacteria 1384
176 Ga0495671_0371160 3300046692 Bacteria 686
177 Ga0495660_0124809 3300046810 Bacteria 1298
178 Ga0495672_0194928 3300047320 Bacteria 1016
179 Ga0495676_0824216 3300047321 Bacteria 597
180 Ga0495673_0103594 3300047469 Bacteria 1147
181 Ga0495686_0009424 3300047472 Bacteria 7033
182 Ga0496111_0090155 3300048914 Bacteria 2246
183 Ga0496116_0001272 3300048919 Bacteria 29014
184 Ga0496117_0044893 3300048920 Bacteria 3197
185 Ga0496117_0076273 3300048920 Bacteria 2223
186 Ga0496117_0079865 3300048920 Bacteria 2153
187 Ga0496118_0032772 3300048921 Bacteria 4272
188 Ga0496118_0077493 3300048921 Bacteria 2357
189 Ga0496119_0074527 3300048922 Bacteria 1976
190 Ga0496119_0314269 3300048922 Bacteria 768
191 Ga0496120_0070296 3300048923 Bacteria 1926
192 Ga0496120_0407884 3300048923 Unclassified 599
193 Ga0496121_0013955 3300048924 Bacteria 8583
194 Ga0496121_0173920 3300048924 Bacteria 1561
195 Ga0496121_0583672 3300048924 Bacteria 693
196 Ga0496122_0098919 3300048925 Bacteria 1957
197 Ga0496122_0161764 3300048925 Bacteria 1364
198 Ga0496122_0206407 3300048925 Bacteria 1143
199 Ga0496123_0069545 3300048926 Bacteria 2209
200 Ga0496123_0164990 3300048926 Bacteria 1176
201 Ga0496124_0126810 3300048927 Bacteria 2032
202 Ga0496125_0000207 3300048928 Bacteria 122897
203 Ga0496125_0000571 3300048928 Bacteria 63074
204 Ga0496125_0007178 3300048928 Bacteria 11881
205 Ga0496125_0022793 3300048928 Bacteria 5804
206 Ga0496125_0350302 3300048928 Bacteria 882
207 Ga0496125_0630914 3300048928 Bacteria 580
208 Ga0496126_0125069 3300048929 Bacteria 2226
209 Ga0496126_0268575 3300048929 Bacteria 1416
210 Ga0496126_0352953 3300048929 Bacteria 1202
211 Ga0501031_0416534 3300049568 Bacteria 869
212 Ga0501032_0004059 3300049569 Bacteria 11102
213 Ga0501032_0018101 3300049569 Bacteria 4940
214 Ga0501032_0652163 3300049569 Unclassified 668
215 Ga0501032_0891708 3300049569 Bacteria 560
216 Ga0501032_0966806 3300049569 Bacteria 535
217 Ga0501033_0011266 3300049570 Bacteria 6845
218 Ga0501033_0159290 3300049570 Bacteria 1625
219 Ga0501033_0311184 3300049570 Bacteria 1107
220 Ga0501033_0381502 3300049570 Bacteria 985
221 Ga0501034_0122952 3300049571 Bacteria 2581
222 Ga0501034_0164760 3300049571 Bacteria 2186
223 Ga0501034_0280419 3300049571 Bacteria 1606
224 Ga0501034_0402684 3300049571 Bacteria 1291
225 Ga0501036_0000909 3300049572 Bacteria 22186
226 Ga0501036_0341703 3300049572 Bacteria 1250
227 Ga0501036_0692517 3300049572 Bacteria 842
228 Ga0501036_1673782 3300049572 Bacteria 513
229 Ga0501037_0112037 3300049573 Bacteria 1965
230 Ga0501037_0125282 3300049573 Bacteria 1845
231 Ga0501038_0024071 3300049574 Bacteria 5435
232 Ga0501038_0024740 3300049574 Bacteria 5353
233 Ga0501038_0128789 3300049574 Bacteria 2080
234 Ga0501038_0227730 3300049574 Bacteria 1485
235 Ga0501039_0134215 3300049575 Bacteria 1943
236 Ga0501039_0328081 3300049575 Bacteria 1203
237 Ga0501043_0028017 3300049579 Bacteria 4421
238 Ga0501043_0045951 3300049579 Bacteria 3433
239 Ga0501043_0220341 3300049579 Bacteria 1468
240 Ga0501043_0296086 3300049579 Bacteria 1238
241 Ga0501046_0197329 3300049580 Bacteria 1499
242 Ga0501046_0956556 3300049580 Bacteria 596
243 Ga0501047_0011912 3300049581 Bacteria 8231
244 Ga0501047_0092474 3300049581 Bacteria 2903
245 Ga0501047_0312105 3300049581 Bacteria 1413
246 Ga0501070_0142713 3300049586 Bacteria 1977
247 Ga0501070_0191470 3300049586 Bacteria 1681
248 Ga0501070_0366652 3300049586 Bacteria 1168
249 Ga0501070_0666365 3300049586 Bacteria 825
250 Ga0501080_1060190 3300049742 Bacteria 701
251 Ga0501035_0015337 3300049822 Bacteria 7073
252 Ga0501035_0065779 3300049822 Bacteria 3218
253 Ga0501035_0205040 3300049822 Bacteria 1689
254 Ga0501035_0379754 3300049822 Bacteria 1179
255 Ga0501035_1219418 3300049822 Bacteria 583
256 Ga0501044_0002628 3300049823 Bacteria 20433
257 Ga0501044_0032582 3300049823 Bacteria 5477
258 Ga0501044_0036135 3300049823 Bacteria 5169
259 Ga0501044_0213266 3300049823 Bacteria 1884
260 Ga0501044_0792434 3300049823 Bacteria 827
261 Ga0501044_1293589 3300049823 Bacteria 596
262 nmdc:mga00v17_157901_c1 3300050491 Bacteria 1459
263 nmdc:mga00v17_260567_c1 3300050491 Bacteria 1125
264 nmdc:mga00v17_459925_c1 3300050491 Bacteria 826
265 nmdc:mga0yw44_127204_c1 3300050492 Bacteria 1647
266 nmdc:mga0yw44_9960_c1 3300050492 Bacteria 4833
267 nmdc:mga0k408_199913_c1 3300050493 Bacteria 1193
268 nmdc:mga0k408_402313_c1 3300050493 Bacteria 815
269 nmdc:mga05p37_207215_c1 3300050507 Bacteria 2371
270 nmdc:mga0sz30_206473_c1 3300050516 Bacteria 872
271 nmdc:mga0sz30_217348_c1 3300050516 Bacteria 850
272 nmdc:mga0sz30_4207_c1 3300050516 Bacteria 5186
273 Ga0500635_0045726 3300053080 Bacteria 1482
274 Ga0500643_009045 3300053087 Bacteria 3847
275 Ga0500643_011509 3300053087 Bacteria 3225
276 Ga0500644_0316204 3300053088 Bacteria 670
277 Ga0500581_105112 3300053089 Bacteria 1383
278 Ga0500651_0002618 3300053093 Bacteria 9560
279 Ga0500651_0167068 3300053093 Bacteria 1313
280 Ga0500566_0000135 3300053094 Bacteria 37782
281 Ga0500641_0002754 3300053096 Bacteria 6210
282 Ga0500650_0001341 3300053098 Bacteria 7357
283 Ga0500556_0000030 3300053104 Bacteria 165098
284 Ga0500562_048828 3300053108 Bacteria 1130
285 Ga0500569_053246 3300053109 Bacteria 1227
286 Ga0500594_0085153 3300053118 Bacteria 951
287 Ga0500595_000996 3300053119 Bacteria 15918
288 Ga0500608_008208 3300053122 Bacteria 4374
289 Ga0500621_285324 3300053126 Bacteria 536
290 Ga0500642_0000028 3300053130 Bacteria 117281
291 Ga0500642_0000380 3300053130 Bacteria 14869
292 Ga0500652_002054 3300053131 Bacteria 6059
293 Ga0500559_0000204 3300053136 Bacteria 47160
294 Ga0500568_0007288 3300053139 Bacteria 5442
295 Ga0500577_0416654 3300053142 Bacteria 587
296 Ga0500590_071217 3300053148 Bacteria 1727
297 Ga0500604_0089944 3300053151 Bacteria 1001
298 Ga0500604_0263526 3300053151 Bacteria 597
299 Ga0500616_0000252 3300053153 Bacteria 83060
300 Ga0500619_053283 3300053154 Bacteria 1314
301 Ga0500622_0000810 3300053156 Bacteria 26795
302 Ga0500624_042354 3300053157 Bacteria 822
303 Ga0500627_0061812 3300053158 Bacteria 1648
304 Ga0500627_0402876 3300053158 Bacteria 582
305 Ga0500633_0317441 3300053160 Bacteria 571
306 Ga0500634_0076582 3300053161 Bacteria 1736
307 Ga0500638_154051 3300053162 Bacteria 1019
308 Ga0500638_255758 3300053162 Bacteria 702
309 Ga0500639_193749 3300053163 Bacteria 882
310 Ga0500636_0000525 3300053177 Bacteria 20813
311 Ga0500637_0004569 3300053178 Bacteria 6586
312 Ga0500637_0060110 3300053178 Bacteria 2176
313 Ga0500645_016071 3300053730 Bacteria 2362
314 Ga0500645_091676 3300053730 Bacteria 861
315 Ga0501082_0924750 3300060353 Bacteria 763

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005440 Ga0070705_100585017 Ga0070705_1005850172 90
2 3300009148 Ga0105243_10680900 Ga0105243_106809001 90
3 iso_pu_bacteria 2857509624 2857510750 90
4 iso_pu_bacteria 2885366525 2885368083 90
5 iso_pu_bacteria 8016622563 8016624434 90
6 iso_pu_bacteria 8019547302 8019551458 90
7 3300006038 Ga0075365_10062692 Ga0075365_100626923 91
8 3300006051 Ga0075364_10204267 Ga0075364_102042672 91
9 3300006177 Ga0075362_10127315 Ga0075362_101273152 91
10 3300006186 Ga0075369_10103407 Ga0075369_101034073 91
11 3300006844 Ga0075428_100144117 Ga0075428_1001441173 91
12 3300006881 Ga0068865_102199699 Ga0068865_1021996991 91
13 3300009147 Ga0114129_10263744 Ga0114129_102637443 91
14 3300013104 Ga0157370_10567735 Ga0157370_105677352 91
15 3300041453 Ga0451797_0493476 Ga0451797_0493476_424_702 91
16 3300050491 nmdc:mga00v17_157901_c1 nmdc:mga00v17_157901_c1_547_843 91
17 3300050492 nmdc:mga0yw44_127204_c1 nmdc:mga0yw44_127204_c1_1196_1492 91
18 3300050493 nmdc:mga0k408_199913_c1 nmdc:mga0k408_199913_c1_775_1071 91
19 3300050507 nmdc:mga05p37_207215_c1 nmdc:mga05p37_207215_c1_1185_1481 91
20 3300050516 nmdc:mga0sz30_217348_c1 nmdc:mga0sz30_217348_c1_505_801 91
21 3300021441 Ga0213871_10023920 Ga0213871_100239202 92
22 3300039438 Ga0436360_0757636 Ga0436360_0757636_219_518 92
23 iso_pu_bacteria 2876761206 2876765836 92
24 iso_pu_bacteria 2513237098 2513671519 93
25 iso_pu_bacteria 2602042107 2603859714 93
26 iso_pu_bacteria 2643221651 2644291476 93
27 iso_pu_bacteria 2857524615 2857530699 93
28 iso_pu_bacteria 2876808645 2876813357 93
29 iso_pu_bacteria 2879110137 2879113533 93
30 iso_pu_bacteria 2889033259 2889037102 93
31 iso_pu_bacteria 2893066018 2893070324 93
32 iso_pu_bacteria 2919073203 2919076276 93
33 3300005327 Ga0070658_10047142 Ga0070658_100471423 94
34 3300005564 Ga0070664_101246747 Ga0070664_1012467472 94
35 3300005578 Ga0068854_102204573 Ga0068854_1022045732 94
36 3300005614 Ga0068856_100917125 Ga0068856_1009171252 94
37 3300014325 Ga0163163_10994635 Ga0163163_109946352 94
38 3300025297 Ga0209758_1000131 Ga0209758_1000131166 94
39 3300025921 Ga0207652_11615893 Ga0207652_116158931 94
40 3300025981 Ga0207640_10830268 Ga0207640_108302682 94
41 3300026041 Ga0207639_10030909 Ga0207639_100309093 94
42 3300027296 Ga0209389_1000080 Ga0209389_100008071 94
43 3300027361 Ga0209489_100027 Ga0209489_100027178 94
44 3300027363 Ga0209700_100022 Ga0209700_100022211 94
45 3300033180 Ga0307510_10008042 Ga0307510_100080423 94
46 3300037466 Ga0395898_0555996 Ga0395898_0555996_204_488 94
47 3300037471 Ga0395905_0007254 Ga0395905_0007254_7411_7695 94
48 3300038443 Ga0395901_0096239 Ga0395901_0096239_747_1031 94
49 3300041509 Ga0451843_0240243 Ga0451843_0240243_225_509 94
50 3300044656 Ga0466969_0074429 Ga0466969_0074429_472_756 94
51 3300044658 Ga0466972_0180607 Ga0466972_0180607_445_729 94
52 3300044683 Ga0466965_0679065 Ga0466965_0679065_264_548 94
53 3300044706 Ga0466964_0012218 Ga0466964_0012218_1642_1935 94
54 3300044901 Ga0466960_0098236 Ga0466960_0098236_964_1248 94
55 3300044901 Ga0466960_0241098 Ga0466960_0241098_429_722 94
56 3300045049 Ga0466959_0086645 Ga0466959_0086645_1932_2216 94
57 3300048914 Ga0496111_0090155 Ga0496111_0090155_1730_2014 94
58 3300050516 nmdc:mga0sz30_206473_c1 nmdc:mga0sz30_206473_c1_78_362 94
59 3300053130 Ga0500642_0000380 Ga0500642_0000380_9190_9474 94
60 3300021361 Ga0213872_10047530 Ga0213872_100475302 95
61 3300031507 Ga0307509_10054051 Ga0307509_100540514 95
62 3300033180 Ga0307510_10044181 Ga0307510_100441813 95
63 3300039447 Ga0436361_0306743 Ga0436361_0306743_889_1215 95
64 3300049580 Ga0501046_0956556 Ga0501046_0956556_121_414 95
65 3300007265 Ga0099794_10180739 Ga0099794_101807392 96
66 3300027671 Ga0209588_1077089 Ga0209588_10770892 96
67 3300049569 Ga0501032_0652163 Ga0501032_0652163_358_654 96
68 3300049570 Ga0501033_0159290 Ga0501033_0159290_523_819 96
69 3300049571 Ga0501034_0402684 Ga0501034_0402684_383_679 96
70 3300049573 Ga0501037_0125282 Ga0501037_0125282_536_832 96
71 3300049574 Ga0501038_0024071 Ga0501038_0024071_715_1011 96
72 3300049575 Ga0501039_0328081 Ga0501039_0328081_130_426 96
73 3300049579 Ga0501043_0220341 Ga0501043_0220341_361_657 96
74 3300049581 Ga0501047_0092474 Ga0501047_0092474_888_1184 96
75 3300049586 Ga0501070_0666365 Ga0501070_0666365_497_793 96
76 3300049822 Ga0501035_0379754 Ga0501035_0379754_234_530 96
77 3300049823 Ga0501044_0213266 Ga0501044_0213266_855_1151 96
78 3300053119 Ga0500595_000996 Ga0500595_000996_5597_5899 96
79 3300005327 Ga0070658_10007876 Ga0070658_100078766 97
80 3300005366 Ga0070659_100585924 Ga0070659_1005859242 97
81 3300005367 Ga0070667_101808126 Ga0070667_1018081262 97
82 3300005434 Ga0070709_10000624 Ga0070709_1000062415 97
83 3300005435 Ga0070714_100018303 Ga0070714_1000183035 97
84 3300005435 Ga0070714_100225607 Ga0070714_1002256072 97
85 3300005436 Ga0070713_100058471 Ga0070713_1000584714 97
86 3300005437 Ga0070710_10005253 Ga0070710_100052532 97
87 3300005439 Ga0070711_100002089 Ga0070711_1000020895 97
88 3300005455 Ga0070663_100115162 Ga0070663_1001151624 97
89 3300005456 Ga0070678_100314175 Ga0070678_1003141752 97
90 3300005457 Ga0070662_100547807 Ga0070662_1005478072 97
91 3300005530 Ga0070679_101070333 Ga0070679_1010703332 97
92 3300005548 Ga0070665_101716286 Ga0070665_1017162861 97
93 3300005577 Ga0068857_100899284 Ga0068857_1008992842 97
94 3300005614 Ga0068856_101611324 Ga0068856_1016113242 97
95 3300005719 Ga0068861_100274760 Ga0068861_1002747601 97
96 3300005842 Ga0068858_100547530 Ga0068858_1005475302 97
97 3300006028 Ga0070717_10835769 Ga0070717_108357691 97
98 3300006038 Ga0075365_10040125 Ga0075365_100401253 97
99 3300006038 Ga0075365_10124736 Ga0075365_101247362 97
100 3300006048 Ga0075363_100850067 Ga0075363_1008500672 97
101 3300006051 Ga0075364_10060149 Ga0075364_100601494 97
102 3300006051 Ga0075364_11038553 Ga0075364_110385531 97
103 3300006163 Ga0070715_10052455 Ga0070715_100524552 97
104 3300006173 Ga0070716_100001552 Ga0070716_10000155211 97
105 3300006178 Ga0075367_10229878 Ga0075367_102298782 97
106 3300006186 Ga0075369_10049341 Ga0075369_100493413 97
107 3300006195 Ga0075366_10365415 Ga0075366_103654152 97
108 3300007265 Ga0099794_10000754 Ga0099794_100007545 97
109 3300007265 Ga0099794_10009159 Ga0099794_100091592 97
110 3300007265 Ga0099794_10224611 Ga0099794_102246112 97
111 3300007265 Ga0099794_10292211 Ga0099794_102922111 97
112 3300007788 Ga0099795_10096439 Ga0099795_100964392 97
113 3300009098 Ga0105245_10287760 Ga0105245_102877603 97
114 3300009101 Ga0105247_10162358 Ga0105247_101623583 97
115 3300009101 Ga0105247_11180561 Ga0105247_111805612 97
116 3300009545 Ga0105237_10179526 Ga0105237_101795263 97
117 3300009553 Ga0105249_10034081 Ga0105249_100340816 97
118 3300013104 Ga0157370_10571889 Ga0157370_105718892 97
119 3300014968 Ga0157379_10331537 Ga0157379_103315372 97
120 3300021358 Ga0213873_10053622 Ga0213873_100536222 97
121 3300021384 Ga0213876_10003801 Ga0213876_100038015 97
122 3300025295 Ga0209564_1010320 Ga0209564_10103202 97
123 3300025898 Ga0207692_10000311 Ga0207692_1000031112 97
124 3300025900 Ga0207710_10294407 Ga0207710_102944072 97
125 3300025900 Ga0207710_10537080 Ga0207710_105370802 97
126 3300025904 Ga0207647_10153289 Ga0207647_101532892 97
127 3300025905 Ga0207685_10039732 Ga0207685_100397322 97
128 3300025906 Ga0207699_10000235 Ga0207699_1000023511 97
129 3300025909 Ga0207705_10007025 Ga0207705_100070255 97
130 3300025914 Ga0207671_10927048 Ga0207671_109270482 97
131 3300025915 Ga0207693_10116318 Ga0207693_101163182 97
132 3300025916 Ga0207663_10011922 Ga0207663_100119223 97
133 3300025921 Ga0207652_11380079 Ga0207652_113800792 97
134 3300025923 Ga0207681_11392373 Ga0207681_113923731 97
135 3300025928 Ga0207700_10087325 Ga0207700_100873251 97
136 3300025929 Ga0207664_10002194 Ga0207664_1000219410 97
137 3300025933 Ga0207706_10157907 Ga0207706_101579072 97
138 3300025939 Ga0207665_10000706 Ga0207665_100007062 97
139 3300025942 Ga0207689_10015143 Ga0207689_100151433 97
140 3300025961 Ga0207712_10130632 Ga0207712_101306322 97
141 3300026067 Ga0207678_10011700 Ga0207678_100117006 97
142 3300026116 Ga0207674_10457126 Ga0207674_104571262 97
143 3300026118 Ga0207675_100022544 Ga0207675_1000225446 97
144 3300026121 Ga0207683_11540569 Ga0207683_115405691 97
145 3300027512 Ga0209179_1047279 Ga0209179_10472792 97
146 3300027671 Ga0209588_1000255 Ga0209588_10002557 97
147 3300027671 Ga0209588_1016162 Ga0209588_10161622 97
148 3300027671 Ga0209588_1049273 Ga0209588_10492732 97
149 3300027671 Ga0209588_1133703 Ga0209588_11337032 97
150 3300028556 Ga0265337_1002332 Ga0265337_100233212 97
151 3300028558 Ga0265326_10063707 Ga0265326_100637072 97
152 3300028563 Ga0265319_1023634 Ga0265319_10236342 97
153 3300028573 Ga0265334_10014790 Ga0265334_100147904 97
154 3300028653 Ga0265323_10000051 Ga0265323_1000005163 97
155 3300028666 Ga0265336_10000026 Ga0265336_1000002642 97
156 3300028800 Ga0265338_10000018 Ga0265338_1000001883 97
157 3300029957 Ga0265324_10000143 Ga0265324_100001434 97
158 3300031616 Ga0307508_10012934 Ga0307508_100129347 97
159 3300031616 Ga0307508_10408454 Ga0307508_104084542 97
160 3300031730 Ga0307516_10022534 Ga0307516_100225343 97
161 3300031911 Ga0307412_10171412 Ga0307412_101714122 97
162 3300032002 Ga0307416_103059105 Ga0307416_1030591051 97
163 3300033180 Ga0307510_10015907 Ga0307510_100159079 97
164 3300033180 Ga0307510_10156566 Ga0307510_101565662 97
165 3300035111 Ga0373923_0026106 Ga0373923_0026106_94_399 97
166 3300035112 Ga0373932_0065047 Ga0373932_0065047_229_522 97
167 3300035117 Ga0373953_0553102 Ga0373953_0553102_144_449 97
168 3300035410 Ga0373924_0324920 Ga0373924_0324920_47_352 97
169 3300035692 Ga0373935_0039459 Ga0373935_0039459_17_322 97
170 3300035692 Ga0373935_0181477 Ga0373935_0181477_779_1072 97
171 3300035695 Ga0373927_0021898 Ga0373927_0021898_2780_3073 97
172 3300035695 Ga0373927_0029201 Ga0373927_0029201_88_393 97
173 3300035695 Ga0373927_0998634 Ga0373927_0998634_195_488 97
174 3300035725 Ga0373947_0055982 Ga0373947_0055982_1350_1643 97
175 3300036401 Ga0373937_0144839 Ga0373937_0144839_1862_2167 97
176 3300037068 Ga0373925_0064334 Ga0373925_0064334_292_585 97
177 3300037068 Ga0373925_0359533 Ga0373925_0359533_58_363 97
178 3300037312 Ga0395899_0096512 Ga0395899_0096512_1417_1716 97
179 3300037418 Ga0395900_0735844 Ga0395900_0735844_379_678 97
180 3300037466 Ga0395898_0550809 Ga0395898_0550809_180_479 97
181 3300038443 Ga0395901_0438931 Ga0395901_0438931_632_931 97
182 3300039437 Ga0436365_0164427 Ga0436365_0164427_5951_6292 97
183 3300039438 Ga0436360_0858237 Ga0436360_0858237_673_966 97
184 3300039453 Ga0436362_0408815 Ga0436362_0408815_1128_1421 97
185 3300041453 Ga0451797_0348983 Ga0451797_0348983_108_407 97
186 3300046455 Ga0495603_0288780 Ga0495603_0288780_356_649 97
187 3300046455 Ga0495603_0425367 Ga0495603_0425367_263_556 97
188 3300046460 Ga0495638_0124050 Ga0495638_0124050_1004_1297 97
189 3300046501 Ga0495607_0071857 Ga0495607_0071857_886_1179 97
190 3300046506 Ga0495583_0191078 Ga0495583_0191078_169_462 97
191 3300046507 Ga0495606_0138793 Ga0495606_0138793_1065_1358 97
192 3300046512 Ga0495610_0034889 Ga0495610_0034889_1914_2207 97
193 3300046513 Ga0495616_0103184 Ga0495616_0103184_670_963 97
194 3300046515 Ga0495620_0081433 Ga0495620_0081433_399_692 97
195 3300046519 Ga0495632_0200864 Ga0495632_0200864_329_622 97
196 3300046520 Ga0495637_0048828 Ga0495637_0048828_841_1134 97
197 3300046524 Ga0495648_0001381 Ga0495648_0001381_11507_11800 97
198 3300046524 Ga0495648_0216010 Ga0495648_0216010_111_404 97
199 3300046529 Ga0495652_1118469 Ga0495652_1118469_29_334 97
200 3300046530 Ga0495654_0061854 Ga0495654_0061854_635_928 97
201 3300046542 Ga0495597_0081609 Ga0495597_0081609_285_578 97
202 3300046557 Ga0495622_0008270 Ga0495622_0008270_2728_3060 97
203 3300046616 Ga0495668_0694848 Ga0495668_0694848_55_348 97
204 3300046660 Ga0495625_0022547 Ga0495625_0022547_2245_2538 97
205 3300046664 Ga0495659_0483776 Ga0495659_0483776_152_445 97
206 3300046665 Ga0495661_0050507 Ga0495661_0050507_111_404 97
207 3300046674 Ga0495588_0004688 Ga0495588_0004688_3723_4016 97
208 3300046674 Ga0495588_0177327 Ga0495588_0177327_174_467 97
209 3300046681 Ga0495647_0276754 Ga0495647_0276754_181_474 97
210 3300046691 Ga0495670_0116779 Ga0495670_0116779_691_984 97
211 3300046692 Ga0495671_0371160 Ga0495671_0371160_180_473 97
212 3300046810 Ga0495660_0124809 Ga0495660_0124809_462_755 97
213 3300047320 Ga0495672_0194928 Ga0495672_0194928_275_568 97
214 3300047321 Ga0495676_0824216 Ga0495676_0824216_210_503 97
215 3300047469 Ga0495673_0103594 Ga0495673_0103594_259_552 97
216 3300047472 Ga0495686_0009424 Ga0495686_0009424_1509_1802 97
217 3300048919 Ga0496116_0001272 Ga0496116_0001272_26862_27155 97
218 3300048920 Ga0496117_0044893 Ga0496117_0044893_2263_2556 97
219 3300048920 Ga0496117_0076273 Ga0496117_0076273_1316_1609 97
220 3300048920 Ga0496117_0079865 Ga0496117_0079865_161_454 97
221 3300048921 Ga0496118_0032772 Ga0496118_0032772_2166_2459 97
222 3300048921 Ga0496118_0077493 Ga0496118_0077493_680_973 97
223 3300048922 Ga0496119_0074527 Ga0496119_0074527_549_842 97
224 3300048922 Ga0496119_0314269 Ga0496119_0314269_45_338 97
225 3300048923 Ga0496120_0070296 Ga0496120_0070296_528_821 97
226 3300048923 Ga0496120_0407884 Ga0496120_0407884_183_476 97
227 3300048924 Ga0496121_0013955 Ga0496121_0013955_3698_3991 97
228 3300048924 Ga0496121_0173920 Ga0496121_0173920_885_1178 97
229 3300048924 Ga0496121_0583672 Ga0496121_0583672_16_309 97
230 3300048925 Ga0496122_0098919 Ga0496122_0098919_1358_1651 97
231 3300048925 Ga0496122_0161764 Ga0496122_0161764_590_883 97
232 3300048925 Ga0496122_0206407 Ga0496122_0206407_714_1007 97
233 3300048926 Ga0496123_0069545 Ga0496123_0069545_913_1206 97
234 3300048926 Ga0496123_0164990 Ga0496123_0164990_622_915 97
235 3300048927 Ga0496124_0126810 Ga0496124_0126810_1573_1866 97
236 3300048928 Ga0496125_0000207 Ga0496125_0000207_65924_66217 97
237 3300048928 Ga0496125_0000571 Ga0496125_0000571_2127_2420 97
238 3300048928 Ga0496125_0007178 Ga0496125_0007178_7731_8024 97
239 3300048928 Ga0496125_0022793 Ga0496125_0022793_1546_1839 97
240 3300048928 Ga0496125_0350302 Ga0496125_0350302_19_312 97
241 3300048928 Ga0496125_0630914 Ga0496125_0630914_36_329 97
242 3300048929 Ga0496126_0125069 Ga0496126_0125069_135_428 97
243 3300048929 Ga0496126_0268575 Ga0496126_0268575_592_885 97
244 3300048929 Ga0496126_0352953 Ga0496126_0352953_47_340 97
245 3300049568 Ga0501031_0416534 Ga0501031_0416534_233_532 97
246 3300049569 Ga0501032_0004059 Ga0501032_0004059_106_405 97
247 3300049569 Ga0501032_0018101 Ga0501032_0018101_905_1204 97
248 3300049569 Ga0501032_0891708 Ga0501032_0891708_224_523 97
249 3300049569 Ga0501032_0966806 Ga0501032_0966806_165_464 97
250 3300049570 Ga0501033_0011266 Ga0501033_0011266_2184_2483 97
251 3300049570 Ga0501033_0311184 Ga0501033_0311184_207_506 97
252 3300049570 Ga0501033_0381502 Ga0501033_0381502_55_354 97
253 3300049571 Ga0501034_0122952 Ga0501034_0122952_1000_1299 97
254 3300049571 Ga0501034_0164760 Ga0501034_0164760_830_1129 97
255 3300049571 Ga0501034_0280419 Ga0501034_0280419_520_819 97
256 3300049572 Ga0501036_0000909 Ga0501036_0000909_4885_5184 97
257 3300049572 Ga0501036_0341703 Ga0501036_0341703_234_533 97
258 3300049572 Ga0501036_0692517 Ga0501036_0692517_438_737 97
259 3300049572 Ga0501036_1673782 Ga0501036_1673782_156_458 97
260 3300049573 Ga0501037_0112037 Ga0501037_0112037_798_1097 97
261 3300049574 Ga0501038_0024740 Ga0501038_0024740_2424_2723 97
262 3300049574 Ga0501038_0128789 Ga0501038_0128789_831_1130 97
263 3300049574 Ga0501038_0227730 Ga0501038_0227730_1089_1427 97
264 3300049575 Ga0501039_0134215 Ga0501039_0134215_1009_1308 97
265 3300049579 Ga0501043_0028017 Ga0501043_0028017_942_1241 97
266 3300049579 Ga0501043_0045951 Ga0501043_0045951_1140_1439 97
267 3300049579 Ga0501043_0296086 Ga0501043_0296086_388_687 97
268 3300049580 Ga0501046_0197329 Ga0501046_0197329_930_1229 97
269 3300049581 Ga0501047_0011912 Ga0501047_0011912_3375_3674 97
270 3300049581 Ga0501047_0312105 Ga0501047_0312105_791_1090 97
271 3300049586 Ga0501070_0142713 Ga0501070_0142713_723_1022 97
272 3300049586 Ga0501070_0191470 Ga0501070_0191470_884_1183 97
273 3300049586 Ga0501070_0366652 Ga0501070_0366652_403_702 97
274 3300049742 Ga0501080_1060190 Ga0501080_1060190_341_640 97
275 3300049822 Ga0501035_0015337 Ga0501035_0015337_5839_6138 97
276 3300049822 Ga0501035_0065779 Ga0501035_0065779_2284_2583 97
277 3300049822 Ga0501035_0205040 Ga0501035_0205040_862_1161 97
278 3300049822 Ga0501035_1219418 Ga0501035_1219418_131_430 97
279 3300049823 Ga0501044_0002628 Ga0501044_0002628_15450_15749 97
280 3300049823 Ga0501044_0032582 Ga0501044_0032582_1308_1607 97
281 3300049823 Ga0501044_0036135 Ga0501044_0036135_1936_2235 97
282 3300049823 Ga0501044_0792434 Ga0501044_0792434_407_727 97
283 3300049823 Ga0501044_1293589 Ga0501044_1293589_214_513 97
284 3300050491 nmdc:mga00v17_260567_c1 nmdc:mga00v17_260567_c1_454_747 97
285 3300050491 nmdc:mga00v17_459925_c1 nmdc:mga00v17_459925_c1_105_401 97
286 3300050492 nmdc:mga0yw44_9960_c1 nmdc:mga0yw44_9960_c1_2424_2717 97
287 3300050493 nmdc:mga0k408_402313_c1 nmdc:mga0k408_402313_c1_397_693 97
288 3300050516 nmdc:mga0sz30_4207_c1 nmdc:mga0sz30_4207_c1_189_482 97
289 3300053080 Ga0500635_0045726 Ga0500635_0045726_101_400 97
290 3300053087 Ga0500643_009045 Ga0500643_009045_2816_3109 97
291 3300053087 Ga0500643_011509 Ga0500643_011509_1640_1933 97
292 3300053088 Ga0500644_0316204 Ga0500644_0316204_367_660 97
293 3300053089 Ga0500581_105112 Ga0500581_105112_854_1147 97
294 3300053093 Ga0500651_0002618 Ga0500651_0002618_1609_1902 97
295 3300053093 Ga0500651_0167068 Ga0500651_0167068_153_485 97
296 3300053094 Ga0500566_0000135 Ga0500566_0000135_17606_17938 97
297 3300053096 Ga0500641_0002754 Ga0500641_0002754_4404_4697 97
298 3300053098 Ga0500650_0001341 Ga0500650_0001341_3556_3849 97
299 3300053104 Ga0500556_0000030 Ga0500556_0000030_67746_68039 97
300 3300053108 Ga0500562_048828 Ga0500562_048828_302_595 97
301 3300053109 Ga0500569_053246 Ga0500569_053246_699_992 97
302 3300053118 Ga0500594_0085153 Ga0500594_0085153_426_719 97
303 3300053122 Ga0500608_008208 Ga0500608_008208_2857_3150 97
304 3300053126 Ga0500621_285324 Ga0500621_285324_180_473 97
305 3300053130 Ga0500642_0000028 Ga0500642_0000028_76963_77256 97
306 3300053131 Ga0500652_002054 Ga0500652_002054_627_920 97
307 3300053136 Ga0500559_0000204 Ga0500559_0000204_42661_42993 97
308 3300053139 Ga0500568_0007288 Ga0500568_0007288_3148_3441 97
309 3300053142 Ga0500577_0416654 Ga0500577_0416654_245_538 97
310 3300053148 Ga0500590_071217 Ga0500590_071217_545_877 97
311 3300053151 Ga0500604_0089944 Ga0500604_0089944_126_419 97
312 3300053151 Ga0500604_0263526 Ga0500604_0263526_267_566 97
313 3300053153 Ga0500616_0000252 Ga0500616_0000252_61811_62104 97
314 3300053154 Ga0500619_053283 Ga0500619_053283_179_472 97
315 3300053156 Ga0500622_0000810 Ga0500622_0000810_3041_3334 97
316 3300053157 Ga0500624_042354 Ga0500624_042354_361_693 97
317 3300053158 Ga0500627_0061812 Ga0500627_0061812_385_678 97
318 3300053158 Ga0500627_0402876 Ga0500627_0402876_246_539 97
319 3300053160 Ga0500633_0317441 Ga0500633_0317441_137_430 97
320 3300053161 Ga0500634_0076582 Ga0500634_0076582_423_716 97
321 3300053162 Ga0500638_154051 Ga0500638_154051_77_409 97
322 3300053162 Ga0500638_255758 Ga0500638_255758_307_600 97
323 3300053163 Ga0500639_193749 Ga0500639_193749_291_590 97
324 3300053177 Ga0500636_0000525 Ga0500636_0000525_20010_20342 97
325 3300053178 Ga0500637_0004569 Ga0500637_0004569_385_684 97
326 3300053178 Ga0500637_0060110 Ga0500637_0060110_784_1116 97
327 3300053730 Ga0500645_016071 Ga0500645_016071_1826_2119 97
328 3300053730 Ga0500645_091676 Ga0500645_091676_168_461 97
329 3300060353 Ga0501082_0924750 Ga0501082_0924750_205_504 97

Feature Viewer

pLDDT pTM Quality
72.83 0.3 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map