F409681
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 329 | 226 | 315 | 97 |
Family's Representative Sequence
| Representative Sequence | 3300021358|Ga0213873_10053622|Ga0213873_100536222 |
| Length | 113 |
| Sequence | MRAAGRFWATVRSGITMFAQFAASLAAVCSACERHFRCHLRSGAALALASTLLAGCLPATVPVSGADPTDPAAKVADINYRSTIAPYASLRPTTPAPWRDRNDNVAPSPRSDR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 2 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 3 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 4 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 5 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 6 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 7 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 8 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 9 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 10 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 11 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 12 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 17 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 29 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 30 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 31 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 32 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 33 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 35 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 36 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 37 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 40 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 41 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 42 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 43 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 44 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 45 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 46 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 47 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 57 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 58 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 59 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 60 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 61 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 86 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 87 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 88 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 91 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 92 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 93 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 94 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 95 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 96 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 97 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 98 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 99 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 100 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 101 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 102 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 103 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 104 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 105 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 106 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 107 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 108 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 109 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 110 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 111 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 112 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 113 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 114 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 115 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 116 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 117 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 118 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 119 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 120 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 121 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 122 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 123 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 124 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 125 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 126 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 127 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 128 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 129 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 130 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 159 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 160 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 161 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 162 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 163 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 164 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 165 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 166 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 167 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 168 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 169 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 170 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 173 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 174 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 175 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 176 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 177 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 178 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 179 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 180 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 181 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 185 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 186 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 187 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 188 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 189 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 190 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 191 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 192 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 193 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 194 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 195 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 196 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 197 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 198 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 199 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 200 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 201 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 202 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 203 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 204 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 205 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 206 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 207 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 208 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 209 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 210 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 211 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 212 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 213 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 214 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 215 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 216 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 217 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 218 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 219 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 220 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 221 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 222 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 223 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 224 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 225 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 226 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.74 |
| Metatranscriptomes | 0 |
| Isolates | 4.26 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 20.06 |
| Nodule | 2.43 |
| Rhizoplane | 1.22 |
| Rhizosphere | 62.01 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 14.29 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10007876 | 3300005327 | Bacteria | 8582 |
| 2 | Ga0070658_10047142 | 3300005327 | Bacteria | 3487 |
| 3 | Ga0070659_100585924 | 3300005366 | Bacteria | 957 |
| 4 | Ga0070667_101808126 | 3300005367 | Bacteria | 575 |
| 5 | Ga0070709_10000624 | 3300005434 | Bacteria | 20259 |
| 6 | Ga0070714_100018303 | 3300005435 | Bacteria | 5688 |
| 7 | Ga0070714_100225607 | 3300005435 | Bacteria | 1724 |
| 8 | Ga0070713_100058471 | 3300005436 | Bacteria | 3215 |
| 9 | Ga0070710_10005253 | 3300005437 | Bacteria | 6136 |
| 10 | Ga0070711_100002089 | 3300005439 | Bacteria | 11290 |
| 11 | Ga0070705_100585017 | 3300005440 | Bacteria | 861 |
| 12 | Ga0070663_100115162 | 3300005455 | Bacteria | 2025 |
| 13 | Ga0070678_100314175 | 3300005456 | Bacteria | 1336 |
| 14 | Ga0070662_100547807 | 3300005457 | Bacteria | 969 |
| 15 | Ga0070679_101070333 | 3300005530 | Bacteria | 751 |
| 16 | Ga0070665_101716286 | 3300005548 | Bacteria | 635 |
| 17 | Ga0070664_101246747 | 3300005564 | Bacteria | 702 |
| 18 | Ga0068857_100899284 | 3300005577 | Bacteria | 849 |
| 19 | Ga0068854_102204573 | 3300005578 | Bacteria | 510 |
| 20 | Ga0068856_100917125 | 3300005614 | Bacteria | 895 |
| 21 | Ga0068856_101611324 | 3300005614 | Bacteria | 662 |
| 22 | Ga0068861_100274760 | 3300005719 | Bacteria | 1448 |
| 23 | Ga0068858_100547530 | 3300005842 | Bacteria | 1120 |
| 24 | Ga0070717_10835769 | 3300006028 | Unclassified | 838 |
| 25 | Ga0075365_10040125 | 3300006038 | Bacteria | 3052 |
| 26 | Ga0075365_10062692 | 3300006038 | Bacteria | 2487 |
| 27 | Ga0075365_10124736 | 3300006038 | Bacteria | 1779 |
| 28 | Ga0075363_100850067 | 3300006048 | Bacteria | 557 |
| 29 | Ga0075364_10060149 | 3300006051 | Bacteria | 2491 |
| 30 | Ga0075364_10204267 | 3300006051 | Bacteria | 1339 |
| 31 | Ga0075364_11038553 | 3300006051 | Bacteria | 557 |
| 32 | Ga0070715_10052455 | 3300006163 | Bacteria | 1759 |
| 33 | Ga0070716_100001552 | 3300006173 | Bacteria | 10308 |
| 34 | Ga0075362_10127315 | 3300006177 | Bacteria | 1209 |
| 35 | Ga0075367_10229878 | 3300006178 | Bacteria | 1161 |
| 36 | Ga0075369_10049341 | 3300006186 | Bacteria | 1818 |
| 37 | Ga0075369_10103407 | 3300006186 | Bacteria | 1279 |
| 38 | Ga0075366_10365415 | 3300006195 | Bacteria | 886 |
| 39 | Ga0075428_100144117 | 3300006844 | Bacteria | 2589 |
| 40 | Ga0068865_102199699 | 3300006881 | Bacteria | 502 |
| 41 | Ga0099794_10000754 | 3300007265 | Bacteria | 10902 |
| 42 | Ga0099794_10009159 | 3300007265 | Bacteria | 4145 |
| 43 | Ga0099794_10180739 | 3300007265 | Unclassified | 1077 |
| 44 | Ga0099794_10224611 | 3300007265 | Bacteria | 965 |
| 45 | Ga0099794_10292211 | 3300007265 | Bacteria | 843 |
| 46 | Ga0099795_10096439 | 3300007788 | Bacteria | 1154 |
| 47 | Ga0105245_10287760 | 3300009098 | Bacteria | 1608 |
| 48 | Ga0105247_10162358 | 3300009101 | Bacteria | 1480 |
| 49 | Ga0105247_11180561 | 3300009101 | Bacteria | 608 |
| 50 | Ga0114129_10263744 | 3300009147 | Bacteria | 2307 |
| 51 | Ga0105243_10680900 | 3300009148 | Bacteria | 1000 |
| 52 | Ga0105237_10179526 | 3300009545 | Bacteria | 2117 |
| 53 | Ga0105249_10034081 | 3300009553 | Bacteria | 4612 |
| 54 | Ga0157370_10567735 | 3300013104 | Bacteria | 1040 |
| 55 | Ga0157370_10571889 | 3300013104 | Bacteria | 1036 |
| 56 | Ga0163163_10994635 | 3300014325 | Bacteria | 902 |
| 57 | Ga0157379_10331537 | 3300014968 | Bacteria | 1390 |
| 58 | Ga0213873_10053622 | 3300021358 | Bacteria | 1074 |
| 59 | Ga0213872_10047530 | 3300021361 | Bacteria | 1951 |
| 60 | Ga0213876_10003801 | 3300021384 | Bacteria | 8559 |
| 61 | Ga0213871_10023920 | 3300021441 | Bacteria | 1542 |
| 62 | Ga0209564_1010320 | 3300025295 | Bacteria | 4320 |
| 63 | Ga0209758_1000131 | 3300025297 | Bacteria | 184259 |
| 64 | Ga0207692_10000311 | 3300025898 | Bacteria | 16862 |
| 65 | Ga0207710_10294407 | 3300025900 | Unclassified | 819 |
| 66 | Ga0207710_10537080 | 3300025900 | Bacteria | 608 |
| 67 | Ga0207647_10153289 | 3300025904 | Bacteria | 1346 |
| 68 | Ga0207685_10039732 | 3300025905 | Bacteria | 1748 |
| 69 | Ga0207699_10000235 | 3300025906 | Bacteria | 30984 |
| 70 | Ga0207705_10007025 | 3300025909 | Bacteria | 8304 |
| 71 | Ga0207671_10927048 | 3300025914 | Bacteria | 688 |
| 72 | Ga0207693_10116318 | 3300025915 | Bacteria | 2100 |
| 73 | Ga0207663_10011922 | 3300025916 | Bacteria | 4682 |
| 74 | Ga0207652_11380079 | 3300025921 | Bacteria | 608 |
| 75 | Ga0207652_11615893 | 3300025921 | Bacteria | 552 |
| 76 | Ga0207681_11392373 | 3300025923 | Bacteria | 589 |
| 77 | Ga0207700_10087325 | 3300025928 | Bacteria | 2453 |
| 78 | Ga0207664_10002194 | 3300025929 | Bacteria | 12852 |
| 79 | Ga0207706_10157907 | 3300025933 | Bacteria | 1994 |
| 80 | Ga0207665_10000706 | 3300025939 | Bacteria | 22642 |
| 81 | Ga0207689_10015143 | 3300025942 | Bacteria | 6537 |
| 82 | Ga0207712_10130632 | 3300025961 | Bacteria | 1914 |
| 83 | Ga0207640_10830268 | 3300025981 | Bacteria | 803 |
| 84 | Ga0207639_10030909 | 3300026041 | Bacteria | 3932 |
| 85 | Ga0207678_10011700 | 3300026067 | Bacteria | 7701 |
| 86 | Ga0207674_10457126 | 3300026116 | Bacteria | 1234 |
| 87 | Ga0207675_100022544 | 3300026118 | Bacteria | 5864 |
| 88 | Ga0207683_11540569 | 3300026121 | Bacteria | 614 |
| 89 | Ga0209389_1000080 | 3300027296 | Bacteria | 89649 |
| 90 | Ga0209489_100027 | 3300027361 | Bacteria | 188074 |
| 91 | Ga0209700_100022 | 3300027363 | Bacteria | 229977 |
| 92 | Ga0209179_1047279 | 3300027512 | Bacteria | 916 |
| 93 | Ga0209588_1000255 | 3300027671 | Bacteria | 14073 |
| 94 | Ga0209588_1016162 | 3300027671 | Bacteria | 2300 |
| 95 | Ga0209588_1049273 | 3300027671 | Bacteria | 1363 |
| 96 | Ga0209588_1077089 | 3300027671 | Unclassified | 1077 |
| 97 | Ga0209588_1133703 | 3300027671 | Bacteria | 790 |
| 98 | Ga0265337_1002332 | 3300028556 | Bacteria | 8801 |
| 99 | Ga0265326_10063707 | 3300028558 | Bacteria | 1042 |
| 100 | Ga0265319_1023634 | 3300028563 | Bacteria | 2225 |
| 101 | Ga0265334_10014790 | 3300028573 | Bacteria | 3248 |
| 102 | Ga0265323_10000051 | 3300028653 | Bacteria | 64400 |
| 103 | Ga0265336_10000026 | 3300028666 | Bacteria | 182259 |
| 104 | Ga0265338_10000018 | 3300028800 | Bacteria | 338910 |
| 105 | Ga0265324_10000143 | 3300029957 | Bacteria | 55192 |
| 106 | Ga0307509_10054051 | 3300031507 | Bacteria | 4277 |
| 107 | Ga0307508_10012934 | 3300031616 | Bacteria | 7631 |
| 108 | Ga0307508_10408454 | 3300031616 | Unclassified | 949 |
| 109 | Ga0307516_10022534 | 3300031730 | Bacteria | 6464 |
| 110 | Ga0307412_10171412 | 3300031911 | Bacteria | 1623 |
| 111 | Ga0307416_103059105 | 3300032002 | Bacteria | 560 |
| 112 | Ga0307510_10008042 | 3300033180 | Bacteria | 12553 |
| 113 | Ga0307510_10015907 | 3300033180 | Bacteria | 8890 |
| 114 | Ga0307510_10044181 | 3300033180 | Bacteria | 4830 |
| 115 | Ga0307510_10156566 | 3300033180 | Bacteria | 1884 |
| 116 | Ga0373923_0026106 | 3300035111 | Bacteria | 2322 |
| 117 | Ga0373932_0065047 | 3300035112 | Bacteria | 1118 |
| 118 | Ga0373953_0553102 | 3300035117 | Bacteria | 512 |
| 119 | Ga0373924_0324920 | 3300035410 | Bacteria | 684 |
| 120 | Ga0373935_0039459 | 3300035692 | Bacteria | 2961 |
| 121 | Ga0373935_0181477 | 3300035692 | Bacteria | 1446 |
| 122 | Ga0373927_0021898 | 3300035695 | Bacteria | 4189 |
| 123 | Ga0373927_0029201 | 3300035695 | Bacteria | 3594 |
| 124 | Ga0373927_0998634 | 3300035695 | Unclassified | 552 |
| 125 | Ga0373947_0055982 | 3300035725 | Bacteria | 2383 |
| 126 | Ga0373937_0144839 | 3300036401 | Bacteria | 2223 |
| 127 | Ga0373925_0064334 | 3300037068 | Bacteria | 2761 |
| 128 | Ga0373925_0359533 | 3300037068 | Bacteria | 1183 |
| 129 | Ga0395899_0096512 | 3300037312 | Bacteria | 2137 |
| 130 | Ga0395900_0735844 | 3300037418 | Bacteria | 917 |
| 131 | Ga0395898_0550809 | 3300037466 | Bacteria | 1095 |
| 132 | Ga0395898_0555996 | 3300037466 | Bacteria | 1090 |
| 133 | Ga0395905_0007254 | 3300037471 | Bacteria | 11044 |
| 134 | Ga0395901_0096239 | 3300038443 | Bacteria | 3103 |
| 135 | Ga0395901_0438931 | 3300038443 | Bacteria | 1336 |
| 136 | Ga0436365_0164427 | 3300039437 | Bacteria | 6702 |
| 137 | Ga0436360_0757636 | 3300039438 | Bacteria | 768 |
| 138 | Ga0436360_0858237 | 3300039438 | Bacteria | 1150 |
| 139 | Ga0436361_0306743 | 3300039447 | Bacteria | 3613 |
| 140 | Ga0436362_0408815 | 3300039453 | Bacteria | 1659 |
| 141 | Ga0451797_0348983 | 3300041453 | Unclassified | 555 |
| 142 | Ga0451797_0493476 | 3300041453 | Bacteria | 889 |
| 143 | Ga0451843_0240243 | 3300041509 | Bacteria | 1085 |
| 144 | Ga0466969_0074429 | 3300044656 | Bacteria | 1629 |
| 145 | Ga0466972_0180607 | 3300044658 | Bacteria | 990 |
| 146 | Ga0466965_0679065 | 3300044683 | Unclassified | 590 |
| 147 | Ga0466964_0012218 | 3300044706 | Bacteria | 3249 |
| 148 | Ga0466960_0098236 | 3300044901 | Bacteria | 1504 |
| 149 | Ga0466960_0241098 | 3300044901 | Bacteria | 1001 |
| 150 | Ga0466959_0086645 | 3300045049 | Bacteria | 2253 |
| 151 | Ga0495603_0288780 | 3300046455 | Unclassified | 942 |
| 152 | Ga0495603_0425367 | 3300046455 | Bacteria | 761 |
| 153 | Ga0495638_0124050 | 3300046460 | Bacteria | 1523 |
| 154 | Ga0495607_0071857 | 3300046501 | Bacteria | 1928 |
| 155 | Ga0495583_0191078 | 3300046506 | Bacteria | 835 |
| 156 | Ga0495606_0138793 | 3300046507 | Bacteria | 1437 |
| 157 | Ga0495610_0034889 | 3300046512 | Bacteria | 2587 |
| 158 | Ga0495616_0103184 | 3300046513 | Bacteria | 1335 |
| 159 | Ga0495620_0081433 | 3300046515 | Bacteria | 1309 |
| 160 | Ga0495632_0200864 | 3300046519 | Bacteria | 908 |
| 161 | Ga0495637_0048828 | 3300046520 | Bacteria | 1781 |
| 162 | Ga0495648_0001381 | 3300046524 | Bacteria | 23912 |
| 163 | Ga0495648_0216010 | 3300046524 | Bacteria | 949 |
| 164 | Ga0495652_1118469 | 3300046529 | Unclassified | 511 |
| 165 | Ga0495654_0061854 | 3300046530 | Bacteria | 1796 |
| 166 | Ga0495597_0081609 | 3300046542 | Bacteria | 1383 |
| 167 | Ga0495622_0008270 | 3300046557 | Bacteria | 4819 |
| 168 | Ga0495668_0694848 | 3300046616 | Unclassified | 563 |
| 169 | Ga0495625_0022547 | 3300046660 | Bacteria | 4826 |
| 170 | Ga0495659_0483776 | 3300046664 | Bacteria | 541 |
| 171 | Ga0495661_0050507 | 3300046665 | Bacteria | 2517 |
| 172 | Ga0495588_0004688 | 3300046674 | Bacteria | 6040 |
| 173 | Ga0495588_0177327 | 3300046674 | Bacteria | 1126 |
| 174 | Ga0495647_0276754 | 3300046681 | Unclassified | 752 |
| 175 | Ga0495670_0116779 | 3300046691 | Bacteria | 1384 |
| 176 | Ga0495671_0371160 | 3300046692 | Bacteria | 686 |
| 177 | Ga0495660_0124809 | 3300046810 | Bacteria | 1298 |
| 178 | Ga0495672_0194928 | 3300047320 | Bacteria | 1016 |
| 179 | Ga0495676_0824216 | 3300047321 | Bacteria | 597 |
| 180 | Ga0495673_0103594 | 3300047469 | Bacteria | 1147 |
| 181 | Ga0495686_0009424 | 3300047472 | Bacteria | 7033 |
| 182 | Ga0496111_0090155 | 3300048914 | Bacteria | 2246 |
| 183 | Ga0496116_0001272 | 3300048919 | Bacteria | 29014 |
| 184 | Ga0496117_0044893 | 3300048920 | Bacteria | 3197 |
| 185 | Ga0496117_0076273 | 3300048920 | Bacteria | 2223 |
| 186 | Ga0496117_0079865 | 3300048920 | Bacteria | 2153 |
| 187 | Ga0496118_0032772 | 3300048921 | Bacteria | 4272 |
| 188 | Ga0496118_0077493 | 3300048921 | Bacteria | 2357 |
| 189 | Ga0496119_0074527 | 3300048922 | Bacteria | 1976 |
| 190 | Ga0496119_0314269 | 3300048922 | Bacteria | 768 |
| 191 | Ga0496120_0070296 | 3300048923 | Bacteria | 1926 |
| 192 | Ga0496120_0407884 | 3300048923 | Unclassified | 599 |
| 193 | Ga0496121_0013955 | 3300048924 | Bacteria | 8583 |
| 194 | Ga0496121_0173920 | 3300048924 | Bacteria | 1561 |
| 195 | Ga0496121_0583672 | 3300048924 | Bacteria | 693 |
| 196 | Ga0496122_0098919 | 3300048925 | Bacteria | 1957 |
| 197 | Ga0496122_0161764 | 3300048925 | Bacteria | 1364 |
| 198 | Ga0496122_0206407 | 3300048925 | Bacteria | 1143 |
| 199 | Ga0496123_0069545 | 3300048926 | Bacteria | 2209 |
| 200 | Ga0496123_0164990 | 3300048926 | Bacteria | 1176 |
| 201 | Ga0496124_0126810 | 3300048927 | Bacteria | 2032 |
| 202 | Ga0496125_0000207 | 3300048928 | Bacteria | 122897 |
| 203 | Ga0496125_0000571 | 3300048928 | Bacteria | 63074 |
| 204 | Ga0496125_0007178 | 3300048928 | Bacteria | 11881 |
| 205 | Ga0496125_0022793 | 3300048928 | Bacteria | 5804 |
| 206 | Ga0496125_0350302 | 3300048928 | Bacteria | 882 |
| 207 | Ga0496125_0630914 | 3300048928 | Bacteria | 580 |
| 208 | Ga0496126_0125069 | 3300048929 | Bacteria | 2226 |
| 209 | Ga0496126_0268575 | 3300048929 | Bacteria | 1416 |
| 210 | Ga0496126_0352953 | 3300048929 | Bacteria | 1202 |
| 211 | Ga0501031_0416534 | 3300049568 | Bacteria | 869 |
| 212 | Ga0501032_0004059 | 3300049569 | Bacteria | 11102 |
| 213 | Ga0501032_0018101 | 3300049569 | Bacteria | 4940 |
| 214 | Ga0501032_0652163 | 3300049569 | Unclassified | 668 |
| 215 | Ga0501032_0891708 | 3300049569 | Bacteria | 560 |
| 216 | Ga0501032_0966806 | 3300049569 | Bacteria | 535 |
| 217 | Ga0501033_0011266 | 3300049570 | Bacteria | 6845 |
| 218 | Ga0501033_0159290 | 3300049570 | Bacteria | 1625 |
| 219 | Ga0501033_0311184 | 3300049570 | Bacteria | 1107 |
| 220 | Ga0501033_0381502 | 3300049570 | Bacteria | 985 |
| 221 | Ga0501034_0122952 | 3300049571 | Bacteria | 2581 |
| 222 | Ga0501034_0164760 | 3300049571 | Bacteria | 2186 |
| 223 | Ga0501034_0280419 | 3300049571 | Bacteria | 1606 |
| 224 | Ga0501034_0402684 | 3300049571 | Bacteria | 1291 |
| 225 | Ga0501036_0000909 | 3300049572 | Bacteria | 22186 |
| 226 | Ga0501036_0341703 | 3300049572 | Bacteria | 1250 |
| 227 | Ga0501036_0692517 | 3300049572 | Bacteria | 842 |
| 228 | Ga0501036_1673782 | 3300049572 | Bacteria | 513 |
| 229 | Ga0501037_0112037 | 3300049573 | Bacteria | 1965 |
| 230 | Ga0501037_0125282 | 3300049573 | Bacteria | 1845 |
| 231 | Ga0501038_0024071 | 3300049574 | Bacteria | 5435 |
| 232 | Ga0501038_0024740 | 3300049574 | Bacteria | 5353 |
| 233 | Ga0501038_0128789 | 3300049574 | Bacteria | 2080 |
| 234 | Ga0501038_0227730 | 3300049574 | Bacteria | 1485 |
| 235 | Ga0501039_0134215 | 3300049575 | Bacteria | 1943 |
| 236 | Ga0501039_0328081 | 3300049575 | Bacteria | 1203 |
| 237 | Ga0501043_0028017 | 3300049579 | Bacteria | 4421 |
| 238 | Ga0501043_0045951 | 3300049579 | Bacteria | 3433 |
| 239 | Ga0501043_0220341 | 3300049579 | Bacteria | 1468 |
| 240 | Ga0501043_0296086 | 3300049579 | Bacteria | 1238 |
| 241 | Ga0501046_0197329 | 3300049580 | Bacteria | 1499 |
| 242 | Ga0501046_0956556 | 3300049580 | Bacteria | 596 |
| 243 | Ga0501047_0011912 | 3300049581 | Bacteria | 8231 |
| 244 | Ga0501047_0092474 | 3300049581 | Bacteria | 2903 |
| 245 | Ga0501047_0312105 | 3300049581 | Bacteria | 1413 |
| 246 | Ga0501070_0142713 | 3300049586 | Bacteria | 1977 |
| 247 | Ga0501070_0191470 | 3300049586 | Bacteria | 1681 |
| 248 | Ga0501070_0366652 | 3300049586 | Bacteria | 1168 |
| 249 | Ga0501070_0666365 | 3300049586 | Bacteria | 825 |
| 250 | Ga0501080_1060190 | 3300049742 | Bacteria | 701 |
| 251 | Ga0501035_0015337 | 3300049822 | Bacteria | 7073 |
| 252 | Ga0501035_0065779 | 3300049822 | Bacteria | 3218 |
| 253 | Ga0501035_0205040 | 3300049822 | Bacteria | 1689 |
| 254 | Ga0501035_0379754 | 3300049822 | Bacteria | 1179 |
| 255 | Ga0501035_1219418 | 3300049822 | Bacteria | 583 |
| 256 | Ga0501044_0002628 | 3300049823 | Bacteria | 20433 |
| 257 | Ga0501044_0032582 | 3300049823 | Bacteria | 5477 |
| 258 | Ga0501044_0036135 | 3300049823 | Bacteria | 5169 |
| 259 | Ga0501044_0213266 | 3300049823 | Bacteria | 1884 |
| 260 | Ga0501044_0792434 | 3300049823 | Bacteria | 827 |
| 261 | Ga0501044_1293589 | 3300049823 | Bacteria | 596 |
| 262 | nmdc:mga00v17_157901_c1 | 3300050491 | Bacteria | 1459 |
| 263 | nmdc:mga00v17_260567_c1 | 3300050491 | Bacteria | 1125 |
| 264 | nmdc:mga00v17_459925_c1 | 3300050491 | Bacteria | 826 |
| 265 | nmdc:mga0yw44_127204_c1 | 3300050492 | Bacteria | 1647 |
| 266 | nmdc:mga0yw44_9960_c1 | 3300050492 | Bacteria | 4833 |
| 267 | nmdc:mga0k408_199913_c1 | 3300050493 | Bacteria | 1193 |
| 268 | nmdc:mga0k408_402313_c1 | 3300050493 | Bacteria | 815 |
| 269 | nmdc:mga05p37_207215_c1 | 3300050507 | Bacteria | 2371 |
| 270 | nmdc:mga0sz30_206473_c1 | 3300050516 | Bacteria | 872 |
| 271 | nmdc:mga0sz30_217348_c1 | 3300050516 | Bacteria | 850 |
| 272 | nmdc:mga0sz30_4207_c1 | 3300050516 | Bacteria | 5186 |
| 273 | Ga0500635_0045726 | 3300053080 | Bacteria | 1482 |
| 274 | Ga0500643_009045 | 3300053087 | Bacteria | 3847 |
| 275 | Ga0500643_011509 | 3300053087 | Bacteria | 3225 |
| 276 | Ga0500644_0316204 | 3300053088 | Bacteria | 670 |
| 277 | Ga0500581_105112 | 3300053089 | Bacteria | 1383 |
| 278 | Ga0500651_0002618 | 3300053093 | Bacteria | 9560 |
| 279 | Ga0500651_0167068 | 3300053093 | Bacteria | 1313 |
| 280 | Ga0500566_0000135 | 3300053094 | Bacteria | 37782 |
| 281 | Ga0500641_0002754 | 3300053096 | Bacteria | 6210 |
| 282 | Ga0500650_0001341 | 3300053098 | Bacteria | 7357 |
| 283 | Ga0500556_0000030 | 3300053104 | Bacteria | 165098 |
| 284 | Ga0500562_048828 | 3300053108 | Bacteria | 1130 |
| 285 | Ga0500569_053246 | 3300053109 | Bacteria | 1227 |
| 286 | Ga0500594_0085153 | 3300053118 | Bacteria | 951 |
| 287 | Ga0500595_000996 | 3300053119 | Bacteria | 15918 |
| 288 | Ga0500608_008208 | 3300053122 | Bacteria | 4374 |
| 289 | Ga0500621_285324 | 3300053126 | Bacteria | 536 |
| 290 | Ga0500642_0000028 | 3300053130 | Bacteria | 117281 |
| 291 | Ga0500642_0000380 | 3300053130 | Bacteria | 14869 |
| 292 | Ga0500652_002054 | 3300053131 | Bacteria | 6059 |
| 293 | Ga0500559_0000204 | 3300053136 | Bacteria | 47160 |
| 294 | Ga0500568_0007288 | 3300053139 | Bacteria | 5442 |
| 295 | Ga0500577_0416654 | 3300053142 | Bacteria | 587 |
| 296 | Ga0500590_071217 | 3300053148 | Bacteria | 1727 |
| 297 | Ga0500604_0089944 | 3300053151 | Bacteria | 1001 |
| 298 | Ga0500604_0263526 | 3300053151 | Bacteria | 597 |
| 299 | Ga0500616_0000252 | 3300053153 | Bacteria | 83060 |
| 300 | Ga0500619_053283 | 3300053154 | Bacteria | 1314 |
| 301 | Ga0500622_0000810 | 3300053156 | Bacteria | 26795 |
| 302 | Ga0500624_042354 | 3300053157 | Bacteria | 822 |
| 303 | Ga0500627_0061812 | 3300053158 | Bacteria | 1648 |
| 304 | Ga0500627_0402876 | 3300053158 | Bacteria | 582 |
| 305 | Ga0500633_0317441 | 3300053160 | Bacteria | 571 |
| 306 | Ga0500634_0076582 | 3300053161 | Bacteria | 1736 |
| 307 | Ga0500638_154051 | 3300053162 | Bacteria | 1019 |
| 308 | Ga0500638_255758 | 3300053162 | Bacteria | 702 |
| 309 | Ga0500639_193749 | 3300053163 | Bacteria | 882 |
| 310 | Ga0500636_0000525 | 3300053177 | Bacteria | 20813 |
| 311 | Ga0500637_0004569 | 3300053178 | Bacteria | 6586 |
| 312 | Ga0500637_0060110 | 3300053178 | Bacteria | 2176 |
| 313 | Ga0500645_016071 | 3300053730 | Bacteria | 2362 |
| 314 | Ga0500645_091676 | 3300053730 | Bacteria | 861 |
| 315 | Ga0501082_0924750 | 3300060353 | Bacteria | 763 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005440 | Ga0070705_100585017 | Ga0070705_1005850172 | 90 |
| 2 | 3300009148 | Ga0105243_10680900 | Ga0105243_106809001 | 90 |
| 3 | iso_pu_bacteria | 2857509624 | 2857510750 | 90 |
| 4 | iso_pu_bacteria | 2885366525 | 2885368083 | 90 |
| 5 | iso_pu_bacteria | 8016622563 | 8016624434 | 90 |
| 6 | iso_pu_bacteria | 8019547302 | 8019551458 | 90 |
| 7 | 3300006038 | Ga0075365_10062692 | Ga0075365_100626923 | 91 |
| 8 | 3300006051 | Ga0075364_10204267 | Ga0075364_102042672 | 91 |
| 9 | 3300006177 | Ga0075362_10127315 | Ga0075362_101273152 | 91 |
| 10 | 3300006186 | Ga0075369_10103407 | Ga0075369_101034073 | 91 |
| 11 | 3300006844 | Ga0075428_100144117 | Ga0075428_1001441173 | 91 |
| 12 | 3300006881 | Ga0068865_102199699 | Ga0068865_1021996991 | 91 |
| 13 | 3300009147 | Ga0114129_10263744 | Ga0114129_102637443 | 91 |
| 14 | 3300013104 | Ga0157370_10567735 | Ga0157370_105677352 | 91 |
| 15 | 3300041453 | Ga0451797_0493476 | Ga0451797_0493476_424_702 | 91 |
| 16 | 3300050491 | nmdc:mga00v17_157901_c1 | nmdc:mga00v17_157901_c1_547_843 | 91 |
| 17 | 3300050492 | nmdc:mga0yw44_127204_c1 | nmdc:mga0yw44_127204_c1_1196_1492 | 91 |
| 18 | 3300050493 | nmdc:mga0k408_199913_c1 | nmdc:mga0k408_199913_c1_775_1071 | 91 |
| 19 | 3300050507 | nmdc:mga05p37_207215_c1 | nmdc:mga05p37_207215_c1_1185_1481 | 91 |
| 20 | 3300050516 | nmdc:mga0sz30_217348_c1 | nmdc:mga0sz30_217348_c1_505_801 | 91 |
| 21 | 3300021441 | Ga0213871_10023920 | Ga0213871_100239202 | 92 |
| 22 | 3300039438 | Ga0436360_0757636 | Ga0436360_0757636_219_518 | 92 |
| 23 | iso_pu_bacteria | 2876761206 | 2876765836 | 92 |
| 24 | iso_pu_bacteria | 2513237098 | 2513671519 | 93 |
| 25 | iso_pu_bacteria | 2602042107 | 2603859714 | 93 |
| 26 | iso_pu_bacteria | 2643221651 | 2644291476 | 93 |
| 27 | iso_pu_bacteria | 2857524615 | 2857530699 | 93 |
| 28 | iso_pu_bacteria | 2876808645 | 2876813357 | 93 |
| 29 | iso_pu_bacteria | 2879110137 | 2879113533 | 93 |
| 30 | iso_pu_bacteria | 2889033259 | 2889037102 | 93 |
| 31 | iso_pu_bacteria | 2893066018 | 2893070324 | 93 |
| 32 | iso_pu_bacteria | 2919073203 | 2919076276 | 93 |
| 33 | 3300005327 | Ga0070658_10047142 | Ga0070658_100471423 | 94 |
| 34 | 3300005564 | Ga0070664_101246747 | Ga0070664_1012467472 | 94 |
| 35 | 3300005578 | Ga0068854_102204573 | Ga0068854_1022045732 | 94 |
| 36 | 3300005614 | Ga0068856_100917125 | Ga0068856_1009171252 | 94 |
| 37 | 3300014325 | Ga0163163_10994635 | Ga0163163_109946352 | 94 |
| 38 | 3300025297 | Ga0209758_1000131 | Ga0209758_1000131166 | 94 |
| 39 | 3300025921 | Ga0207652_11615893 | Ga0207652_116158931 | 94 |
| 40 | 3300025981 | Ga0207640_10830268 | Ga0207640_108302682 | 94 |
| 41 | 3300026041 | Ga0207639_10030909 | Ga0207639_100309093 | 94 |
| 42 | 3300027296 | Ga0209389_1000080 | Ga0209389_100008071 | 94 |
| 43 | 3300027361 | Ga0209489_100027 | Ga0209489_100027178 | 94 |
| 44 | 3300027363 | Ga0209700_100022 | Ga0209700_100022211 | 94 |
| 45 | 3300033180 | Ga0307510_10008042 | Ga0307510_100080423 | 94 |
| 46 | 3300037466 | Ga0395898_0555996 | Ga0395898_0555996_204_488 | 94 |
| 47 | 3300037471 | Ga0395905_0007254 | Ga0395905_0007254_7411_7695 | 94 |
| 48 | 3300038443 | Ga0395901_0096239 | Ga0395901_0096239_747_1031 | 94 |
| 49 | 3300041509 | Ga0451843_0240243 | Ga0451843_0240243_225_509 | 94 |
| 50 | 3300044656 | Ga0466969_0074429 | Ga0466969_0074429_472_756 | 94 |
| 51 | 3300044658 | Ga0466972_0180607 | Ga0466972_0180607_445_729 | 94 |
| 52 | 3300044683 | Ga0466965_0679065 | Ga0466965_0679065_264_548 | 94 |
| 53 | 3300044706 | Ga0466964_0012218 | Ga0466964_0012218_1642_1935 | 94 |
| 54 | 3300044901 | Ga0466960_0098236 | Ga0466960_0098236_964_1248 | 94 |
| 55 | 3300044901 | Ga0466960_0241098 | Ga0466960_0241098_429_722 | 94 |
| 56 | 3300045049 | Ga0466959_0086645 | Ga0466959_0086645_1932_2216 | 94 |
| 57 | 3300048914 | Ga0496111_0090155 | Ga0496111_0090155_1730_2014 | 94 |
| 58 | 3300050516 | nmdc:mga0sz30_206473_c1 | nmdc:mga0sz30_206473_c1_78_362 | 94 |
| 59 | 3300053130 | Ga0500642_0000380 | Ga0500642_0000380_9190_9474 | 94 |
| 60 | 3300021361 | Ga0213872_10047530 | Ga0213872_100475302 | 95 |
| 61 | 3300031507 | Ga0307509_10054051 | Ga0307509_100540514 | 95 |
| 62 | 3300033180 | Ga0307510_10044181 | Ga0307510_100441813 | 95 |
| 63 | 3300039447 | Ga0436361_0306743 | Ga0436361_0306743_889_1215 | 95 |
| 64 | 3300049580 | Ga0501046_0956556 | Ga0501046_0956556_121_414 | 95 |
| 65 | 3300007265 | Ga0099794_10180739 | Ga0099794_101807392 | 96 |
| 66 | 3300027671 | Ga0209588_1077089 | Ga0209588_10770892 | 96 |
| 67 | 3300049569 | Ga0501032_0652163 | Ga0501032_0652163_358_654 | 96 |
| 68 | 3300049570 | Ga0501033_0159290 | Ga0501033_0159290_523_819 | 96 |
| 69 | 3300049571 | Ga0501034_0402684 | Ga0501034_0402684_383_679 | 96 |
| 70 | 3300049573 | Ga0501037_0125282 | Ga0501037_0125282_536_832 | 96 |
| 71 | 3300049574 | Ga0501038_0024071 | Ga0501038_0024071_715_1011 | 96 |
| 72 | 3300049575 | Ga0501039_0328081 | Ga0501039_0328081_130_426 | 96 |
| 73 | 3300049579 | Ga0501043_0220341 | Ga0501043_0220341_361_657 | 96 |
| 74 | 3300049581 | Ga0501047_0092474 | Ga0501047_0092474_888_1184 | 96 |
| 75 | 3300049586 | Ga0501070_0666365 | Ga0501070_0666365_497_793 | 96 |
| 76 | 3300049822 | Ga0501035_0379754 | Ga0501035_0379754_234_530 | 96 |
| 77 | 3300049823 | Ga0501044_0213266 | Ga0501044_0213266_855_1151 | 96 |
| 78 | 3300053119 | Ga0500595_000996 | Ga0500595_000996_5597_5899 | 96 |
| 79 | 3300005327 | Ga0070658_10007876 | Ga0070658_100078766 | 97 |
| 80 | 3300005366 | Ga0070659_100585924 | Ga0070659_1005859242 | 97 |
| 81 | 3300005367 | Ga0070667_101808126 | Ga0070667_1018081262 | 97 |
| 82 | 3300005434 | Ga0070709_10000624 | Ga0070709_1000062415 | 97 |
| 83 | 3300005435 | Ga0070714_100018303 | Ga0070714_1000183035 | 97 |
| 84 | 3300005435 | Ga0070714_100225607 | Ga0070714_1002256072 | 97 |
| 85 | 3300005436 | Ga0070713_100058471 | Ga0070713_1000584714 | 97 |
| 86 | 3300005437 | Ga0070710_10005253 | Ga0070710_100052532 | 97 |
| 87 | 3300005439 | Ga0070711_100002089 | Ga0070711_1000020895 | 97 |
| 88 | 3300005455 | Ga0070663_100115162 | Ga0070663_1001151624 | 97 |
| 89 | 3300005456 | Ga0070678_100314175 | Ga0070678_1003141752 | 97 |
| 90 | 3300005457 | Ga0070662_100547807 | Ga0070662_1005478072 | 97 |
| 91 | 3300005530 | Ga0070679_101070333 | Ga0070679_1010703332 | 97 |
| 92 | 3300005548 | Ga0070665_101716286 | Ga0070665_1017162861 | 97 |
| 93 | 3300005577 | Ga0068857_100899284 | Ga0068857_1008992842 | 97 |
| 94 | 3300005614 | Ga0068856_101611324 | Ga0068856_1016113242 | 97 |
| 95 | 3300005719 | Ga0068861_100274760 | Ga0068861_1002747601 | 97 |
| 96 | 3300005842 | Ga0068858_100547530 | Ga0068858_1005475302 | 97 |
| 97 | 3300006028 | Ga0070717_10835769 | Ga0070717_108357691 | 97 |
| 98 | 3300006038 | Ga0075365_10040125 | Ga0075365_100401253 | 97 |
| 99 | 3300006038 | Ga0075365_10124736 | Ga0075365_101247362 | 97 |
| 100 | 3300006048 | Ga0075363_100850067 | Ga0075363_1008500672 | 97 |
| 101 | 3300006051 | Ga0075364_10060149 | Ga0075364_100601494 | 97 |
| 102 | 3300006051 | Ga0075364_11038553 | Ga0075364_110385531 | 97 |
| 103 | 3300006163 | Ga0070715_10052455 | Ga0070715_100524552 | 97 |
| 104 | 3300006173 | Ga0070716_100001552 | Ga0070716_10000155211 | 97 |
| 105 | 3300006178 | Ga0075367_10229878 | Ga0075367_102298782 | 97 |
| 106 | 3300006186 | Ga0075369_10049341 | Ga0075369_100493413 | 97 |
| 107 | 3300006195 | Ga0075366_10365415 | Ga0075366_103654152 | 97 |
| 108 | 3300007265 | Ga0099794_10000754 | Ga0099794_100007545 | 97 |
| 109 | 3300007265 | Ga0099794_10009159 | Ga0099794_100091592 | 97 |
| 110 | 3300007265 | Ga0099794_10224611 | Ga0099794_102246112 | 97 |
| 111 | 3300007265 | Ga0099794_10292211 | Ga0099794_102922111 | 97 |
| 112 | 3300007788 | Ga0099795_10096439 | Ga0099795_100964392 | 97 |
| 113 | 3300009098 | Ga0105245_10287760 | Ga0105245_102877603 | 97 |
| 114 | 3300009101 | Ga0105247_10162358 | Ga0105247_101623583 | 97 |
| 115 | 3300009101 | Ga0105247_11180561 | Ga0105247_111805612 | 97 |
| 116 | 3300009545 | Ga0105237_10179526 | Ga0105237_101795263 | 97 |
| 117 | 3300009553 | Ga0105249_10034081 | Ga0105249_100340816 | 97 |
| 118 | 3300013104 | Ga0157370_10571889 | Ga0157370_105718892 | 97 |
| 119 | 3300014968 | Ga0157379_10331537 | Ga0157379_103315372 | 97 |
| 120 | 3300021358 | Ga0213873_10053622 | Ga0213873_100536222 | 97 |
| 121 | 3300021384 | Ga0213876_10003801 | Ga0213876_100038015 | 97 |
| 122 | 3300025295 | Ga0209564_1010320 | Ga0209564_10103202 | 97 |
| 123 | 3300025898 | Ga0207692_10000311 | Ga0207692_1000031112 | 97 |
| 124 | 3300025900 | Ga0207710_10294407 | Ga0207710_102944072 | 97 |
| 125 | 3300025900 | Ga0207710_10537080 | Ga0207710_105370802 | 97 |
| 126 | 3300025904 | Ga0207647_10153289 | Ga0207647_101532892 | 97 |
| 127 | 3300025905 | Ga0207685_10039732 | Ga0207685_100397322 | 97 |
| 128 | 3300025906 | Ga0207699_10000235 | Ga0207699_1000023511 | 97 |
| 129 | 3300025909 | Ga0207705_10007025 | Ga0207705_100070255 | 97 |
| 130 | 3300025914 | Ga0207671_10927048 | Ga0207671_109270482 | 97 |
| 131 | 3300025915 | Ga0207693_10116318 | Ga0207693_101163182 | 97 |
| 132 | 3300025916 | Ga0207663_10011922 | Ga0207663_100119223 | 97 |
| 133 | 3300025921 | Ga0207652_11380079 | Ga0207652_113800792 | 97 |
| 134 | 3300025923 | Ga0207681_11392373 | Ga0207681_113923731 | 97 |
| 135 | 3300025928 | Ga0207700_10087325 | Ga0207700_100873251 | 97 |
| 136 | 3300025929 | Ga0207664_10002194 | Ga0207664_1000219410 | 97 |
| 137 | 3300025933 | Ga0207706_10157907 | Ga0207706_101579072 | 97 |
| 138 | 3300025939 | Ga0207665_10000706 | Ga0207665_100007062 | 97 |
| 139 | 3300025942 | Ga0207689_10015143 | Ga0207689_100151433 | 97 |
| 140 | 3300025961 | Ga0207712_10130632 | Ga0207712_101306322 | 97 |
| 141 | 3300026067 | Ga0207678_10011700 | Ga0207678_100117006 | 97 |
| 142 | 3300026116 | Ga0207674_10457126 | Ga0207674_104571262 | 97 |
| 143 | 3300026118 | Ga0207675_100022544 | Ga0207675_1000225446 | 97 |
| 144 | 3300026121 | Ga0207683_11540569 | Ga0207683_115405691 | 97 |
| 145 | 3300027512 | Ga0209179_1047279 | Ga0209179_10472792 | 97 |
| 146 | 3300027671 | Ga0209588_1000255 | Ga0209588_10002557 | 97 |
| 147 | 3300027671 | Ga0209588_1016162 | Ga0209588_10161622 | 97 |
| 148 | 3300027671 | Ga0209588_1049273 | Ga0209588_10492732 | 97 |
| 149 | 3300027671 | Ga0209588_1133703 | Ga0209588_11337032 | 97 |
| 150 | 3300028556 | Ga0265337_1002332 | Ga0265337_100233212 | 97 |
| 151 | 3300028558 | Ga0265326_10063707 | Ga0265326_100637072 | 97 |
| 152 | 3300028563 | Ga0265319_1023634 | Ga0265319_10236342 | 97 |
| 153 | 3300028573 | Ga0265334_10014790 | Ga0265334_100147904 | 97 |
| 154 | 3300028653 | Ga0265323_10000051 | Ga0265323_1000005163 | 97 |
| 155 | 3300028666 | Ga0265336_10000026 | Ga0265336_1000002642 | 97 |
| 156 | 3300028800 | Ga0265338_10000018 | Ga0265338_1000001883 | 97 |
| 157 | 3300029957 | Ga0265324_10000143 | Ga0265324_100001434 | 97 |
| 158 | 3300031616 | Ga0307508_10012934 | Ga0307508_100129347 | 97 |
| 159 | 3300031616 | Ga0307508_10408454 | Ga0307508_104084542 | 97 |
| 160 | 3300031730 | Ga0307516_10022534 | Ga0307516_100225343 | 97 |
| 161 | 3300031911 | Ga0307412_10171412 | Ga0307412_101714122 | 97 |
| 162 | 3300032002 | Ga0307416_103059105 | Ga0307416_1030591051 | 97 |
| 163 | 3300033180 | Ga0307510_10015907 | Ga0307510_100159079 | 97 |
| 164 | 3300033180 | Ga0307510_10156566 | Ga0307510_101565662 | 97 |
| 165 | 3300035111 | Ga0373923_0026106 | Ga0373923_0026106_94_399 | 97 |
| 166 | 3300035112 | Ga0373932_0065047 | Ga0373932_0065047_229_522 | 97 |
| 167 | 3300035117 | Ga0373953_0553102 | Ga0373953_0553102_144_449 | 97 |
| 168 | 3300035410 | Ga0373924_0324920 | Ga0373924_0324920_47_352 | 97 |
| 169 | 3300035692 | Ga0373935_0039459 | Ga0373935_0039459_17_322 | 97 |
| 170 | 3300035692 | Ga0373935_0181477 | Ga0373935_0181477_779_1072 | 97 |
| 171 | 3300035695 | Ga0373927_0021898 | Ga0373927_0021898_2780_3073 | 97 |
| 172 | 3300035695 | Ga0373927_0029201 | Ga0373927_0029201_88_393 | 97 |
| 173 | 3300035695 | Ga0373927_0998634 | Ga0373927_0998634_195_488 | 97 |
| 174 | 3300035725 | Ga0373947_0055982 | Ga0373947_0055982_1350_1643 | 97 |
| 175 | 3300036401 | Ga0373937_0144839 | Ga0373937_0144839_1862_2167 | 97 |
| 176 | 3300037068 | Ga0373925_0064334 | Ga0373925_0064334_292_585 | 97 |
| 177 | 3300037068 | Ga0373925_0359533 | Ga0373925_0359533_58_363 | 97 |
| 178 | 3300037312 | Ga0395899_0096512 | Ga0395899_0096512_1417_1716 | 97 |
| 179 | 3300037418 | Ga0395900_0735844 | Ga0395900_0735844_379_678 | 97 |
| 180 | 3300037466 | Ga0395898_0550809 | Ga0395898_0550809_180_479 | 97 |
| 181 | 3300038443 | Ga0395901_0438931 | Ga0395901_0438931_632_931 | 97 |
| 182 | 3300039437 | Ga0436365_0164427 | Ga0436365_0164427_5951_6292 | 97 |
| 183 | 3300039438 | Ga0436360_0858237 | Ga0436360_0858237_673_966 | 97 |
| 184 | 3300039453 | Ga0436362_0408815 | Ga0436362_0408815_1128_1421 | 97 |
| 185 | 3300041453 | Ga0451797_0348983 | Ga0451797_0348983_108_407 | 97 |
| 186 | 3300046455 | Ga0495603_0288780 | Ga0495603_0288780_356_649 | 97 |
| 187 | 3300046455 | Ga0495603_0425367 | Ga0495603_0425367_263_556 | 97 |
| 188 | 3300046460 | Ga0495638_0124050 | Ga0495638_0124050_1004_1297 | 97 |
| 189 | 3300046501 | Ga0495607_0071857 | Ga0495607_0071857_886_1179 | 97 |
| 190 | 3300046506 | Ga0495583_0191078 | Ga0495583_0191078_169_462 | 97 |
| 191 | 3300046507 | Ga0495606_0138793 | Ga0495606_0138793_1065_1358 | 97 |
| 192 | 3300046512 | Ga0495610_0034889 | Ga0495610_0034889_1914_2207 | 97 |
| 193 | 3300046513 | Ga0495616_0103184 | Ga0495616_0103184_670_963 | 97 |
| 194 | 3300046515 | Ga0495620_0081433 | Ga0495620_0081433_399_692 | 97 |
| 195 | 3300046519 | Ga0495632_0200864 | Ga0495632_0200864_329_622 | 97 |
| 196 | 3300046520 | Ga0495637_0048828 | Ga0495637_0048828_841_1134 | 97 |
| 197 | 3300046524 | Ga0495648_0001381 | Ga0495648_0001381_11507_11800 | 97 |
| 198 | 3300046524 | Ga0495648_0216010 | Ga0495648_0216010_111_404 | 97 |
| 199 | 3300046529 | Ga0495652_1118469 | Ga0495652_1118469_29_334 | 97 |
| 200 | 3300046530 | Ga0495654_0061854 | Ga0495654_0061854_635_928 | 97 |
| 201 | 3300046542 | Ga0495597_0081609 | Ga0495597_0081609_285_578 | 97 |
| 202 | 3300046557 | Ga0495622_0008270 | Ga0495622_0008270_2728_3060 | 97 |
| 203 | 3300046616 | Ga0495668_0694848 | Ga0495668_0694848_55_348 | 97 |
| 204 | 3300046660 | Ga0495625_0022547 | Ga0495625_0022547_2245_2538 | 97 |
| 205 | 3300046664 | Ga0495659_0483776 | Ga0495659_0483776_152_445 | 97 |
| 206 | 3300046665 | Ga0495661_0050507 | Ga0495661_0050507_111_404 | 97 |
| 207 | 3300046674 | Ga0495588_0004688 | Ga0495588_0004688_3723_4016 | 97 |
| 208 | 3300046674 | Ga0495588_0177327 | Ga0495588_0177327_174_467 | 97 |
| 209 | 3300046681 | Ga0495647_0276754 | Ga0495647_0276754_181_474 | 97 |
| 210 | 3300046691 | Ga0495670_0116779 | Ga0495670_0116779_691_984 | 97 |
| 211 | 3300046692 | Ga0495671_0371160 | Ga0495671_0371160_180_473 | 97 |
| 212 | 3300046810 | Ga0495660_0124809 | Ga0495660_0124809_462_755 | 97 |
| 213 | 3300047320 | Ga0495672_0194928 | Ga0495672_0194928_275_568 | 97 |
| 214 | 3300047321 | Ga0495676_0824216 | Ga0495676_0824216_210_503 | 97 |
| 215 | 3300047469 | Ga0495673_0103594 | Ga0495673_0103594_259_552 | 97 |
| 216 | 3300047472 | Ga0495686_0009424 | Ga0495686_0009424_1509_1802 | 97 |
| 217 | 3300048919 | Ga0496116_0001272 | Ga0496116_0001272_26862_27155 | 97 |
| 218 | 3300048920 | Ga0496117_0044893 | Ga0496117_0044893_2263_2556 | 97 |
| 219 | 3300048920 | Ga0496117_0076273 | Ga0496117_0076273_1316_1609 | 97 |
| 220 | 3300048920 | Ga0496117_0079865 | Ga0496117_0079865_161_454 | 97 |
| 221 | 3300048921 | Ga0496118_0032772 | Ga0496118_0032772_2166_2459 | 97 |
| 222 | 3300048921 | Ga0496118_0077493 | Ga0496118_0077493_680_973 | 97 |
| 223 | 3300048922 | Ga0496119_0074527 | Ga0496119_0074527_549_842 | 97 |
| 224 | 3300048922 | Ga0496119_0314269 | Ga0496119_0314269_45_338 | 97 |
| 225 | 3300048923 | Ga0496120_0070296 | Ga0496120_0070296_528_821 | 97 |
| 226 | 3300048923 | Ga0496120_0407884 | Ga0496120_0407884_183_476 | 97 |
| 227 | 3300048924 | Ga0496121_0013955 | Ga0496121_0013955_3698_3991 | 97 |
| 228 | 3300048924 | Ga0496121_0173920 | Ga0496121_0173920_885_1178 | 97 |
| 229 | 3300048924 | Ga0496121_0583672 | Ga0496121_0583672_16_309 | 97 |
| 230 | 3300048925 | Ga0496122_0098919 | Ga0496122_0098919_1358_1651 | 97 |
| 231 | 3300048925 | Ga0496122_0161764 | Ga0496122_0161764_590_883 | 97 |
| 232 | 3300048925 | Ga0496122_0206407 | Ga0496122_0206407_714_1007 | 97 |
| 233 | 3300048926 | Ga0496123_0069545 | Ga0496123_0069545_913_1206 | 97 |
| 234 | 3300048926 | Ga0496123_0164990 | Ga0496123_0164990_622_915 | 97 |
| 235 | 3300048927 | Ga0496124_0126810 | Ga0496124_0126810_1573_1866 | 97 |
| 236 | 3300048928 | Ga0496125_0000207 | Ga0496125_0000207_65924_66217 | 97 |
| 237 | 3300048928 | Ga0496125_0000571 | Ga0496125_0000571_2127_2420 | 97 |
| 238 | 3300048928 | Ga0496125_0007178 | Ga0496125_0007178_7731_8024 | 97 |
| 239 | 3300048928 | Ga0496125_0022793 | Ga0496125_0022793_1546_1839 | 97 |
| 240 | 3300048928 | Ga0496125_0350302 | Ga0496125_0350302_19_312 | 97 |
| 241 | 3300048928 | Ga0496125_0630914 | Ga0496125_0630914_36_329 | 97 |
| 242 | 3300048929 | Ga0496126_0125069 | Ga0496126_0125069_135_428 | 97 |
| 243 | 3300048929 | Ga0496126_0268575 | Ga0496126_0268575_592_885 | 97 |
| 244 | 3300048929 | Ga0496126_0352953 | Ga0496126_0352953_47_340 | 97 |
| 245 | 3300049568 | Ga0501031_0416534 | Ga0501031_0416534_233_532 | 97 |
| 246 | 3300049569 | Ga0501032_0004059 | Ga0501032_0004059_106_405 | 97 |
| 247 | 3300049569 | Ga0501032_0018101 | Ga0501032_0018101_905_1204 | 97 |
| 248 | 3300049569 | Ga0501032_0891708 | Ga0501032_0891708_224_523 | 97 |
| 249 | 3300049569 | Ga0501032_0966806 | Ga0501032_0966806_165_464 | 97 |
| 250 | 3300049570 | Ga0501033_0011266 | Ga0501033_0011266_2184_2483 | 97 |
| 251 | 3300049570 | Ga0501033_0311184 | Ga0501033_0311184_207_506 | 97 |
| 252 | 3300049570 | Ga0501033_0381502 | Ga0501033_0381502_55_354 | 97 |
| 253 | 3300049571 | Ga0501034_0122952 | Ga0501034_0122952_1000_1299 | 97 |
| 254 | 3300049571 | Ga0501034_0164760 | Ga0501034_0164760_830_1129 | 97 |
| 255 | 3300049571 | Ga0501034_0280419 | Ga0501034_0280419_520_819 | 97 |
| 256 | 3300049572 | Ga0501036_0000909 | Ga0501036_0000909_4885_5184 | 97 |
| 257 | 3300049572 | Ga0501036_0341703 | Ga0501036_0341703_234_533 | 97 |
| 258 | 3300049572 | Ga0501036_0692517 | Ga0501036_0692517_438_737 | 97 |
| 259 | 3300049572 | Ga0501036_1673782 | Ga0501036_1673782_156_458 | 97 |
| 260 | 3300049573 | Ga0501037_0112037 | Ga0501037_0112037_798_1097 | 97 |
| 261 | 3300049574 | Ga0501038_0024740 | Ga0501038_0024740_2424_2723 | 97 |
| 262 | 3300049574 | Ga0501038_0128789 | Ga0501038_0128789_831_1130 | 97 |
| 263 | 3300049574 | Ga0501038_0227730 | Ga0501038_0227730_1089_1427 | 97 |
| 264 | 3300049575 | Ga0501039_0134215 | Ga0501039_0134215_1009_1308 | 97 |
| 265 | 3300049579 | Ga0501043_0028017 | Ga0501043_0028017_942_1241 | 97 |
| 266 | 3300049579 | Ga0501043_0045951 | Ga0501043_0045951_1140_1439 | 97 |
| 267 | 3300049579 | Ga0501043_0296086 | Ga0501043_0296086_388_687 | 97 |
| 268 | 3300049580 | Ga0501046_0197329 | Ga0501046_0197329_930_1229 | 97 |
| 269 | 3300049581 | Ga0501047_0011912 | Ga0501047_0011912_3375_3674 | 97 |
| 270 | 3300049581 | Ga0501047_0312105 | Ga0501047_0312105_791_1090 | 97 |
| 271 | 3300049586 | Ga0501070_0142713 | Ga0501070_0142713_723_1022 | 97 |
| 272 | 3300049586 | Ga0501070_0191470 | Ga0501070_0191470_884_1183 | 97 |
| 273 | 3300049586 | Ga0501070_0366652 | Ga0501070_0366652_403_702 | 97 |
| 274 | 3300049742 | Ga0501080_1060190 | Ga0501080_1060190_341_640 | 97 |
| 275 | 3300049822 | Ga0501035_0015337 | Ga0501035_0015337_5839_6138 | 97 |
| 276 | 3300049822 | Ga0501035_0065779 | Ga0501035_0065779_2284_2583 | 97 |
| 277 | 3300049822 | Ga0501035_0205040 | Ga0501035_0205040_862_1161 | 97 |
| 278 | 3300049822 | Ga0501035_1219418 | Ga0501035_1219418_131_430 | 97 |
| 279 | 3300049823 | Ga0501044_0002628 | Ga0501044_0002628_15450_15749 | 97 |
| 280 | 3300049823 | Ga0501044_0032582 | Ga0501044_0032582_1308_1607 | 97 |
| 281 | 3300049823 | Ga0501044_0036135 | Ga0501044_0036135_1936_2235 | 97 |
| 282 | 3300049823 | Ga0501044_0792434 | Ga0501044_0792434_407_727 | 97 |
| 283 | 3300049823 | Ga0501044_1293589 | Ga0501044_1293589_214_513 | 97 |
| 284 | 3300050491 | nmdc:mga00v17_260567_c1 | nmdc:mga00v17_260567_c1_454_747 | 97 |
| 285 | 3300050491 | nmdc:mga00v17_459925_c1 | nmdc:mga00v17_459925_c1_105_401 | 97 |
| 286 | 3300050492 | nmdc:mga0yw44_9960_c1 | nmdc:mga0yw44_9960_c1_2424_2717 | 97 |
| 287 | 3300050493 | nmdc:mga0k408_402313_c1 | nmdc:mga0k408_402313_c1_397_693 | 97 |
| 288 | 3300050516 | nmdc:mga0sz30_4207_c1 | nmdc:mga0sz30_4207_c1_189_482 | 97 |
| 289 | 3300053080 | Ga0500635_0045726 | Ga0500635_0045726_101_400 | 97 |
| 290 | 3300053087 | Ga0500643_009045 | Ga0500643_009045_2816_3109 | 97 |
| 291 | 3300053087 | Ga0500643_011509 | Ga0500643_011509_1640_1933 | 97 |
| 292 | 3300053088 | Ga0500644_0316204 | Ga0500644_0316204_367_660 | 97 |
| 293 | 3300053089 | Ga0500581_105112 | Ga0500581_105112_854_1147 | 97 |
| 294 | 3300053093 | Ga0500651_0002618 | Ga0500651_0002618_1609_1902 | 97 |
| 295 | 3300053093 | Ga0500651_0167068 | Ga0500651_0167068_153_485 | 97 |
| 296 | 3300053094 | Ga0500566_0000135 | Ga0500566_0000135_17606_17938 | 97 |
| 297 | 3300053096 | Ga0500641_0002754 | Ga0500641_0002754_4404_4697 | 97 |
| 298 | 3300053098 | Ga0500650_0001341 | Ga0500650_0001341_3556_3849 | 97 |
| 299 | 3300053104 | Ga0500556_0000030 | Ga0500556_0000030_67746_68039 | 97 |
| 300 | 3300053108 | Ga0500562_048828 | Ga0500562_048828_302_595 | 97 |
| 301 | 3300053109 | Ga0500569_053246 | Ga0500569_053246_699_992 | 97 |
| 302 | 3300053118 | Ga0500594_0085153 | Ga0500594_0085153_426_719 | 97 |
| 303 | 3300053122 | Ga0500608_008208 | Ga0500608_008208_2857_3150 | 97 |
| 304 | 3300053126 | Ga0500621_285324 | Ga0500621_285324_180_473 | 97 |
| 305 | 3300053130 | Ga0500642_0000028 | Ga0500642_0000028_76963_77256 | 97 |
| 306 | 3300053131 | Ga0500652_002054 | Ga0500652_002054_627_920 | 97 |
| 307 | 3300053136 | Ga0500559_0000204 | Ga0500559_0000204_42661_42993 | 97 |
| 308 | 3300053139 | Ga0500568_0007288 | Ga0500568_0007288_3148_3441 | 97 |
| 309 | 3300053142 | Ga0500577_0416654 | Ga0500577_0416654_245_538 | 97 |
| 310 | 3300053148 | Ga0500590_071217 | Ga0500590_071217_545_877 | 97 |
| 311 | 3300053151 | Ga0500604_0089944 | Ga0500604_0089944_126_419 | 97 |
| 312 | 3300053151 | Ga0500604_0263526 | Ga0500604_0263526_267_566 | 97 |
| 313 | 3300053153 | Ga0500616_0000252 | Ga0500616_0000252_61811_62104 | 97 |
| 314 | 3300053154 | Ga0500619_053283 | Ga0500619_053283_179_472 | 97 |
| 315 | 3300053156 | Ga0500622_0000810 | Ga0500622_0000810_3041_3334 | 97 |
| 316 | 3300053157 | Ga0500624_042354 | Ga0500624_042354_361_693 | 97 |
| 317 | 3300053158 | Ga0500627_0061812 | Ga0500627_0061812_385_678 | 97 |
| 318 | 3300053158 | Ga0500627_0402876 | Ga0500627_0402876_246_539 | 97 |
| 319 | 3300053160 | Ga0500633_0317441 | Ga0500633_0317441_137_430 | 97 |
| 320 | 3300053161 | Ga0500634_0076582 | Ga0500634_0076582_423_716 | 97 |
| 321 | 3300053162 | Ga0500638_154051 | Ga0500638_154051_77_409 | 97 |
| 322 | 3300053162 | Ga0500638_255758 | Ga0500638_255758_307_600 | 97 |
| 323 | 3300053163 | Ga0500639_193749 | Ga0500639_193749_291_590 | 97 |
| 324 | 3300053177 | Ga0500636_0000525 | Ga0500636_0000525_20010_20342 | 97 |
| 325 | 3300053178 | Ga0500637_0004569 | Ga0500637_0004569_385_684 | 97 |
| 326 | 3300053178 | Ga0500637_0060110 | Ga0500637_0060110_784_1116 | 97 |
| 327 | 3300053730 | Ga0500645_016071 | Ga0500645_016071_1826_2119 | 97 |
| 328 | 3300053730 | Ga0500645_091676 | Ga0500645_091676_168_461 | 97 |
| 329 | 3300060353 | Ga0501082_0924750 | Ga0501082_0924750_205_504 | 97 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar