F409252

General Info

Members Datasets Scaffolds Average Seq Length
328 220 656 236

Family's Representative Sequence

Representative Sequence 3300014326|Ga0157380_10014376|Ga0157380_100143765
Length 280
Sequence MPEVLPCSSAGATFENVKPGGGRRQRPYDAANHWGGVCMNNRVNSLGQPVGYQVPHWKAVNPPPKALIDGRYCRIEPIDIDRHAADLFEAISDDADGRTWTYMAYGPFGTLPEYRAWMKTTCLGDDPLFHAVIDSSTDKAVGVASYLRIDPKFGVIETGHIHYSPRLQRTRAATEAMYLMMRRVFEELGYRRYEWKCDALNEPSRKAAARLGFSFEGVFRQATIYKGRNRDTAWFAIIDHEWPALKAAYETWLDPGNFDAHGKQQQSLGALTAAALGVKP

Samples

Sample ID Description Type Environment
1 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
2 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
5 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
6 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
7 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
8 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
9 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
10 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
43 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
44 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
70 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
71 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
72 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
73 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
75 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
76 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
80 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
81 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
121 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
124 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
125 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
126 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
127 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
130 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
134 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
135 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
136 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
137 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
138 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
139 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
140 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
141 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
142 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
143 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
144 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
145 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
146 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
147 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
148 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
149 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
150 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
151 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
152 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
153 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
154 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
155 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
156 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
157 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
158 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
159 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
160 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
161 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
162 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
163 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
164 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
165 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
166 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
167 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
168 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
169 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
170 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
185 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
186 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
187 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
188 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
189 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
190 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
191 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
192 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
193 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
194 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
195 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
196 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
197 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
199 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
200 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
201 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
202 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
203 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
204 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
205 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
206 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
207 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
208 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
209 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
210 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
211 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
212 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
213 2643221561 Nocardioides sp. Root151 Isolate Unclassified
214 2643221609 Acidovorax sp. Root217 Isolate Unclassified
215 2643221611 Acidovorax sp. Root219 Isolate Unclassified
216 2643221696 Nocardioides sp. Root140 Isolate Unclassified
217 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
218 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
219 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
220 2941479691

Type Distribution

Type Percentage (%)
Metagenomes 97.26
Metatranscriptomes 0.3
Isolates 2.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.76
Nodule 0
Rhizoplane 3.05
Rhizosphere 79.57
Stem 0
Stem Tuber 0
Unclassified 2.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157380_10014376 3300014326 Bacteria 5790
2 JGI25159J45721_1000992 3300002987 Bacteria 12273
3 rootH1_10094136 3300003323 Bacteria 3862
4 Ga0055526_1002394 3300003771 Bacteria 12702
5 Ga0055526_1003145 3300003771 Bacteria 10695
6 Ga0055537_1000709 3300003773 Bacteria 17283
7 Ga0055524_1000082 3300003775 Bacteria 119749
8 Ga0055528_1002493 3300003790 Bacteria 9828
9 Ga0055530_10000688 3300003791 Bacteria 28617
10 Ga0055540_1000010 3300003792 Bacteria 290865
11 Ga0065165_1009717 3300005262 Bacteria 4263
12 Ga0065707_10249851 3300005295 Bacteria 1129
13 Ga0070658_10012971 3300005327 Bacteria 6688
14 Ga0068869_100209141 3300005334 Bacteria 1542
15 Ga0070680_100057337 3300005336 Bacteria 3184
16 Ga0070682_100147094 3300005337 Bacteria 1613
17 Ga0068868_100119716 3300005338 Bacteria 2147
18 Ga0070660_100125209 3300005339 Bacteria 2053
19 Ga0070692_10392308 3300005345 Bacteria 874
20 Ga0070668_100165819 3300005347 Bacteria 1795
21 Ga0070669_100071957 3300005353 Bacteria 2559
22 Ga0070669_100165860 3300005353 Bacteria 1719
23 Ga0070675_100001263 3300005354 Bacteria 18495
24 Ga0070659_100014521 3300005366 Bacteria 5886
25 Ga0070659_100074191 3300005366 Bacteria 2710
26 Ga0070714_100570503 3300005435 Bacteria 1085
27 Ga0070713_100327343 3300005436 Bacteria 1416
28 Ga0070700_100239281 3300005441 Bacteria 1296
29 Ga0070708_100004995 3300005445 Bacteria 10487
30 Ga0070663_100694677 3300005455 Bacteria 864
31 Ga0070662_100102429 3300005457 Bacteria 2169
32 Ga0070681_10071685 3300005458 Bacteria 3429
33 Ga0068867_100214851 3300005459 Bacteria 1547
34 Ga0070706_100022875 3300005467 Bacteria 5756
35 Ga0070698_100154388 3300005471 Bacteria 2241
36 Ga0070699_100054690 3300005518 Unclassified 3455
37 Ga0070699_100073174 3300005518 Bacteria 2981
38 Ga0070699_100167911 3300005518 Bacteria 1944
39 Ga0070679_100006034 3300005530 Bacteria 11271
40 Ga0070679_100613277 3300005530 Bacteria 1031
41 Ga0070697_100024824 3300005536 Plasmid 4773
42 Ga0070697_100304212 3300005536 Bacteria 1371
43 Ga0068853_100103098 3300005539 Bacteria 2525
44 Ga0070686_100150837 3300005544 Bacteria 1628
45 Ga0068855_100050656 3300005563 Bacteria 4892
46 Ga0070664_100025800 3300005564 Bacteria 4872
47 Ga0070664_100289672 3300005564 Bacteria 1478
48 Ga0070702_100336218 3300005615 Bacteria 1058
49 Ga0068860_100219972 3300005843 Bacteria 1844
50 Ga0068860_100709362 3300005843 Bacteria 1016
51 Ga0081538_10009622 3300005981 Bacteria 8038
52 Ga0070717_10430990 3300006028 Unclassified 1187
53 Ga0075365_10021629 3300006038 Bacteria 4015
54 Ga0068871_100053469 3300006358 Bacteria 3273
55 Ga0075434_100296827 3300006871 Bacteria 1636
56 Ga0075434_100536008 3300006871 Unclassified 1190
57 Ga0075434_100614480 3300006871 Unclassified 1106
58 Ga0068865_100013142 3300006881 Bacteria 5224
59 Ga0068865_100235429 3300006881 Bacteria 1438
60 Ga0099795_10002085 3300007788 Bacteria 4595
61 Ga0105240_10001785 3300009093 Bacteria 36285
62 Ga0105240_10045087 3300009093 Bacteria 5596
63 Ga0111539_10000283 3300009094 Bacteria 61000
64 Ga0111539_10093667 3300009094 Bacteria 3528
65 Ga0105245_10212616 3300009098 Bacteria 1862
66 Ga0105245_11213895 3300009098 Bacteria 802
67 Ga0114129_10135191 3300009147 Bacteria 3383
68 Ga0114129_10271393 3300009147 Bacteria 2269
69 Ga0114129_10832780 3300009147 Bacteria 1174
70 Ga0114129_10928806 3300009147 Bacteria 1101
71 Ga0105243_10588985 3300009148 Bacteria 1069
72 Ga0105242_10046608 3300009176 Bacteria 3517
73 Ga0105242_10252081 3300009176 Bacteria 1591
74 Ga0105242_10258662 3300009176 Bacteria 1572
75 Ga0105248_10077764 3300009177 Bacteria 3730
76 Ga0105248_10752118 3300009177 Unclassified 1100
77 Ga0105237_10006601 3300009545 Bacteria 12827
78 Ga0105237_10031531 3300009545 Bacteria 5372
79 Ga0105237_10082185 3300009545 Bacteria 3212
80 Ga0105238_10000063 3300009551 Bacteria 123809
81 Ga0105238_10917651 3300009551 Bacteria 895
82 Ga0105249_10148914 3300009553 Bacteria 2251
83 Ga0099796_10034654 3300010159 Bacteria 1669
84 Ga0105239_10001427 3300010375 Bacteria 31882
85 Ga0105239_10868717 3300010375 Bacteria 1035
86 Ga0157370_10005401 3300013104 Bacteria 14334
87 Ga0163162_10211460 3300013306 Bacteria 2069
88 Ga0163162_10280385 3300013306 Bacteria 1799
89 Ga0163162_10333998 3300013306 Bacteria 1648
90 Ga0157375_11212659 3300013308 Bacteria 885
91 Ga0163163_10433009 3300014325 Bacteria 1374
92 Ga0163163_10522512 3300014325 Bacteria 1249
93 Ga0182008_10020524 3300014497 Bacteria 3401
94 Ga0157379_10189852 3300014968 Bacteria 1857
95 Ga0157379_10355505 3300014968 Bacteria 1342
96 Ga0157376_10011883 3300014969 Bacteria 6437
97 Ga0206356_10034130 3300020070 Bacteria 1558
98 Ga0213872_10007389 3300021361 Bacteria 5410
99 Ga0213872_10080336 3300021361 Bacteria 1465
100 Ga0213872_10112492 3300021361 Bacteria 1208
101 Ga0213872_10130347 3300021361 Bacteria 1108
102 Ga0213876_10096569 3300021384 Bacteria 1565
103 Ga0209129_1035653 3300025258 Bacteria 808
104 Ga0209565_1000036 3300025263 Bacteria 293334
105 Ga0209673_1000282 3300025273 Bacteria 95013
106 Ga0209130_1000151 3300025284 Bacteria 107021
107 Ga0209675_1000751 3300025291 Bacteria 21867
108 Ga0209675_1012585 3300025291 Bacteria 2713
109 Ga0209676_1000007 3300025292 Bacteria 1029371
110 Ga0209676_1018497 3300025292 Bacteria 2429
111 Ga0209564_1000729 3300025295 Bacteria 46947
112 Ga0209564_1000903 3300025295 Bacteria 38881
113 Ga0209050_1000003 3300025298 Bacteria 1609245
114 Ga0209050_1002339 3300025298 Bacteria 16628
115 Ga0209256_1000001 3300025299 Bacteria 2166974
116 Ga0207426_1001878 3300025302 Bacteria 15369
117 Ga0209051_1000003 3300025303 Bacteria 1609245
118 Ga0209051_1014181 3300025303 Bacteria 3733
119 Ga0209257_1000020 3300025304 Bacteria 773356
120 Ga0207642_10167380 3300025899 Bacteria 1186
121 Ga0207705_10015851 3300025909 Bacteria 5413
122 Ga0207684_10022785 3300025910 Bacteria 5347
123 Ga0207707_10005765 3300025912 Bacteria 10828
124 Ga0207695_10003498 3300025913 Bacteria 22039
125 Ga0207671_10003791 3300025914 Bacteria 14837
126 Ga0207671_10103551 3300025914 Bacteria 2159
127 Ga0207671_10316013 3300025914 Bacteria 1235
128 Ga0207693_10022829 3300025915 Bacteria 4967
129 Ga0207660_10017940 3300025917 Bacteria 4712
130 Ga0207660_10474223 3300025917 Bacteria 1014
131 Ga0207657_10127683 3300025919 Bacteria 2087
132 Ga0207657_10158672 3300025919 Bacteria 1838
133 Ga0207681_10123525 3300025923 Bacteria 1902
134 Ga0207681_10179860 3300025923 Bacteria 1610
135 Ga0207694_10001975 3300025924 Bacteria 16971
136 Ga0207694_10014513 3300025924 Bacteria 5939
137 Ga0207659_10018237 3300025926 Bacteria 4599
138 Ga0207700_10030078 3300025928 Bacteria 3841
139 Ga0207664_10330682 3300025929 Bacteria 1346
140 Ga0207690_10063823 3300025932 Bacteria 2513
141 Ga0207690_10071933 3300025932 Bacteria 2387
142 Ga0207706_10051606 3300025933 Bacteria 3631
143 Ga0207706_10299849 3300025933 Bacteria 1400
144 Ga0207686_10036544 3300025934 Bacteria 2958
145 Ga0207669_10020721 3300025937 Bacteria 3454
146 Ga0207704_10013150 3300025938 Bacteria 4134
147 Ga0207704_10253011 3300025938 Bacteria 1323
148 Ga0207711_10051732 3300025941 Bacteria 3519
149 Ga0207711_10446527 3300025941 Bacteria 1204
150 Ga0207679_10005100 3300025945 Bacteria 8213
151 Ga0207667_10000216 3300025949 Bacteria 80609
152 Ga0207712_10015436 3300025961 Bacteria 4929
153 Ga0207668_10679950 3300025972 Bacteria 903
154 Ga0207703_10791267 3300026035 Bacteria 905
155 Ga0207678_10048772 3300026067 Bacteria 3660
156 Ga0207708_10282116 3300026075 Bacteria 1346
157 Ga0207641_10082927 3300026088 Bacteria 2787
158 Ga0207648_10315641 3300026089 Bacteria 1404
159 Ga0207674_10382728 3300026116 Bacteria 1360
160 Ga0207675_100025209 3300026118 Bacteria 5535
161 Ga0209371_1041349 3300027312 Bacteria 933
162 Ga0209981_1001434 3300027378 Bacteria 3012
163 Ga0210000_1013248 3300027462 Bacteria 1230
164 Ga0209995_1012297 3300027471 Bacteria 1396
165 Ga0209970_1033662 3300027614 Bacteria 897
166 Ga0209974_10003268 3300027876 Bacteria 5860
167 Ga0207428_10001439 3300027907 Bacteria 25009
168 Ga0268265_10607785 3300028380 Bacteria 1046
169 Ga0268265_10971741 3300028380 Bacteria 838
170 Ga0268264_10458619 3300028381 Bacteria 1236
171 Ga0268264_10555517 3300028381 Bacteria 1126
172 Ga0268256_1046919 3300030500 Bacteria 933
173 Ga0265328_10069358 3300031239 Bacteria 1295
174 Ga0265329_10005116 3300031242 Bacteria 5346
175 Ga0307408_100150713 3300031548 Bacteria 1835
176 Ga0265314_10000389 3300031711 Bacteria 59681
177 Ga0307410_10100051 3300031852 Bacteria 2076
178 Ga0307410_10274103 3300031852 Bacteria 1321
179 Ga0307410_10367587 3300031852 Bacteria 1154
180 Ga0307407_10091970 3300031903 Bacteria 1862
181 Ga0307412_10002597 3300031911 Bacteria 10032
182 Ga0307409_100379023 3300031995 Bacteria 1344
183 Ga0307409_100466933 3300031995 Bacteria 1221
184 Ga0307416_100162771 3300032002 Bacteria 2065
185 Ga0307416_100598867 3300032002 Bacteria 1182
186 Ga0307411_10008584 3300032005 Bacteria 5305
187 Ga0307411_10063185 3300032005 Bacteria 2473
188 Ga0373952_0008838 3300035092 Bacteria 1917
189 Ga0373939_0005098 3300035114 Bacteria 3122
190 Ga0373941_0015469 3300035115 Bacteria 2058
191 Ga0373960_0021601 3300035121 Bacteria 1714
192 Ga0373946_0008881 3300035171 Bacteria 3692
193 Ga0316574_0190759 3300035398 Bacteria 1318
194 Ga0373931_0000611 3300035691 Bacteria 14798
195 Ga0373927_0131321 3300035695 Bacteria 1636
196 Ga0373947_0274641 3300035725 Bacteria 1119
197 Ga0400483_012271 3300039062 Bacteria 15360
198 Ga0400483_064861 3300039062 Bacteria 2367
199 Ga0400483_244292 3300039062 Bacteria 3480
200 Ga0400483_246197 3300039062 Bacteria 8889
201 Ga0400483_254494 3300039062 Bacteria 1109
202 Ga0436365_1149121 3300039437 Bacteria 3369
203 Ga0436365_1928739 3300039437 Bacteria 7039
204 Ga0436361_0047187 3300039447 Bacteria 15576
205 Ga0436361_1029863 3300039447 Bacteria 1351
206 Ga0436361_1165271 3300039447 Bacteria 12230
207 Ga0436363_0544542 3300039450 Bacteria 2616
208 Ga0436362_0927393 3300039453 Bacteria 3974
209 Ga0436362_1160388 3300039453 Bacteria 2432
210 Ga0439442_015479 3300042002 Bacteria 1572
211 Ga0439445_0080593 3300042004 Bacteria 909
212 Ga0439457_041225 3300042014 Bacteria 1029
213 Ga0439446_0010452 3300042156 Bacteria 2499
214 Ga0439446_0130170 3300042156 Bacteria 815
215 Ga0439464_0011583 3300042439 Bacteria 2338
216 Ga0451577_0078301 3300042876 Bacteria 2947
217 Ga0453684_0053144 3300044712 Bacteria 5290
218 Ga0453684_0095254 3300044712 Bacteria 3660
219 Ga0466958_0000025 3300045836 Bacteria 42350
220 Ga0495580_0045149 3300046472 Bacteria 3131
221 Ga0496102_0082085 3300048905 Bacteria 2973
222 Ga0496104_0183753 3300048907 Bacteria 2001
223 Ga0496105_0111553 3300048908 Bacteria 2257
224 Ga0496106_0510204 3300048909 Unclassified 966
225 Ga0496108_0000469 3300048911 Bacteria 32315
226 Ga0496110_0126076 3300048913 Bacteria 2310
227 Ga0496110_0321725 3300048913 Bacteria 1409
228 Ga0496110_0402490 3300048913 Bacteria 1248
229 Ga0496112_0057075 3300048915 Bacteria 3843
230 Ga0496112_0520686 3300048915 Bacteria 1124
231 Ga0496116_0016981 3300048919 Bacteria 5672
232 Ga0496121_0017993 3300048924 Bacteria 7161
233 Ga0496122_0000165 3300048925 Bacteria 157612
234 Ga0496123_0001042 3300048926 Bacteria 41981
235 Ga0496124_0118379 3300048927 Bacteria 2120
236 Ga0496124_0284272 3300048927 Bacteria 1204
237 Ga0496125_0092920 3300048928 Bacteria 2253
238 Ga0496125_0227197 3300048928 Bacteria 1197
239 Ga0501032_0065424 3300049569 Bacteria 2431
240 Ga0501032_0179700 3300049569 Bacteria 1385
241 Ga0501033_0047747 3300049570 Bacteria 3183
242 Ga0501033_0138637 3300049570 Bacteria 1759
243 Ga0501033_0392560 3300049570 Bacteria 968
244 Ga0501034_0064932 3300049571 Bacteria 3663
245 Ga0501036_0017723 3300049572 Bacteria 5961
246 Ga0501036_0090079 3300049572 Bacteria 2591
247 Ga0501037_0043422 3300049573 Bacteria 3303
248 Ga0501037_0126890 3300049573 Bacteria 1831
249 Ga0501038_0028442 3300049574 Bacteria 4967
250 Ga0501038_0074896 3300049574 Bacteria 2862
251 Ga0501038_0471239 3300049574 Bacteria 963
252 Ga0501039_0039095 3300049575 Bacteria 3664
253 Ga0501040_0233028 3300049576 Bacteria 1311
254 Ga0501041_0012067 3300049577 Bacteria 5115
255 Ga0501041_0454859 3300049577 Bacteria 813
256 Ga0501042_0014840 3300049578 Bacteria 5322
257 Ga0501043_0017139 3300049579 Bacteria 5681
258 Ga0501043_0309612 3300049579 Bacteria 1205
259 Ga0501046_0044312 3300049580 Bacteria 3538
260 Ga0501046_0439150 3300049580 Bacteria 939
261 Ga0501047_0270753 3300049581 Bacteria 1544
262 Ga0501047_0617837 3300049581 Bacteria 904
263 Ga0501048_0007203 3300049582 Bacteria 8448
264 Ga0501048_0497005 3300049582 Bacteria 874
265 Ga0501067_0001307 3300049583 Bacteria 13493
266 Ga0501067_0013714 3300049583 Bacteria 4488
267 Ga0501068_0010722 3300049584 Bacteria 5152
268 Ga0501069_0028839 3300049585 Bacteria 3044
269 Ga0501070_0043475 3300049586 Bacteria 3737
270 Ga0501070_0630541 3300049586 Bacteria 852
271 Ga0501073_0004294 3300049589 Bacteria 10690
272 Ga0501074_0197461 3300049590 Bacteria 1434
273 Ga0501075_0016098 3300049591 Bacteria 5380
274 Ga0501076_0005240 3300049592 Bacteria 9295
275 Ga0501076_0069169 3300049592 Bacteria 2821
276 Ga0501077_0066283 3300049593 Bacteria 2290
277 Ga0501077_0150805 3300049593 Bacteria 1475
278 Ga0501077_0551747 3300049593 Bacteria 739
279 Ga0501079_0166944 3300049741 Bacteria 1716
280 Ga0501079_0476694 3300049741 Bacteria 980
281 Ga0501080_0009051 3300049742 Bacteria 9061
282 Ga0501080_0010430 3300049742 Bacteria 8505
283 Ga0501080_0055716 3300049742 Bacteria 3682
284 Ga0501081_0003386 3300049743 Bacteria 10149
285 Ga0501081_0166968 3300049743 Bacteria 1588
286 Ga0501083_0032672 3300049744 Bacteria 3567
287 Ga0501083_0084875 3300049744 Bacteria 2095
288 Ga0501035_0052685 3300049822 Bacteria 3640
289 Ga0501035_0117142 3300049822 Bacteria 2331
290 Ga0501035_0434227 3300049822 Bacteria 1088
291 Ga0501044_0110559 3300049823 Bacteria 2756
292 Ga0501044_0417837 3300049823 Bacteria 1251
293 nmdc:mga0yw44_264512_c1 3300050492 Bacteria 1147
294 nmdc:mga05p37_26638_c1 3300050507 Bacteria 7030
295 nmdc:mga0qj67_435160_c1 3300050509 Bacteria 1057
296 nmdc:mga08y16_16_c1 3300050511 Bacteria 386948
297 nmdc:mga08y16_659512_c1 3300050511 Bacteria 1050
298 nmdc:mga0n895_10604_c1 3300050512 Bacteria 8156
299 nmdc:mga0n895_385836_c1 3300050512 Unclassified 1417
300 nmdc:mga0n895_908_c1 3300050512 Bacteria 21366
301 nmdc:mga0rr50_3_c1 3300050513 Bacteria 353622
302 nmdc:mga0rr50_428960_c1 3300050513 Bacteria 1119
303 nmdc:mga08x19_176_c1 3300050514 Bacteria 51743
304 nmdc:mga08x19_28484_c1 3300050514 Bacteria 3498
305 nmdc:mga08x19_331870_c1 3300050514 Bacteria 1060
306 Ga0500556_0095459 3300053104 Bacteria 1140
307 Ga0500658_0055893 3300053134 Bacteria 1626
308 Ga0500573_0007226 3300053140 Bacteria 6052
309 Ga0500633_0120729 3300053160 Bacteria 975
310 Ga0501084_0027038 3300054114 Bacteria 4793
311 Ga0501084_0036395 3300054114 Bacteria 4111
312 Ga0501084_0109683 3300054114 Bacteria 2319
313 Ga0501084_0223555 3300054114 Bacteria 1589
314 Ga0501084_0529715 3300054114 Bacteria 996
315 Ga0590075_002461 3300059424 Bacteria 4428
316 Ga0501082_0016560 3300060353 Bacteria 6346
317 Ga0501082_0068529 3300060353 Bacteria 3054
318 Ga0501082_0096706 3300060353 Bacteria 2552
319 Ga0501082_0234758 3300060353 Bacteria 1596
320 Ga0501082_0445027 3300060353 Bacteria 1132
321 2643828174 2643221561 Bacteria 4984412
322 2644057351 2643221609 Bacteria 6756331
323 2644072554 2643221611 Bacteria 6820941
324 2644531263 2643221696 Bacteria 5431823
325 2809031303 2808606395 Bacteria 6020352
326 2857539381 2857537821 Bacteria 5248181
327 2887446975 2887443736 Bacteria 4426037
328 2941480784
329 Ga0157380_10014376
330 JGI25159J45721_1000992
331 rootH1_10094136
332 Ga0055526_1002394
333 Ga0055526_1003145
334 Ga0055537_1000709
335 Ga0055524_1000082
336 Ga0055528_1002493
337 Ga0055530_10000688
338 Ga0055540_1000010
339 Ga0065165_1009717
340 Ga0065707_10249851
341 Ga0070658_10012971
342 Ga0068869_100209141
343 Ga0070680_100057337
344 Ga0070682_100147094
345 Ga0068868_100119716
346 Ga0070660_100125209
347 Ga0070692_10392308
348 Ga0070668_100165819
349 Ga0070669_100071957
350 Ga0070669_100165860
351 Ga0070675_100001263
352 Ga0070659_100014521
353 Ga0070659_100074191
354 Ga0070714_100570503
355 Ga0070713_100327343
356 Ga0070700_100239281
357 Ga0070708_100004995
358 Ga0070663_100694677
359 Ga0070662_100102429
360 Ga0070681_10071685
361 Ga0068867_100214851
362 Ga0070706_100022875
363 Ga0070698_100154388
364 Ga0070699_100054690
365 Ga0070699_100073174
366 Ga0070699_100167911
367 Ga0070679_100006034
368 Ga0070679_100613277
369 Ga0070697_100024824
370 Ga0070697_100304212
371 Ga0068853_100103098
372 Ga0070686_100150837
373 Ga0068855_100050656
374 Ga0070664_100025800
375 Ga0070664_100289672
376 Ga0070702_100336218
377 Ga0068860_100219972
378 Ga0068860_100709362
379 Ga0081538_10009622
380 Ga0070717_10430990
381 Ga0075365_10021629
382 Ga0068871_100053469
383 Ga0075434_100296827
384 Ga0075434_100536008
385 Ga0075434_100614480
386 Ga0068865_100013142
387 Ga0068865_100235429
388 Ga0099795_10002085
389 Ga0105240_10001785
390 Ga0105240_10045087
391 Ga0111539_10000283
392 Ga0111539_10093667
393 Ga0105245_10212616
394 Ga0105245_11213895
395 Ga0114129_10135191
396 Ga0114129_10271393
397 Ga0114129_10832780
398 Ga0114129_10928806
399 Ga0105243_10588985
400 Ga0105242_10046608
401 Ga0105242_10252081
402 Ga0105242_10258662
403 Ga0105248_10077764
404 Ga0105248_10752118
405 Ga0105237_10006601
406 Ga0105237_10031531
407 Ga0105237_10082185
408 Ga0105238_10000063
409 Ga0105238_10917651
410 Ga0105249_10148914
411 Ga0099796_10034654
412 Ga0105239_10001427
413 Ga0105239_10868717
414 Ga0157370_10005401
415 Ga0163162_10211460
416 Ga0163162_10280385
417 Ga0163162_10333998
418 Ga0157375_11212659
419 Ga0163163_10433009
420 Ga0163163_10522512
421 Ga0182008_10020524
422 Ga0157379_10189852
423 Ga0157379_10355505
424 Ga0157376_10011883
425 Ga0206356_10034130
426 Ga0213872_10007389
427 Ga0213872_10080336
428 Ga0213872_10112492
429 Ga0213872_10130347
430 Ga0213876_10096569
431 Ga0209129_1035653
432 Ga0209565_1000036
433 Ga0209673_1000282
434 Ga0209130_1000151
435 Ga0209675_1000751
436 Ga0209675_1012585
437 Ga0209676_1000007
438 Ga0209676_1018497
439 Ga0209564_1000729
440 Ga0209564_1000903
441 Ga0209050_1000003
442 Ga0209050_1002339
443 Ga0209256_1000001
444 Ga0207426_1001878
445 Ga0209051_1000003
446 Ga0209051_1014181
447 Ga0209257_1000020
448 Ga0207642_10167380
449 Ga0207705_10015851
450 Ga0207684_10022785
451 Ga0207707_10005765
452 Ga0207695_10003498
453 Ga0207671_10003791
454 Ga0207671_10103551
455 Ga0207671_10316013
456 Ga0207693_10022829
457 Ga0207660_10017940
458 Ga0207660_10474223
459 Ga0207657_10127683
460 Ga0207657_10158672
461 Ga0207681_10123525
462 Ga0207681_10179860
463 Ga0207694_10001975
464 Ga0207694_10014513
465 Ga0207659_10018237
466 Ga0207700_10030078
467 Ga0207664_10330682
468 Ga0207690_10063823
469 Ga0207690_10071933
470 Ga0207706_10051606
471 Ga0207706_10299849
472 Ga0207686_10036544
473 Ga0207669_10020721
474 Ga0207704_10013150
475 Ga0207704_10253011
476 Ga0207711_10051732
477 Ga0207711_10446527
478 Ga0207679_10005100
479 Ga0207667_10000216
480 Ga0207712_10015436
481 Ga0207668_10679950
482 Ga0207703_10791267
483 Ga0207678_10048772
484 Ga0207708_10282116
485 Ga0207641_10082927
486 Ga0207648_10315641
487 Ga0207674_10382728
488 Ga0207675_100025209
489 Ga0209371_1041349
490 Ga0209981_1001434
491 Ga0210000_1013248
492 Ga0209995_1012297
493 Ga0209970_1033662
494 Ga0209974_10003268
495 Ga0207428_10001439
496 Ga0268265_10607785
497 Ga0268265_10971741
498 Ga0268264_10458619
499 Ga0268264_10555517
500 Ga0268256_1046919
501 Ga0265328_10069358
502 Ga0265329_10005116
503 Ga0307408_100150713
504 Ga0265314_10000389
505 Ga0307410_10100051
506 Ga0307410_10274103
507 Ga0307410_10367587
508 Ga0307407_10091970
509 Ga0307412_10002597
510 Ga0307409_100379023
511 Ga0307409_100466933
512 Ga0307416_100162771
513 Ga0307416_100598867
514 Ga0307411_10008584
515 Ga0307411_10063185
516 Ga0373952_0008838
517 Ga0373939_0005098
518 Ga0373941_0015469
519 Ga0373960_0021601
520 Ga0373946_0008881
521 Ga0316574_0190759
522 Ga0373931_0000611
523 Ga0373927_0131321
524 Ga0373947_0274641
525 Ga0400483_012271
526 Ga0400483_064861
527 Ga0400483_244292
528 Ga0400483_246197
529 Ga0400483_254494
530 Ga0436365_1149121
531 Ga0436365_1928739
532 Ga0436361_0047187
533 Ga0436361_1029863
534 Ga0436361_1165271
535 Ga0436363_0544542
536 Ga0436362_0927393
537 Ga0436362_1160388
538 Ga0439442_015479
539 Ga0439445_0080593
540 Ga0439457_041225
541 Ga0439446_0010452
542 Ga0439446_0130170
543 Ga0439464_0011583
544 Ga0451577_0078301
545 Ga0453684_0053144
546 Ga0453684_0095254
547 Ga0466958_0000025
548 Ga0495580_0045149
549 Ga0496102_0082085
550 Ga0496104_0183753
551 Ga0496105_0111553
552 Ga0496106_0510204
553 Ga0496108_0000469
554 Ga0496110_0126076
555 Ga0496110_0321725
556 Ga0496110_0402490
557 Ga0496112_0057075
558 Ga0496112_0520686
559 Ga0496116_0016981
560 Ga0496121_0017993
561 Ga0496122_0000165
562 Ga0496123_0001042
563 Ga0496124_0118379
564 Ga0496124_0284272
565 Ga0496125_0092920
566 Ga0496125_0227197
567 Ga0501032_0065424
568 Ga0501032_0179700
569 Ga0501033_0047747
570 Ga0501033_0138637
571 Ga0501033_0392560
572 Ga0501034_0064932
573 Ga0501036_0017723
574 Ga0501036_0090079
575 Ga0501037_0043422
576 Ga0501037_0126890
577 Ga0501038_0028442
578 Ga0501038_0074896
579 Ga0501038_0471239
580 Ga0501039_0039095
581 Ga0501040_0233028
582 Ga0501041_0012067
583 Ga0501041_0454859
584 Ga0501042_0014840
585 Ga0501043_0017139
586 Ga0501043_0309612
587 Ga0501046_0044312
588 Ga0501046_0439150
589 Ga0501047_0270753
590 Ga0501047_0617837
591 Ga0501048_0007203
592 Ga0501048_0497005
593 Ga0501067_0001307
594 Ga0501067_0013714
595 Ga0501068_0010722
596 Ga0501069_0028839
597 Ga0501070_0043475
598 Ga0501070_0630541
599 Ga0501073_0004294
600 Ga0501074_0197461
601 Ga0501075_0016098
602 Ga0501076_0005240
603 Ga0501076_0069169
604 Ga0501077_0066283
605 Ga0501077_0150805
606 Ga0501077_0551747
607 Ga0501079_0166944
608 Ga0501079_0476694
609 Ga0501080_0009051
610 Ga0501080_0010430
611 Ga0501080_0055716
612 Ga0501081_0003386
613 Ga0501081_0166968
614 Ga0501083_0032672
615 Ga0501083_0084875
616 Ga0501035_0052685
617 Ga0501035_0117142
618 Ga0501035_0434227
619 Ga0501044_0110559
620 Ga0501044_0417837
621 nmdc:mga0yw44_264512_c1
622 nmdc:mga05p37_26638_c1
623 nmdc:mga0qj67_435160_c1
624 nmdc:mga08y16_16_c1
625 nmdc:mga08y16_659512_c1
626 nmdc:mga0n895_10604_c1
627 nmdc:mga0n895_385836_c1
628 nmdc:mga0n895_908_c1
629 nmdc:mga0rr50_3_c1
630 nmdc:mga0rr50_428960_c1
631 nmdc:mga08x19_176_c1
632 nmdc:mga08x19_28484_c1
633 nmdc:mga08x19_331870_c1
634 Ga0500556_0095459
635 Ga0500658_0055893
636 Ga0500573_0007226
637 Ga0500633_0120729
638 Ga0501084_0027038
639 Ga0501084_0036395
640 Ga0501084_0109683
641 Ga0501084_0223555
642 Ga0501084_0529715
643 Ga0590075_002461
644 Ga0501082_0016560
645 Ga0501082_0068529
646 Ga0501082_0096706
647 Ga0501082_0234758
648 Ga0501082_0445027
649 2643828174
650 2644057351
651 2644072554
652 2644531263
653 2809031303
654 2857539381
655 2887446975
656 2941480784

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00583

Acetyltransf_1

Acetyltransferase (GNAT) family

93

213

0.81

PF13302

Acetyltransf_3

Acetyltransferase (GNAT) domain

73

214

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tcv-assembly1.cif.gz_A crystal structure of a gcn5-related n-acetyltransferase from brucella melitensis 0.9794 16 235
3tcv-assembly1.cif.gz_A crystal structure of a gcn5-related n-acetyltransferase from brucella melitensis 0.9706 16 235
3pzj-assembly1.cif.gz_A crystal structure of a probable acetyltransferases (gnat family) from chromobacterium violaceum atcc 12472 0.9328 11 205
3pzj-assembly1.cif.gz_B crystal structure of a probable acetyltransferases (gnat family) from chromobacterium violaceum atcc 12472 0.9084 18 205
3pzj-assembly1.cif.gz_A crystal structure of a probable acetyltransferases (gnat family) from chromobacterium violaceum atcc 12472 0.9016 11 205
ID Description Score Start End Superfamily
3tcvA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9794 16 235 3.40.630.30
af_P40586_15_233_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9788 16 235 3.40.630.30
3tcvA00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9706 16 235 3.40.630.30
af_P40586_15_233_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.97 16 235 3.40.630.30
af_A0A0R0ECR9_59_131_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.9125 135 200 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A7H9VA42-F1-model_v4 N-acetyltransferase 0.9936 143 214 GO:0008999
GO:1990189
AF-A0A2U2BLB6-F1-model_v4 Ribosomal-protein-serine acetyltransferase 0.99 3 232 GO:0008999
GO:1990189
AF-A0A535NEY3-F1-model_v4 GNAT family N-acetyltransferase 0.9815 86 240 GO:0008999
GO:1990189
AF-A0A7R7YFK8-F1-model_v4 N-acetyltransferase domain-containing protein 0.9798 27 230 GO:0008999
GO:1990189
AF-A0A657LVG5-F1-model_v4 GCN5 family acetyltransferase 0.9786 14 231 GO:0008999
GO:1990189

Map