F409209

General Info

Members Datasets Scaffolds Average Seq Length
328 244 656 126

Family's Representative Sequence

Representative Sequence 3300007265|Ga0099794_10126763|Ga0099794_101267633
Length 152
Sequence MDAASARATGAVPGIPRDDDGPVFREPWEAHAFAMALALHERRLFTWNEWATALAEEIKRAQAKGDPDTGETYYRHWLATLENLVAAKGVATSDALHRYRDAWDHAADRTPHGAPIELKPEDFADYGLIPELPPLRHGHRACARAPAARPCR

Samples

Sample ID Description Type Environment
1 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
48 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
49 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
50 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
59 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
74 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
75 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
120 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
121 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
122 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
123 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
124 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
125 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
126 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
127 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
128 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
129 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
130 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
131 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
137 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
138 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
139 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
140 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
142 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
143 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
144 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
145 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
146 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
147 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
148 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
149 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
150 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
151 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
152 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
153 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
154 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
155 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
156 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
157 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
158 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
159 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
160 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
161 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
162 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
163 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
164 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
165 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
166 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
167 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
168 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
169 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
170 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
171 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
172 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
173 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
174 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
175 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
176 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
177 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
178 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
179 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
180 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
181 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
182 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
183 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
184 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
185 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
186 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
187 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
188 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
189 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
190 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
191 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
192 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
193 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
194 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
195 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
196 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
207 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
208 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
209 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
210 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
211 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
212 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
213 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
215 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
216 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
217 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
218 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
219 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
220 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
221 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
222 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
223 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
224 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
225 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
226 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
227 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
228 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
229 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
230 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
231 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
232 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
233 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
234 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
235 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
236 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
237 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
238 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
239 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
240 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
241 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
242 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
243 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
244 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.09
Metatranscriptomes 0.61
Isolates 0.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.28
Nodule 0.3
Rhizoplane 7.93
Rhizosphere 72.26
Stem 0
Stem Tuber 0
Unclassified 0.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0099794_10126763 3300007265 Bacteria 1287
2 JGI24750J21931_1062827 3300002070 Bacteria 596
3 JGI24744J21845_10028166 3300002077 Bacteria 1083
4 JGI25406J46586_10000004 3300003203 Bacteria 149772
5 Ga0070676_10355704 3300005328 Bacteria 1008
6 Ga0070683_100015944 3300005329 Bacteria 6610
7 Ga0070690_100343832 3300005330 Bacteria 1081
8 Ga0070666_10722926 3300005335 Bacteria 731
9 Ga0070680_100134866 3300005336 Bacteria 2067
10 Ga0070660_100264481 3300005339 Bacteria 1405
11 Ga0070668_100402070 3300005347 Bacteria 1169
12 Ga0070669_101243650 3300005353 Bacteria 644
13 Ga0070674_100154195 3300005356 Bacteria 1736
14 Ga0070673_100708581 3300005364 Bacteria 925
15 Ga0070667_100281005 3300005367 Bacteria 1495
16 Ga0070667_100537329 3300005367 Bacteria 1074
17 Ga0070709_10982187 3300005434 Bacteria 671
18 Ga0070714_101158843 3300005435 Bacteria 754
19 Ga0070713_100163304 3300005436 Bacteria 1990
20 Ga0070713_100185323 3300005436 Bacteria 1873
21 Ga0070711_100018562 3300005439 Bacteria 4444
22 Ga0070694_101661659 3300005444 Bacteria 543
23 Ga0070663_100008568 3300005455 Bacteria 6300
24 Ga0070678_100664704 3300005456 Bacteria 936
25 Ga0070662_100172927 3300005457 Bacteria 1697
26 Ga0070681_11239856 3300005458 Bacteria 668
27 Ga0068867_100443211 3300005459 Bacteria 1105
28 Ga0070706_100645438 3300005467 Bacteria 983
29 Ga0070707_100272614 3300005468 Bacteria 1645
30 Ga0070698_100885917 3300005471 Bacteria 838
31 Ga0070679_100712027 3300005530 Bacteria 947
32 Ga0070684_100007537 3300005535 Bacteria 8472
33 Ga0068853_100527736 3300005539 Bacteria 1116
34 Ga0070686_100183597 3300005544 Bacteria 1488
35 Ga0070686_100755989 3300005544 Bacteria 780
36 Ga0070665_100004313 3300005548 Bacteria 14949
37 Ga0070665_100113379 3300005548 Bacteria 2714
38 Ga0070665_100621069 3300005548 Bacteria 1094
39 Ga0070665_101525156 3300005548 Bacteria 677
40 Ga0068852_102036513 3300005616 Bacteria 596
41 Ga0068859_101051342 3300005617 Bacteria 895
42 Ga0068866_10018371 3300005718 Bacteria 3162
43 Ga0068861_100046124 3300005719 Bacteria 3284
44 Ga0068861_101010807 3300005719 Bacteria 794
45 Ga0068858_100441333 3300005842 Bacteria 1253
46 Ga0081539_10000080 3300005985 Bacteria 222745
47 Ga0070717_10239746 3300006028 Bacteria 1599
48 Ga0075365_10035263 3300006038 Bacteria 3235
49 Ga0075365_10341360 3300006038 Bacteria 1055
50 Ga0075368_10017307 3300006042 Bacteria 2696
51 Ga0075363_100001412 3300006048 Bacteria 9091
52 Ga0070715_10800979 3300006163 Bacteria 572
53 Ga0070716_100085511 3300006173 Bacteria 1894
54 Ga0070716_101408795 3300006173 Bacteria 567
55 Ga0070712_100130489 3300006175 Bacteria 1904
56 Ga0075367_10040398 3300006178 Bacteria 2723
57 Ga0075367_10156398 3300006178 Bacteria 1416
58 Ga0075367_10451613 3300006178 Bacteria 814
59 Ga0075369_10278566 3300006186 Bacteria 779
60 Ga0075369_10400899 3300006186 Bacteria 647
61 Ga0075370_10030843 3300006353 Bacteria 2992
62 Ga0068871_100443347 3300006358 Bacteria 1163
63 Ga0068871_100656467 3300006358 Bacteria 958
64 Ga0075429_101551720 3300006880 Bacteria 576
65 Ga0068865_100582257 3300006881 Bacteria 944
66 Ga0097620_101051314 3300006931 Bacteria 895
67 Ga0099794_10005736 3300007265 Bacteria 5004
68 Ga0099794_10009738 3300007265 Bacteria 4054
69 Ga0099795_10107422 3300007788 Bacteria 1102
70 Ga0105240_10592127 3300009093 Bacteria 1222
71 Ga0105240_10663337 3300009093 Bacteria 1142
72 Ga0111539_10096406 3300009094 Bacteria 3474
73 Ga0111539_11481788 3300009094 Unclassified 787
74 Ga0105245_10049278 3300009098 Bacteria 3771
75 Ga0105247_11369647 3300009101 Bacteria 571
76 Ga0105243_10261350 3300009148 Bacteria 1550
77 Ga0105243_11199559 3300009148 Bacteria 772
78 Ga0105241_11304515 3300009174 Bacteria 691
79 Ga0105242_12565102 3300009176 Bacteria 558
80 Ga0105249_10194106 3300009553 Bacteria 1983
81 Ga0099796_10085042 3300010159 Bacteria 1167
82 Ga0105246_10661279 3300011119 Bacteria 911
83 Ga0157369_11614124 3300013105 Bacteria 659
84 Ga0157378_10175261 3300013297 Bacteria 2014
85 Ga0163162_10283551 3300013306 Bacteria 1788
86 Ga0163162_10320281 3300013306 Bacteria 1683
87 Ga0157375_10282907 3300013308 Bacteria 1822
88 Ga0163163_10290836 3300014325 Bacteria 1686
89 Ga0157379_10116830 3300014968 Bacteria 2399
90 Ga0157379_10843331 3300014968 Bacteria 867
91 Ga0157376_10045991 3300014969 Bacteria 3597
92 Ga0163161_10161909 3300017792 Bacteria 1706
93 Ga0213874_10035077 3300021377 Bacteria 1472
94 Ga0213876_10279266 3300021384 Bacteria 888
95 Ga0224712_10344790 3300022467 Bacteria 703
96 Ga0209677_100482 3300025253 Bacteria 22696
97 Ga0207642_10176902 3300025899 Bacteria 1159
98 Ga0207688_10323117 3300025901 Bacteria 947
99 Ga0207699_10199786 3300025906 Bacteria 1354
100 Ga0207699_10429374 3300025906 Bacteria 945
101 Ga0207645_10221419 3300025907 Bacteria 1247
102 Ga0207707_10413780 3300025912 Bacteria 1157
103 Ga0207695_10468432 3300025913 Bacteria 1142
104 Ga0207695_10524074 3300025913 Bacteria 1067
105 Ga0207663_10004390 3300025916 Bacteria 7002
106 Ga0207660_10068010 3300025917 Bacteria 2582
107 Ga0207657_10542160 3300025919 Bacteria 910
108 Ga0207649_10382495 3300025920 Bacteria 1049
109 Ga0207646_10196515 3300025922 Bacteria 1822
110 Ga0207659_10398724 3300025926 Bacteria 1150
111 Ga0207687_10082586 3300025927 Bacteria 2325
112 Ga0207700_10085019 3300025928 Bacteria 2482
113 Ga0207700_10361529 3300025928 Bacteria 1266
114 Ga0207664_11335666 3300025929 Bacteria 637
115 Ga0207644_11386124 3300025931 Bacteria 591
116 Ga0207706_10086952 3300025933 Bacteria 2748
117 Ga0207706_11174539 3300025933 Bacteria 639
118 Ga0207709_10041095 3300025935 Bacteria 2773
119 Ga0207669_10012191 3300025937 Bacteria 4219
120 Ga0207704_10135573 3300025938 Bacteria 1713
121 Ga0207665_10060360 3300025939 Bacteria 2568
122 Ga0207665_11103823 3300025939 Bacteria 632
123 Ga0207711_10265237 3300025941 Bacteria 1579
124 Ga0207711_12041717 3300025941 Bacteria 516
125 Ga0207689_10724947 3300025942 Bacteria 839
126 Ga0207661_10000177 3300025944 Bacteria 41089
127 Ga0207651_10073515 3300025960 Bacteria 2431
128 Ga0207651_10432880 3300025960 Bacteria 1125
129 Ga0207712_10049944 3300025961 Bacteria 2918
130 Ga0207668_10558498 3300025972 Bacteria 992
131 Ga0207668_11277533 3300025972 Bacteria 660
132 Ga0207640_10184271 3300025981 Bacteria 1568
133 Ga0207640_11785650 3300025981 Bacteria 556
134 Ga0207658_10385006 3300025986 Bacteria 1229
135 Ga0207677_11755475 3300026023 Bacteria 576
136 Ga0207678_10017116 3300026067 Bacteria 6365
137 Ga0207678_10056581 3300026067 Bacteria 3376
138 Ga0207641_10461360 3300026088 Bacteria 1229
139 Ga0207648_10013660 3300026089 Bacteria 7539
140 Ga0207648_11297820 3300026089 Bacteria 684
141 Ga0207676_11494904 3300026095 Bacteria 672
142 Ga0207675_100062108 3300026118 Bacteria 3488
143 Ga0207675_101038436 3300026118 Bacteria 838
144 Ga0207683_10022911 3300026121 Bacteria 5367
145 Ga0209179_1044877 3300027512 Bacteria 937
146 Ga0209588_1016788 3300027671 Bacteria 2264
147 Ga0207428_10133824 3300027907 Bacteria 1896
148 Ga0268266_10005823 3300028379 Bacteria 11405
149 Ga0268266_10021762 3300028379 Bacteria 5464
150 Ga0268266_11927996 3300028379 Bacteria 565
151 Ga0268266_12272426 3300028379 Bacteria 514
152 Ga0268265_10470250 3300028380 Bacteria 1178
153 Ga0268264_12022102 3300028381 Bacteria 585
154 Ga0307517_10000053 3300028786 Bacteria 155723
155 Ga0265325_10184678 3300031241 Bacteria 969
156 Ga0265340_10086658 3300031247 Bacteria 1468
157 Ga0265316_10352465 3300031344 Bacteria 1065
158 Ga0307513_10138904 3300031456 Bacteria 2360
159 Ga0307408_100166766 3300031548 Bacteria 1755
160 Ga0265313_10039526 3300031595 Bacteria 2339
161 Ga0307508_10050635 3300031616 Bacteria 3695
162 Ga0265314_10153031 3300031711 Bacteria 1412
163 Ga0265342_10053626 3300031712 Bacteria 2399
164 Ga0307516_10065794 3300031730 Bacteria 3499
165 Ga0307516_10267248 3300031730 Bacteria 1398
166 Ga0307516_10300504 3300031730 Bacteria 1281
167 Ga0307516_10697342 3300031730 Bacteria 672
168 Ga0307405_10281962 3300031731 Bacteria 1251
169 Ga0307406_10679062 3300031901 Bacteria 858
170 Ga0307412_10384921 3300031911 Bacteria 1137
171 Ga0307412_10560368 3300031911 Bacteria 961
172 Ga0307416_100403591 3300032002 Bacteria 1405
173 Ga0307416_101152572 3300032002 Bacteria 880
174 Ga0307414_10153523 3300032004 Bacteria 1820
175 Ga0307415_100097181 3300032126 Bacteria 2149
176 Ga0307415_101031818 3300032126 Bacteria 766
177 Ga0307510_10137909 3300033180 Bacteria 2092
178 Ga0373945_0223221 3300035116 Bacteria 789
179 Ga0373945_0455184 3300035116 Bacteria 566
180 Ga0373943_0281123 3300035170 Bacteria 941
181 Ga0373931_0173808 3300035691 Bacteria 1271
182 Ga0373931_0754492 3300035691 Bacteria 646
183 Ga0373935_0158143 3300035692 Bacteria 1543
184 Ga0373927_0778353 3300035695 Bacteria 632
185 Ga0373947_0021843 3300035725 Bacteria 3708
186 Ga0373947_0105888 3300035725 Bacteria 1772
187 Ga0372808_056178 3300036459 Bacteria 565
188 Ga0373925_0073227 3300037068 Bacteria 2593
189 Ga0373925_0252048 3300037068 Bacteria 1416
190 Ga0373925_0506680 3300037068 Bacteria 991
191 Ga0436365_1774729 3300039437 Bacteria 1765
192 Ga0436361_0566742 3300039447 Unclassified 648
193 Ga0436363_1388796 3300039450 Bacteria 1822
194 Ga0451837_1072600 3300041494 Bacteria 575
195 Ga0451839_1430863 3300041496 Bacteria 720
196 Ga0451841_0838663 3300041498 Bacteria 540
197 Ga0451853_3619731 3300041512 Bacteria 1034
198 Ga0466961_0106467 3300044693 Bacteria 1765
199 Ga0466971_0011780 3300044719 Bacteria 3831
200 Ga0466968_0229565 3300044735 Bacteria 876
201 Ga0466957_0143727 3300044842 Bacteria 1539
202 Ga0466960_0810151 3300044901 Bacteria 567
203 Ga0466959_0053628 3300045049 Bacteria 2947
204 Ga0466958_0046372 3300045836 Bacteria 2623
205 Ga0495617_132842 3300046452 Bacteria 797
206 Ga0495627_170144 3300046453 Bacteria 605
207 Ga0495592_0555244 3300046454 Bacteria 706
208 Ga0495603_0035963 3300046455 Bacteria 2973
209 Ga0495590_0162335 3300046457 Bacteria 813
210 Ga0495638_0045888 3300046460 Bacteria 2747
211 Ga0495638_0460794 3300046460 Bacteria 647
212 Ga0495638_0508206 3300046460 Bacteria 606
213 Ga0495638_0558780 3300046460 Bacteria 568
214 Ga0495641_0087145 3300046461 Bacteria 1397
215 Ga0495580_0145636 3300046472 Bacteria 1642
216 Ga0495580_0479553 3300046472 Bacteria 832
217 Ga0495664_0036962 3300046477 Bacteria 2881
218 Ga0495584_0028056 3300046491 Bacteria 2851
219 Ga0495584_0446111 3300046491 Bacteria 658
220 Ga0495606_0002525 3300046507 Bacteria 21061
221 Ga0495628_0497303 3300046516 Bacteria 881
222 Ga0495630_0534521 3300046517 Bacteria 899
223 Ga0495631_0108238 3300046518 Bacteria 1195
224 Ga0495631_0155840 3300046518 Bacteria 980
225 Ga0495632_0514753 3300046519 Bacteria 515
226 Ga0495640_0242310 3300046533 Bacteria 1131
227 Ga0495622_0312045 3300046557 Bacteria 684
228 Ga0495611_0030557 3300046648 Bacteria 2369
229 Ga0495625_0282824 3300046660 Bacteria 1067
230 Ga0495625_0318321 3300046660 Bacteria 991
231 Ga0495625_0483821 3300046660 Bacteria 759
232 Ga0495588_0335710 3300046674 Bacteria 795
233 Ga0495647_0071593 3300046681 Bacteria 1389
234 Ga0495658_0170972 3300046683 Bacteria 1345
235 Ga0495669_0013819 3300046684 Bacteria 3446
236 Ga0495613_0492503 3300046689 Bacteria 826
237 Ga0495624_0646072 3300046690 Bacteria 629
238 Ga0495589_0046558 3300046794 Bacteria 2152
239 Ga0495581_0230894 3300047315 Bacteria 1082
240 Ga0495674_0403963 3300047319 Bacteria 1102
241 Ga0495672_0043987 3300047320 Bacteria 2681
242 Ga0495676_0219341 3300047321 Bacteria 1312
243 Ga0495680_0841254 3300047322 Bacteria 597
244 Ga0495677_0039196 3300047445 Bacteria 1732
245 Ga0495685_273251 3300047447 Bacteria 533
246 Ga0495686_0592064 3300047472 Bacteria 575
247 Ga0495686_0671266 3300047472 Bacteria 531
248 Ga0495593_0592195 3300047673 Bacteria 557
249 Ga0495615_0055384 3300048090 Bacteria 1032
250 Ga0496100_0023500 3300048903 Bacteria 3746
251 Ga0496100_0119675 3300048903 Bacteria 1840
252 Ga0496100_0396472 3300048903 Bacteria 1050
253 Ga0496100_1255913 3300048903 Bacteria 584
254 Ga0496101_0027031 3300048904 Bacteria 3992
255 Ga0496101_0113865 3300048904 Bacteria 2039
256 Ga0496102_0092337 3300048905 Bacteria 2803
257 Ga0496102_0177314 3300048905 Bacteria 2007
258 Ga0496102_1170897 3300048905 Bacteria 688
259 Ga0496104_0211590 3300048907 Bacteria 1850
260 Ga0496104_0548979 3300048907 Bacteria 1066
261 Ga0496106_0126932 3300048909 Bacteria 1998
262 Ga0496106_0152890 3300048909 Bacteria 1821
263 Ga0496106_0214799 3300048909 Bacteria 1533
264 Ga0496107_0269074 3300048910 Bacteria 1268
265 Ga0496107_0346365 3300048910 Bacteria 1106
266 Ga0496108_0233556 3300048911 Bacteria 1599
267 Ga0496108_1482584 3300048911 Bacteria 565
268 Ga0496109_0100854 3300048912 Bacteria 2679
269 Ga0496110_0351461 3300048913 Bacteria 1343
270 Ga0496111_1103522 3300048914 Bacteria 565
271 Ga0496112_0001594 3300048915 Bacteria 17533
272 Ga0496114_0149296 3300048917 Bacteria 2027
273 Ga0496115_0161051 3300048918 Bacteria 1854
274 Ga0496115_0606372 3300048918 Bacteria 870
275 Ga0496115_1243863 3300048918 Bacteria 557
276 Ga0496116_0343511 3300048919 Bacteria 687
277 Ga0496119_0090363 3300048922 Bacteria 1742
278 Ga0496121_0032695 3300048924 Bacteria 4723
279 Ga0496121_0049129 3300048924 Bacteria 3581
280 Ga0496121_0398419 3300048924 Bacteria 902
281 Ga0496124_0143736 3300048927 Bacteria 1880
282 Ga0496124_0366493 3300048927 Bacteria 1013
283 Ga0496126_0027301 3300048929 Bacteria 5455
284 Ga0496126_0157546 3300048929 Bacteria 1943
285 Ga0496126_0608117 3300048929 Bacteria 860
286 Ga0501044_0250858 3300049823 Bacteria 1711
287 Ga0501044_1243857 3300049823 Bacteria 612
288 Ga0501045_0429158 3300049824 Bacteria 983
289 nmdc:mga03683_411455_c1 3300050489 Bacteria 647
290 nmdc:mga03683_83394_c1 3300050489 Bacteria 1384
291 nmdc:mga03n38_404_c1 3300050490 Bacteria 10692
292 nmdc:mga03n38_581625_c1 3300050490 Bacteria 636
293 nmdc:mga0yw44_22793_c1 3300050492 Bacteria 3517
294 nmdc:mga06z11_7555_c1 3300050494 Bacteria 4482
295 nmdc:mga04h51_168856_c1 3300050495 Bacteria 846
296 nmdc:mga04h51_319292_c1 3300050495 Bacteria 636
297 nmdc:mga04h51_74603_c1 3300050495 Bacteria 1192
298 nmdc:mga07m45_10981_c1 3300050496 Bacteria 4746
299 nmdc:mga07m45_483194_c1 3300050496 Bacteria 717
300 nmdc:mga08y16_89055_c1 3300050511 Bacteria 3216
301 nmdc:mga0n895_131995_c1 3300050512 Bacteria 2523
302 nmdc:mga0rr50_34960_c1 3300050513 Bacteria 3604
303 Ga0495601_0102445 3300053077 Bacteria 1850
304 Ga0495601_0113799 3300053077 Bacteria 1753
305 Ga0495601_0120435 3300053077 Bacteria 1704
306 Ga0495601_0546889 3300053077 Bacteria 745
307 Ga0500610_0210292 3300053079 Bacteria 930
308 Ga0495655_0352417 3300053083 Bacteria 515
309 Ga0495595_0014681 3300053084 Bacteria 3327
310 Ga0495619_0058817 3300053085 Bacteria 2553
311 Ga0495619_0784043 3300053085 Bacteria 645
312 Ga0500583_0003359 3300053092 Bacteria 5024
313 Ga0500641_0107674 3300053096 Bacteria 1198
314 Ga0500641_0222443 3300053096 Bacteria 800
315 Ga0500642_0232060 3300053130 Bacteria 852
316 Ga0500658_0159567 3300053134 Bacteria 1020
317 Ga0500577_0157080 3300053142 Bacteria 967
318 Ga0500579_216078 3300053143 Bacteria 678
319 Ga0500588_0197673 3300053146 Bacteria 744
320 Ga0500589_179451 3300053147 Bacteria 833
321 Ga0500633_0200785 3300053160 Bacteria 746
322 Ga0500634_0042331 3300053161 Bacteria 2471
323 Ga0500636_0043274 3300053177 Bacteria 2659
324 Ga0500611_100927 3300053727 Bacteria 747
325 Ga0500609_047402 3300053731 Bacteria 596
326 Ga0501082_0105590 3300060353 Bacteria 2437
327 Ga0466962_0542492 3300061719 Bacteria 590
328 2513717937 2513237104 Bacteria 10034502
329 Ga0099794_10126763
330 JGI24750J21931_1062827
331 JGI24744J21845_10028166
332 JGI25406J46586_10000004
333 Ga0070676_10355704
334 Ga0070683_100015944
335 Ga0070690_100343832
336 Ga0070666_10722926
337 Ga0070680_100134866
338 Ga0070660_100264481
339 Ga0070668_100402070
340 Ga0070669_101243650
341 Ga0070674_100154195
342 Ga0070673_100708581
343 Ga0070667_100281005
344 Ga0070667_100537329
345 Ga0070709_10982187
346 Ga0070714_101158843
347 Ga0070713_100163304
348 Ga0070713_100185323
349 Ga0070711_100018562
350 Ga0070694_101661659
351 Ga0070663_100008568
352 Ga0070678_100664704
353 Ga0070662_100172927
354 Ga0070681_11239856
355 Ga0068867_100443211
356 Ga0070706_100645438
357 Ga0070707_100272614
358 Ga0070698_100885917
359 Ga0070679_100712027
360 Ga0070684_100007537
361 Ga0068853_100527736
362 Ga0070686_100183597
363 Ga0070686_100755989
364 Ga0070665_100004313
365 Ga0070665_100113379
366 Ga0070665_100621069
367 Ga0070665_101525156
368 Ga0068852_102036513
369 Ga0068859_101051342
370 Ga0068866_10018371
371 Ga0068861_100046124
372 Ga0068861_101010807
373 Ga0068858_100441333
374 Ga0081539_10000080
375 Ga0070717_10239746
376 Ga0075365_10035263
377 Ga0075365_10341360
378 Ga0075368_10017307
379 Ga0075363_100001412
380 Ga0070715_10800979
381 Ga0070716_100085511
382 Ga0070716_101408795
383 Ga0070712_100130489
384 Ga0075367_10040398
385 Ga0075367_10156398
386 Ga0075367_10451613
387 Ga0075369_10278566
388 Ga0075369_10400899
389 Ga0075370_10030843
390 Ga0068871_100443347
391 Ga0068871_100656467
392 Ga0075429_101551720
393 Ga0068865_100582257
394 Ga0097620_101051314
395 Ga0099794_10005736
396 Ga0099794_10009738
397 Ga0099795_10107422
398 Ga0105240_10592127
399 Ga0105240_10663337
400 Ga0111539_10096406
401 Ga0111539_11481788
402 Ga0105245_10049278
403 Ga0105247_11369647
404 Ga0105243_10261350
405 Ga0105243_11199559
406 Ga0105241_11304515
407 Ga0105242_12565102
408 Ga0105249_10194106
409 Ga0099796_10085042
410 Ga0105246_10661279
411 Ga0157369_11614124
412 Ga0157378_10175261
413 Ga0163162_10283551
414 Ga0163162_10320281
415 Ga0157375_10282907
416 Ga0163163_10290836
417 Ga0157379_10116830
418 Ga0157379_10843331
419 Ga0157376_10045991
420 Ga0163161_10161909
421 Ga0213874_10035077
422 Ga0213876_10279266
423 Ga0224712_10344790
424 Ga0209677_100482
425 Ga0207642_10176902
426 Ga0207688_10323117
427 Ga0207699_10199786
428 Ga0207699_10429374
429 Ga0207645_10221419
430 Ga0207707_10413780
431 Ga0207695_10468432
432 Ga0207695_10524074
433 Ga0207663_10004390
434 Ga0207660_10068010
435 Ga0207657_10542160
436 Ga0207649_10382495
437 Ga0207646_10196515
438 Ga0207659_10398724
439 Ga0207687_10082586
440 Ga0207700_10085019
441 Ga0207700_10361529
442 Ga0207664_11335666
443 Ga0207644_11386124
444 Ga0207706_10086952
445 Ga0207706_11174539
446 Ga0207709_10041095
447 Ga0207669_10012191
448 Ga0207704_10135573
449 Ga0207665_10060360
450 Ga0207665_11103823
451 Ga0207711_10265237
452 Ga0207711_12041717
453 Ga0207689_10724947
454 Ga0207661_10000177
455 Ga0207651_10073515
456 Ga0207651_10432880
457 Ga0207712_10049944
458 Ga0207668_10558498
459 Ga0207668_11277533
460 Ga0207640_10184271
461 Ga0207640_11785650
462 Ga0207658_10385006
463 Ga0207677_11755475
464 Ga0207678_10017116
465 Ga0207678_10056581
466 Ga0207641_10461360
467 Ga0207648_10013660
468 Ga0207648_11297820
469 Ga0207676_11494904
470 Ga0207675_100062108
471 Ga0207675_101038436
472 Ga0207683_10022911
473 Ga0209179_1044877
474 Ga0209588_1016788
475 Ga0207428_10133824
476 Ga0268266_10005823
477 Ga0268266_10021762
478 Ga0268266_11927996
479 Ga0268266_12272426
480 Ga0268265_10470250
481 Ga0268264_12022102
482 Ga0307517_10000053
483 Ga0265325_10184678
484 Ga0265340_10086658
485 Ga0265316_10352465
486 Ga0307513_10138904
487 Ga0307408_100166766
488 Ga0265313_10039526
489 Ga0307508_10050635
490 Ga0265314_10153031
491 Ga0265342_10053626
492 Ga0307516_10065794
493 Ga0307516_10267248
494 Ga0307516_10300504
495 Ga0307516_10697342
496 Ga0307405_10281962
497 Ga0307406_10679062
498 Ga0307412_10384921
499 Ga0307412_10560368
500 Ga0307416_100403591
501 Ga0307416_101152572
502 Ga0307414_10153523
503 Ga0307415_100097181
504 Ga0307415_101031818
505 Ga0307510_10137909
506 Ga0373945_0223221
507 Ga0373945_0455184
508 Ga0373943_0281123
509 Ga0373931_0173808
510 Ga0373931_0754492
511 Ga0373935_0158143
512 Ga0373927_0778353
513 Ga0373947_0021843
514 Ga0373947_0105888
515 Ga0372808_056178
516 Ga0373925_0073227
517 Ga0373925_0252048
518 Ga0373925_0506680
519 Ga0436365_1774729
520 Ga0436361_0566742
521 Ga0436363_1388796
522 Ga0451837_1072600
523 Ga0451839_1430863
524 Ga0451841_0838663
525 Ga0451853_3619731
526 Ga0466961_0106467
527 Ga0466971_0011780
528 Ga0466968_0229565
529 Ga0466957_0143727
530 Ga0466960_0810151
531 Ga0466959_0053628
532 Ga0466958_0046372
533 Ga0495617_132842
534 Ga0495627_170144
535 Ga0495592_0555244
536 Ga0495603_0035963
537 Ga0495590_0162335
538 Ga0495638_0045888
539 Ga0495638_0460794
540 Ga0495638_0508206
541 Ga0495638_0558780
542 Ga0495641_0087145
543 Ga0495580_0145636
544 Ga0495580_0479553
545 Ga0495664_0036962
546 Ga0495584_0028056
547 Ga0495584_0446111
548 Ga0495606_0002525
549 Ga0495628_0497303
550 Ga0495630_0534521
551 Ga0495631_0108238
552 Ga0495631_0155840
553 Ga0495632_0514753
554 Ga0495640_0242310
555 Ga0495622_0312045
556 Ga0495611_0030557
557 Ga0495625_0282824
558 Ga0495625_0318321
559 Ga0495625_0483821
560 Ga0495588_0335710
561 Ga0495647_0071593
562 Ga0495658_0170972
563 Ga0495669_0013819
564 Ga0495613_0492503
565 Ga0495624_0646072
566 Ga0495589_0046558
567 Ga0495581_0230894
568 Ga0495674_0403963
569 Ga0495672_0043987
570 Ga0495676_0219341
571 Ga0495680_0841254
572 Ga0495677_0039196
573 Ga0495685_273251
574 Ga0495686_0592064
575 Ga0495686_0671266
576 Ga0495593_0592195
577 Ga0495615_0055384
578 Ga0496100_0023500
579 Ga0496100_0119675
580 Ga0496100_0396472
581 Ga0496100_1255913
582 Ga0496101_0027031
583 Ga0496101_0113865
584 Ga0496102_0092337
585 Ga0496102_0177314
586 Ga0496102_1170897
587 Ga0496104_0211590
588 Ga0496104_0548979
589 Ga0496106_0126932
590 Ga0496106_0152890
591 Ga0496106_0214799
592 Ga0496107_0269074
593 Ga0496107_0346365
594 Ga0496108_0233556
595 Ga0496108_1482584
596 Ga0496109_0100854
597 Ga0496110_0351461
598 Ga0496111_1103522
599 Ga0496112_0001594
600 Ga0496114_0149296
601 Ga0496115_0161051
602 Ga0496115_0606372
603 Ga0496115_1243863
604 Ga0496116_0343511
605 Ga0496119_0090363
606 Ga0496121_0032695
607 Ga0496121_0049129
608 Ga0496121_0398419
609 Ga0496124_0143736
610 Ga0496124_0366493
611 Ga0496126_0027301
612 Ga0496126_0157546
613 Ga0496126_0608117
614 Ga0501044_0250858
615 Ga0501044_1243857
616 Ga0501045_0429158
617 nmdc:mga03683_411455_c1
618 nmdc:mga03683_83394_c1
619 nmdc:mga03n38_404_c1
620 nmdc:mga03n38_581625_c1
621 nmdc:mga0yw44_22793_c1
622 nmdc:mga06z11_7555_c1
623 nmdc:mga04h51_168856_c1
624 nmdc:mga04h51_319292_c1
625 nmdc:mga04h51_74603_c1
626 nmdc:mga07m45_10981_c1
627 nmdc:mga07m45_483194_c1
628 nmdc:mga08y16_89055_c1
629 nmdc:mga0n895_131995_c1
630 nmdc:mga0rr50_34960_c1
631 Ga0495601_0102445
632 Ga0495601_0113799
633 Ga0495601_0120435
634 Ga0495601_0546889
635 Ga0500610_0210292
636 Ga0495655_0352417
637 Ga0495595_0014681
638 Ga0495619_0058817
639 Ga0495619_0784043
640 Ga0500583_0003359
641 Ga0500641_0107674
642 Ga0500641_0222443
643 Ga0500642_0232060
644 Ga0500658_0159567
645 Ga0500577_0157080
646 Ga0500579_216078
647 Ga0500588_0197673
648 Ga0500589_179451
649 Ga0500633_0200785
650 Ga0500634_0042331
651 Ga0500636_0043274
652 Ga0500611_100927
653 Ga0500609_047402
654 Ga0501082_0105590
655 Ga0466962_0542492
656 2513717937

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21006

NHase_beta_N

Nitrile hydratase beta subunit, N-terminal

7

122

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ire-assembly1.cif.gz_B crystal structure of co-type nitrile hydratase from pseudonocardia thermophila 0.6423 16 124
6l49-assembly1.cif.gz_E h3-ca-h3 tri-nucleosome with the 22 base-pair linker dna 0.6252 83 124
4zgd-assembly1.cif.gz_B mutant r157a of fe-type nitrile hydratase from comamonas testosteroni ni1 0.6157 13 120
2dd4-assembly1.cif.gz_H thiocyanate hydrolase (scnase) from thiobacillus thioparus recombinant apo-enzyme 0.5805 11 120
7w8m-assembly1.cif.gz_B-2 crystal structure of co-type nitrile hydratase mutant from pseudomonas thermophila - a129r 0.571 6 124
ID Description Score Start End Superfamily
1ireB01 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Nitrile hydratase, beta subunit 0.6423 16 124 1.10.472.20
2dd4H00 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Nitrile hydratase, beta subunit 0.5805 11 120 1.10.472.20
3qxeB01 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Nitrile hydratase, beta subunit 0.5563 8 122 1.10.472.20
4fm4B01 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Nitrile hydratase, beta subunit 0.5473 1 120 1.10.472.20
4fm4B01 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Nitrile hydratase, beta subunit 0.5374 1 120 1.10.472.20
ID Description Score Start End GO Terms
AF-A0A5A7YB97-F1-model_v4 Nitrile hydratase accessory protein 0.974 37 120
AF-A0A5A7YB97-F1-model_v4 Nitrile hydratase accessory protein 0.9519 37 120
AF-A0A2E9LLB9-F1-model_v4 Nitrile hydratase accessory protein 0.9329 25 111
AF-A0A1Y5RWQ0-F1-model_v4 Nitrile hydratase beta subunit 0.9324 37 120
AF-A0A381YPB9-F1-model_v4 Nitrile hydratase beta subunit-like N-terminal domain-containing protein 0.9318 25 120

Map