F409050

General Info

Members Datasets Scaffolds Average Seq Length
328 188 656 66

Family's Representative Sequence

Representative Sequence 3300002459|JGI24751J29686_10039822|JGI24751J29686_100398222
Length 66
Sequence MSLRWVHAMLILLSAALAVLFGVWCLALYSRQGGSGPLLAALVSFALSLGLVLYDSWFLRKTRMLR

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
38 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
60 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
61 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
97 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
98 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
99 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
100 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
101 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
102 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
103 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
104 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
105 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
106 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
107 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
108 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
109 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
110 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
111 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
112 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
113 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
114 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
115 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
116 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
117 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
118 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
119 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
120 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
121 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
122 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
123 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
124 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
125 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
126 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
127 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
128 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
129 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
130 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
131 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
132 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
133 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
135 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
138 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
139 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
144 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
145 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
146 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
147 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
148 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
149 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
150 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
151 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
152 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
153 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
154 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
155 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
156 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
157 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
158 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
159 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
160 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
161 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
162 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
163 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
164 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
165 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
166 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
168 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
169 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
170 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
171 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
172 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
173 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
174 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
175 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
176 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
177 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
178 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
179 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
180 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
181 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
182 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
183 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
184 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
185 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
186 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
187 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
188 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.66
Nodule 0
Rhizoplane 0.91
Rhizosphere 95.43
Stem 0
Stem Tuber 0
Unclassified 12.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10039822 3300002459 Bacteria 973
2 JGI24751J29686_10097938 3300002459 Bacteria 612
3 Ga0065714_10337368 3300005288 Bacteria 650
4 Ga0065712_10086689 3300005290 Bacteria 2617
5 Ga0065712_10546108 3300005290 Bacteria 620
6 Ga0065712_10599943 3300005290 Bacteria 574
7 Ga0065715_10068198 3300005293 Bacteria 847
8 Ga0065715_10302219 3300005293 Bacteria 1039
9 Ga0065707_10007335 3300005295 Bacteria 2999
10 Ga0065707_10044150 3300005295 Bacteria 1448
11 Ga0065707_10389394 3300005295 Bacteria 858
12 Ga0065707_10731618 3300005295 Bacteria 626
13 Ga0070676_10482521 3300005328 Bacteria 877
14 Ga0070683_102379774 3300005329 Bacteria 508
15 Ga0070670_100009318 3300005331 Bacteria 8388
16 Ga0070670_100070689 3300005331 Bacteria 2996
17 Ga0070670_100226527 3300005331 Bacteria 1627
18 Ga0070670_101436513 3300005331 Bacteria 633
19 Ga0068869_101874556 3300005334 Unclassified 537
20 Ga0070680_101191980 3300005336 Bacteria 659
21 Ga0070682_100923568 3300005337 Bacteria 719
22 Ga0070689_100384284 3300005340 Bacteria 1184
23 Ga0070691_10562068 3300005341 Bacteria 668
24 Ga0070691_10620046 3300005341 Bacteria 641
25 Ga0070661_100597326 3300005344 Bacteria 892
26 Ga0070661_100754541 3300005344 Bacteria 796
27 Ga0070661_101904777 3300005344 Bacteria 505
28 Ga0070668_101126425 3300005347 Bacteria 709
29 Ga0070669_100312165 3300005353 Bacteria 1268
30 Ga0070669_101046250 3300005353 Bacteria 702
31 Ga0070669_101497459 3300005353 Bacteria 586
32 Ga0070674_101354169 3300005356 Bacteria 636
33 Ga0070688_100260129 3300005365 Bacteria 1239
34 Ga0070662_100605165 3300005457 Bacteria 922
35 Ga0070662_100963146 3300005457 Bacteria 730
36 Ga0070681_10397947 3300005458 Bacteria 1289
37 Ga0068867_100638057 3300005459 Bacteria 933
38 Ga0070707_101086667 3300005468 Bacteria 766
39 Ga0070699_100251782 3300005518 Bacteria 1578
40 Ga0070679_101153706 3300005530 Unclassified 720
41 Ga0070684_100160693 3300005535 Bacteria 2038
42 Ga0068853_100995307 3300005539 Bacteria 807
43 Ga0070696_101270905 3300005546 Bacteria 624
44 Ga0070665_100217851 3300005548 Bacteria 1909
45 Ga0070664_100046738 3300005564 Bacteria 3657
46 Ga0068857_100015662 3300005577 Bacteria 6628
47 Ga0068857_100371457 3300005577 Bacteria 1327
48 Ga0068857_100561451 3300005577 Unclassified 1076
49 Ga0068859_101219067 3300005617 Bacteria 829
50 Ga0068864_101295767 3300005618 Bacteria 729
51 Ga0068861_101513599 3300005719 Bacteria 659
52 Ga0068870_10655414 3300005840 Bacteria 720
53 Ga0068862_100279064 3300005844 Bacteria 1531
54 Ga0068862_101182361 3300005844 Bacteria 763
55 Ga0068862_101583401 3300005844 Bacteria 662
56 Ga0081455_10526103 3300005937 Bacteria 788
57 Ga0075363_100042543 3300006048 Bacteria 2401
58 Ga0075364_10362067 3300006051 Unclassified 989
59 Ga0075364_10804080 3300006051 Bacteria 641
60 Ga0075428_100012862 3300006844 Bacteria 9314
61 Ga0075428_102228156 3300006844 Unclassified 565
62 Ga0075430_100028728 3300006846 Bacteria 4723
63 Ga0075430_100093214 3300006846 Bacteria 2518
64 Ga0075430_100154825 3300006846 Bacteria 1908
65 Ga0075430_100281683 3300006846 Bacteria 1375
66 Ga0075431_100034890 3300006847 Bacteria 5182
67 Ga0075431_100942642 3300006847 Bacteria 832
68 Ga0075433_10289157 3300006852 Bacteria 1452
69 Ga0075433_10696743 3300006852 Bacteria 890
70 Ga0075433_11846255 3300006852 Bacteria 519
71 Ga0075433_11969259 3300006852 Bacteria 501
72 Ga0075434_100753448 3300006871 Bacteria 991
73 Ga0075434_101163285 3300006871 Bacteria 784
74 Ga0075429_100091310 3300006880 Bacteria 2656
75 Ga0068865_100147366 3300006881 Bacteria 1782
76 Ga0097620_101218843 3300006931 Bacteria 829
77 Ga0075435_101658870 3300007076 Unclassified 561
78 Ga0105240_11521324 3300009093 Bacteria 701
79 Ga0111539_10421593 3300009094 Bacteria 1554
80 Ga0114129_10047313 3300009147 Bacteria 6044
81 Ga0114129_10635361 3300009147 Bacteria 1379
82 Ga0105243_10536083 3300009148 Bacteria 1116
83 Ga0105243_10942267 3300009148 Bacteria 862
84 Ga0105243_12401112 3300009148 Unclassified 566
85 Ga0105241_10451462 3300009174 Bacteria 1137
86 Ga0105242_10030456 3300009176 Bacteria 4308
87 Ga0105249_10083297 3300009553 Bacteria 2977
88 Ga0105249_10460189 3300009553 Bacteria 1312
89 Ga0105249_11275191 3300009553 Bacteria 806
90 Ga0105239_10956254 3300010375 Bacteria 984
91 Ga0157378_10355007 3300013297 Bacteria 1433
92 Ga0163163_11222699 3300014325 Unclassified 814
93 Ga0157380_12395086 3300014326 Bacteria 593
94 Ga0182008_10856811 3300014497 Unclassified 532
95 Ga0157377_10611015 3300014745 Bacteria 779
96 Ga0157377_10648167 3300014745 Bacteria 760
97 Ga0157377_11168965 3300014745 Unclassified 594
98 Ga0207654_10105463 3300025911 Bacteria 1744
99 Ga0207671_10903794 3300025914 Bacteria 698
100 Ga0207660_10862220 3300025917 Bacteria 739
101 Ga0207649_10415149 3300025920 Bacteria 1010
102 Ga0207649_10537237 3300025920 Bacteria 893
103 Ga0207652_10533176 3300025921 Bacteria 1056
104 Ga0207646_11493460 3300025922 Unclassified 585
105 Ga0207681_10995382 3300025923 Bacteria 703
106 Ga0207650_10007091 3300025925 Bacteria 7636
107 Ga0207650_10008096 3300025925 Bacteria 7164
108 Ga0207650_10380526 3300025925 Bacteria 1165
109 Ga0207650_11910687 3300025925 Bacteria 501
110 Ga0207659_10996832 3300025926 Bacteria 721
111 Ga0207690_11753817 3300025932 Bacteria 518
112 Ga0207706_10024166 3300025933 Bacteria 5449
113 Ga0207706_10320039 3300025933 Bacteria 1350
114 Ga0207706_11197556 3300025933 Unclassified 631
115 Ga0207686_10084349 3300025934 Bacteria 2081
116 Ga0207709_11692624 3300025935 Bacteria 526
117 Ga0207670_10165399 3300025936 Bacteria 1655
118 Ga0207669_10995696 3300025937 Bacteria 704
119 Ga0207704_10157849 3300025938 Bacteria 1610
120 Ga0207691_10643186 3300025940 Bacteria 896
121 Ga0207689_10014485 3300025942 Bacteria 6709
122 Ga0207689_11610341 3300025942 Unclassified 540
123 Ga0207661_10477423 3300025944 Bacteria 1138
124 Ga0207679_10033713 3300025945 Bacteria 3606
125 Ga0207679_10452467 3300025945 Unclassified 1139
126 Ga0207712_10145405 3300025961 Bacteria 1824
127 Ga0207712_10470283 3300025961 Bacteria 1070
128 Ga0207712_10483823 3300025961 Bacteria 1055
129 Ga0207658_10584979 3300025986 Bacteria 1002
130 Ga0207639_11001586 3300026041 Bacteria 783
131 Ga0207641_10114111 3300026088 Bacteria 2400
132 Ga0207648_10161977 3300026089 Bacteria 1976
133 Ga0207648_10724724 3300026089 Bacteria 922
134 Ga0207648_11149560 3300026089 Bacteria 729
135 Ga0207676_10841210 3300026095 Bacteria 897
136 Ga0207674_10073053 3300026116 Bacteria 3444
137 Ga0207674_10318931 3300026116 Bacteria 1503
138 Ga0207674_11747653 3300026116 Unclassified 590
139 Ga0207675_100545733 3300026118 Bacteria 1158
140 Ga0207675_101587278 3300026118 Bacteria 675
141 Ga0207698_10391632 3300026142 Bacteria 1325
142 Ga0209999_1039564 3300027543 Unclassified 883
143 Ga0209971_1096598 3300027682 Bacteria 722
144 Ga0207428_10442632 3300027907 Bacteria 948
145 Ga0268266_10035327 3300028379 Bacteria 4252
146 Ga0268265_11045737 3300028380 Bacteria 808
147 Ga0268264_11248563 3300028381 Unclassified 753
148 Ga0307408_100043742 3300031548 Bacteria 3188
149 Ga0307408_100584419 3300031548 Bacteria 990
150 Ga0307405_10822538 3300031731 Bacteria 780
151 Ga0307413_10305490 3300031824 Bacteria 1208
152 Ga0307413_10319523 3300031824 Bacteria 1185
153 Ga0307413_11857099 3300031824 Unclassified 540
154 Ga0307410_10024119 3300031852 Bacteria 3795
155 Ga0307410_10195064 3300031852 Bacteria 1542
156 Ga0307406_10033238 3300031901 Bacteria 3156
157 Ga0307407_11246871 3300031903 Bacteria 582
158 Ga0307412_10164157 3300031911 Bacteria 1654
159 Ga0307409_100046151 3300031995 Bacteria 3296
160 Ga0307409_100670801 3300031995 Bacteria 1033
161 Ga0307409_102969599 3300031995 Bacteria 501
162 Ga0307416_100026833 3300032002 Bacteria 4252
163 Ga0307416_100085209 3300032002 Bacteria 2688
164 Ga0307416_100115188 3300032002 Bacteria 2380
165 Ga0307416_100394506 3300032002 Bacteria 1419
166 Ga0307414_10025909 3300032004 Bacteria 3765
167 Ga0307411_10325023 3300032005 Bacteria 1244
168 Ga0307411_10550319 3300032005 Bacteria 984
169 Ga0307415_100011908 3300032126 Bacteria 5004
170 Ga0395901_0187888 3300038443 Bacteria 2167
171 Ga0439439_0044161 3300041406 Bacteria 1160
172 Ga0439453_0012573 3300041408 Bacteria 1427
173 Ga0439453_0104427 3300041408 Unclassified 635
174 Ga0451797_1265102 3300041453 Bacteria 900
175 Ga0439431_0081100 3300041997 Bacteria 875
176 Ga0439433_0012624 3300041999 Bacteria 1854
177 Ga0439441_156011 3300042001 Bacteria 540
178 Ga0439443_052468 3300042003 Unclassified 716
179 Ga0439445_0122860 3300042004 Bacteria 746
180 Ga0439449_0046335 3300042007 Bacteria 1611
181 Ga0439454_022283 3300042011 Unclassified 943
182 Ga0439462_0044512 3300042015 Bacteria 1188
183 Ga0450919_026189 3300042121 Unclassified 663
184 Ga0439446_0043515 3300042156 Bacteria 1327
185 Ga0439434_0163183 3300042435 Unclassified 741
186 Ga0439434_0211045 3300042435 Bacteria 657
187 Ga0439434_0325976 3300042435 Bacteria 534
188 Ga0439435_0003185 3300042436 Bacteria 3379
189 Ga0439435_0013967 3300042436 Bacteria 1977
190 Ga0439435_0016876 3300042436 Bacteria 1838
191 Ga0439435_0048055 3300042436 Unclassified 1214
192 Ga0439435_0074446 3300042436 Bacteria 1010
193 Ga0439444_0016064 3300042437 Bacteria 1270
194 Ga0439444_0026252 3300042437 Bacteria 1065
195 Ga0439460_0165534 3300042461 Bacteria 743
196 Ga0451577_0005412 3300042876 Bacteria 13097
197 Ga0451577_0066463 3300042876 Bacteria 3216
198 Ga0453684_0267055 3300044712 Bacteria 1957
199 Ga0453684_0293520 3300044712 Bacteria 1850
200 Ga0496112_0426786 3300048915 Bacteria 1264
201 Ga0496113_0156124 3300048916 Bacteria 1802
202 Ga0501292_014024 3300049515 Bacteria 1238
203 Ga0501296_064829 3300049519 Unclassified 558
204 Ga0501298_118039 3300049521 Bacteria 622
205 Ga0501031_0093785 3300049568 Bacteria 1959
206 Ga0501031_0285944 3300049568 Bacteria 1069
207 Ga0501034_0617092 3300049571 Unclassified 989
208 Ga0501034_0945687 3300049571 Bacteria 748
209 Ga0501036_0005932 3300049572 Bacteria 9895
210 Ga0501036_0110039 3300049572 Bacteria 2328
211 Ga0501037_0510545 3300049573 Bacteria 815
212 Ga0501038_0067601 3300049574 Bacteria 3040
213 Ga0501038_0243786 3300049574 Bacteria 1426
214 Ga0501038_0367652 3300049574 Bacteria 1118
215 Ga0501039_0051685 3300049575 Bacteria 3180
216 Ga0501039_0136749 3300049575 Bacteria 1924
217 Ga0501039_0216736 3300049575 Bacteria 1505
218 Ga0501039_1304312 3300049575 Unclassified 560
219 Ga0501039_1333811 3300049575 Bacteria 553
220 Ga0501040_0010300 3300049576 Bacteria 6114
221 Ga0501040_0961282 3300049576 Bacteria 619
222 Ga0501040_1351881 3300049576 Bacteria 517
223 Ga0501041_0124449 3300049577 Bacteria 1604
224 Ga0501041_0281888 3300049577 Bacteria 1046
225 Ga0501042_0222703 3300049578 Bacteria 1361
226 Ga0501042_1061653 3300049578 Bacteria 590
227 Ga0501042_1212730 3300049578 Unclassified 550
228 Ga0501043_0353499 3300049579 Bacteria 1116
229 Ga0501043_0884257 3300049579 Bacteria 642
230 Ga0501046_0294353 3300049580 Bacteria 1187
231 Ga0501047_1002885 3300049581 Bacteria 648
232 Ga0501048_0191460 3300049582 Bacteria 1449
233 Ga0501048_0631548 3300049582 Bacteria 769
234 Ga0501048_0845326 3300049582 Unclassified 658
235 Ga0501048_1123908 3300049582 Unclassified 565
236 Ga0501048_1229980 3300049582 Bacteria 538
237 Ga0501068_0305810 3300049584 Bacteria 1018
238 Ga0501068_0532958 3300049584 Bacteria 763
239 Ga0501070_0702568 3300049586 Bacteria 800
240 Ga0501071_0020890 3300049587 Bacteria 4555
241 Ga0501071_0023290 3300049587 Bacteria 4325
242 Ga0501071_0207845 3300049587 Bacteria 1472
243 Ga0501071_0618303 3300049587 Bacteria 833
244 Ga0501071_0671326 3300049587 Bacteria 798
245 Ga0501072_0101728 3300049588 Bacteria 2284
246 Ga0501072_0390255 3300049588 Bacteria 1105
247 Ga0501072_0399621 3300049588 Bacteria 1090
248 Ga0501072_0509617 3300049588 Bacteria 951
249 Ga0501073_0050267 3300049589 Bacteria 2922
250 Ga0501074_0934269 3300049590 Bacteria 610
251 Ga0501074_1130919 3300049590 Bacteria 550
252 Ga0501075_0012466 3300049591 Bacteria 6042
253 Ga0501075_0102195 3300049591 Bacteria 2177
254 Ga0501075_0103473 3300049591 Bacteria 2164
255 Ga0501075_0672738 3300049591 Bacteria 789
256 Ga0501075_1417345 3300049591 Unclassified 526
257 Ga0501076_0072137 3300049592 Bacteria 2763
258 Ga0501076_0181417 3300049592 Bacteria 1716
259 Ga0501076_0299464 3300049592 Unclassified 1318
260 Ga0501076_0466475 3300049592 Bacteria 1040
261 Ga0501076_0660540 3300049592 Bacteria 863
262 Ga0501077_0469339 3300049593 Bacteria 806
263 Ga0501077_0614404 3300049593 Bacteria 698
264 Ga0501202_174860 3300049652 Unclassified 576
265 Ga0501217_008701 3300049661 Bacteria 2198
266 Ga0501217_071819 3300049661 Bacteria 943
267 Ga0501235_214497 3300049669 Unclassified 526
268 Ga0501239_043701 3300049672 Bacteria 628
269 Ga0501221_143827 3300049704 Unclassified 627
270 Ga0501225_0367132 3300049705 Bacteria 501
271 Ga0501079_0030179 3300049741 Bacteria 4166
272 Ga0501079_0105028 3300049741 Bacteria 2191
273 Ga0501079_0335931 3300049741 Bacteria 1183
274 Ga0501079_0380194 3300049741 Unclassified 1107
275 Ga0501079_0438012 3300049741 Unclassified 1026
276 Ga0501079_0728554 3300049741 Bacteria 780
277 Ga0501080_0284972 3300049742 Bacteria 1501
278 Ga0501080_1739927 3300049742 Bacteria 525
279 Ga0501081_0041279 3300049743 Bacteria 3159
280 Ga0501081_0196000 3300049743 Unclassified 1464
281 Ga0501081_0273949 3300049743 Bacteria 1235
282 Ga0501083_0156993 3300049744 Bacteria 1489
283 Ga0501274_046621 3300049771 Unclassified 534
284 Ga0501035_0417134 3300049822 Bacteria 1115
285 Ga0501045_0039587 3300049824 Bacteria 3430
286 Ga0501045_1363294 3300049824 Unclassified 515
287 nmdc:mga03n38_55445_c1 3300050490 Bacteria 1785
288 nmdc:mga00v17_217310_c1 3300050491 Bacteria 1237
289 nmdc:mga00v17_716250_c1 3300050491 Bacteria 641
290 nmdc:mga0yw44_15513_c1 3300050492 Bacteria 4084
291 nmdc:mga0k408_28732_c1 3300050493 Bacteria 3162
292 nmdc:mga06z11_318583_c1 3300050494 Bacteria 927
293 nmdc:mga05p37_146758_c2 3300050507 Bacteria 2530
294 nmdc:mga05p37_962362_c1 3300050507 Bacteria 912
295 nmdc:mga05p37_969879_c1 3300050507 Bacteria 907
296 nmdc:mga09592_622080_c1 3300050508 Bacteria 924
297 nmdc:mga0qj67_1191287_c1 3300050509 Bacteria 593
298 nmdc:mga0qj67_23614_c1 3300050509 Bacteria 4732
299 nmdc:mga0qj67_378476_c1 3300050509 Bacteria 1143
300 nmdc:mga0qj67_732052_c1 3300050509 Bacteria 785
301 nmdc:mga0qj67_87525_c1 3300050509 Bacteria 2500
302 nmdc:mga06r32_125613_c1 3300050510 Bacteria 2534
303 nmdc:mga06r32_863395_c1 3300050510 Bacteria 863
304 nmdc:mga08y16_242463_c1 3300050511 Bacteria 1863
305 nmdc:mga08y16_37872_c1 3300050511 Bacteria 5063
306 nmdc:mga0n895_687956_c1 3300050512 Bacteria 1019
307 nmdc:mga0a205_209926_c1 3300050515 Bacteria 1836
308 nmdc:mga0a205_266532_c1 3300050515 Bacteria 1590
309 Ga0500555_000048 3300053103 Bacteria 61782
310 Ga0500589_267709 3300053147 Bacteria 619
311 Ga0500645_000118 3300053730 Bacteria 62173
312 Ga0501084_0077692 3300054114 Bacteria 2783
313 Ga0501084_0106022 3300054114 Bacteria 2361
314 Ga0501084_0333572 3300054114 Bacteria 1281
315 Ga0501084_0462709 3300054114 Bacteria 1072
316 Ga0501084_1075700 3300054114 Bacteria 675
317 Ga0590071_001208 3300059421 Bacteria 6983
318 Ga0590071_079855 3300059421 Bacteria 812
319 Ga0590071_148065 3300059421 Bacteria 608
320 Ga0590075_029211 3300059424 Bacteria 1393
321 Ga0590077_164687 3300059426 Unclassified 533
322 Ga0501082_0065398 3300060353 Bacteria 3132
323 Ga0501082_0128764 3300060353 Bacteria 2196
324 Ga0501082_0330604 3300060353 Bacteria 1328
325 Ga0501082_0367356 3300060353 Bacteria 1255
326 Ga0501082_1359856 3300060353 Bacteria 620
327 Ga0530510_0006258 3300061734 Bacteria 8280
328 Ga0530510_0015536 3300061734 Bacteria 5381
329 JGI24751J29686_10039822
330 JGI24751J29686_10097938
331 Ga0065714_10337368
332 Ga0065712_10086689
333 Ga0065712_10546108
334 Ga0065712_10599943
335 Ga0065715_10068198
336 Ga0065715_10302219
337 Ga0065707_10007335
338 Ga0065707_10044150
339 Ga0065707_10389394
340 Ga0065707_10731618
341 Ga0070676_10482521
342 Ga0070683_102379774
343 Ga0070670_100009318
344 Ga0070670_100070689
345 Ga0070670_100226527
346 Ga0070670_101436513
347 Ga0068869_101874556
348 Ga0070680_101191980
349 Ga0070682_100923568
350 Ga0070689_100384284
351 Ga0070691_10562068
352 Ga0070691_10620046
353 Ga0070661_100597326
354 Ga0070661_100754541
355 Ga0070661_101904777
356 Ga0070668_101126425
357 Ga0070669_100312165
358 Ga0070669_101046250
359 Ga0070669_101497459
360 Ga0070674_101354169
361 Ga0070688_100260129
362 Ga0070662_100605165
363 Ga0070662_100963146
364 Ga0070681_10397947
365 Ga0068867_100638057
366 Ga0070707_101086667
367 Ga0070699_100251782
368 Ga0070679_101153706
369 Ga0070684_100160693
370 Ga0068853_100995307
371 Ga0070696_101270905
372 Ga0070665_100217851
373 Ga0070664_100046738
374 Ga0068857_100015662
375 Ga0068857_100371457
376 Ga0068857_100561451
377 Ga0068859_101219067
378 Ga0068864_101295767
379 Ga0068861_101513599
380 Ga0068870_10655414
381 Ga0068862_100279064
382 Ga0068862_101182361
383 Ga0068862_101583401
384 Ga0081455_10526103
385 Ga0075363_100042543
386 Ga0075364_10362067
387 Ga0075364_10804080
388 Ga0075428_100012862
389 Ga0075428_102228156
390 Ga0075430_100028728
391 Ga0075430_100093214
392 Ga0075430_100154825
393 Ga0075430_100281683
394 Ga0075431_100034890
395 Ga0075431_100942642
396 Ga0075433_10289157
397 Ga0075433_10696743
398 Ga0075433_11846255
399 Ga0075433_11969259
400 Ga0075434_100753448
401 Ga0075434_101163285
402 Ga0075429_100091310
403 Ga0068865_100147366
404 Ga0097620_101218843
405 Ga0075435_101658870
406 Ga0105240_11521324
407 Ga0111539_10421593
408 Ga0114129_10047313
409 Ga0114129_10635361
410 Ga0105243_10536083
411 Ga0105243_10942267
412 Ga0105243_12401112
413 Ga0105241_10451462
414 Ga0105242_10030456
415 Ga0105249_10083297
416 Ga0105249_10460189
417 Ga0105249_11275191
418 Ga0105239_10956254
419 Ga0157378_10355007
420 Ga0163163_11222699
421 Ga0157380_12395086
422 Ga0182008_10856811
423 Ga0157377_10611015
424 Ga0157377_10648167
425 Ga0157377_11168965
426 Ga0207654_10105463
427 Ga0207671_10903794
428 Ga0207660_10862220
429 Ga0207649_10415149
430 Ga0207649_10537237
431 Ga0207652_10533176
432 Ga0207646_11493460
433 Ga0207681_10995382
434 Ga0207650_10007091
435 Ga0207650_10008096
436 Ga0207650_10380526
437 Ga0207650_11910687
438 Ga0207659_10996832
439 Ga0207690_11753817
440 Ga0207706_10024166
441 Ga0207706_10320039
442 Ga0207706_11197556
443 Ga0207686_10084349
444 Ga0207709_11692624
445 Ga0207670_10165399
446 Ga0207669_10995696
447 Ga0207704_10157849
448 Ga0207691_10643186
449 Ga0207689_10014485
450 Ga0207689_11610341
451 Ga0207661_10477423
452 Ga0207679_10033713
453 Ga0207679_10452467
454 Ga0207712_10145405
455 Ga0207712_10470283
456 Ga0207712_10483823
457 Ga0207658_10584979
458 Ga0207639_11001586
459 Ga0207641_10114111
460 Ga0207648_10161977
461 Ga0207648_10724724
462 Ga0207648_11149560
463 Ga0207676_10841210
464 Ga0207674_10073053
465 Ga0207674_10318931
466 Ga0207674_11747653
467 Ga0207675_100545733
468 Ga0207675_101587278
469 Ga0207698_10391632
470 Ga0209999_1039564
471 Ga0209971_1096598
472 Ga0207428_10442632
473 Ga0268266_10035327
474 Ga0268265_11045737
475 Ga0268264_11248563
476 Ga0307408_100043742
477 Ga0307408_100584419
478 Ga0307405_10822538
479 Ga0307413_10305490
480 Ga0307413_10319523
481 Ga0307413_11857099
482 Ga0307410_10024119
483 Ga0307410_10195064
484 Ga0307406_10033238
485 Ga0307407_11246871
486 Ga0307412_10164157
487 Ga0307409_100046151
488 Ga0307409_100670801
489 Ga0307409_102969599
490 Ga0307416_100026833
491 Ga0307416_100085209
492 Ga0307416_100115188
493 Ga0307416_100394506
494 Ga0307414_10025909
495 Ga0307411_10325023
496 Ga0307411_10550319
497 Ga0307415_100011908
498 Ga0395901_0187888
499 Ga0439439_0044161
500 Ga0439453_0012573
501 Ga0439453_0104427
502 Ga0451797_1265102
503 Ga0439431_0081100
504 Ga0439433_0012624
505 Ga0439441_156011
506 Ga0439443_052468
507 Ga0439445_0122860
508 Ga0439449_0046335
509 Ga0439454_022283
510 Ga0439462_0044512
511 Ga0450919_026189
512 Ga0439446_0043515
513 Ga0439434_0163183
514 Ga0439434_0211045
515 Ga0439434_0325976
516 Ga0439435_0003185
517 Ga0439435_0013967
518 Ga0439435_0016876
519 Ga0439435_0048055
520 Ga0439435_0074446
521 Ga0439444_0016064
522 Ga0439444_0026252
523 Ga0439460_0165534
524 Ga0451577_0005412
525 Ga0451577_0066463
526 Ga0453684_0267055
527 Ga0453684_0293520
528 Ga0496112_0426786
529 Ga0496113_0156124
530 Ga0501292_014024
531 Ga0501296_064829
532 Ga0501298_118039
533 Ga0501031_0093785
534 Ga0501031_0285944
535 Ga0501034_0617092
536 Ga0501034_0945687
537 Ga0501036_0005932
538 Ga0501036_0110039
539 Ga0501037_0510545
540 Ga0501038_0067601
541 Ga0501038_0243786
542 Ga0501038_0367652
543 Ga0501039_0051685
544 Ga0501039_0136749
545 Ga0501039_0216736
546 Ga0501039_1304312
547 Ga0501039_1333811
548 Ga0501040_0010300
549 Ga0501040_0961282
550 Ga0501040_1351881
551 Ga0501041_0124449
552 Ga0501041_0281888
553 Ga0501042_0222703
554 Ga0501042_1061653
555 Ga0501042_1212730
556 Ga0501043_0353499
557 Ga0501043_0884257
558 Ga0501046_0294353
559 Ga0501047_1002885
560 Ga0501048_0191460
561 Ga0501048_0631548
562 Ga0501048_0845326
563 Ga0501048_1123908
564 Ga0501048_1229980
565 Ga0501068_0305810
566 Ga0501068_0532958
567 Ga0501070_0702568
568 Ga0501071_0020890
569 Ga0501071_0023290
570 Ga0501071_0207845
571 Ga0501071_0618303
572 Ga0501071_0671326
573 Ga0501072_0101728
574 Ga0501072_0390255
575 Ga0501072_0399621
576 Ga0501072_0509617
577 Ga0501073_0050267
578 Ga0501074_0934269
579 Ga0501074_1130919
580 Ga0501075_0012466
581 Ga0501075_0102195
582 Ga0501075_0103473
583 Ga0501075_0672738
584 Ga0501075_1417345
585 Ga0501076_0072137
586 Ga0501076_0181417
587 Ga0501076_0299464
588 Ga0501076_0466475
589 Ga0501076_0660540
590 Ga0501077_0469339
591 Ga0501077_0614404
592 Ga0501202_174860
593 Ga0501217_008701
594 Ga0501217_071819
595 Ga0501235_214497
596 Ga0501239_043701
597 Ga0501221_143827
598 Ga0501225_0367132
599 Ga0501079_0030179
600 Ga0501079_0105028
601 Ga0501079_0335931
602 Ga0501079_0380194
603 Ga0501079_0438012
604 Ga0501079_0728554
605 Ga0501080_0284972
606 Ga0501080_1739927
607 Ga0501081_0041279
608 Ga0501081_0196000
609 Ga0501081_0273949
610 Ga0501083_0156993
611 Ga0501274_046621
612 Ga0501035_0417134
613 Ga0501045_0039587
614 Ga0501045_1363294
615 nmdc:mga03n38_55445_c1
616 nmdc:mga00v17_217310_c1
617 nmdc:mga00v17_716250_c1
618 nmdc:mga0yw44_15513_c1
619 nmdc:mga0k408_28732_c1
620 nmdc:mga06z11_318583_c1
621 nmdc:mga05p37_146758_c2
622 nmdc:mga05p37_962362_c1
623 nmdc:mga05p37_969879_c1
624 nmdc:mga09592_622080_c1
625 nmdc:mga0qj67_1191287_c1
626 nmdc:mga0qj67_23614_c1
627 nmdc:mga0qj67_378476_c1
628 nmdc:mga0qj67_732052_c1
629 nmdc:mga0qj67_87525_c1
630 nmdc:mga06r32_125613_c1
631 nmdc:mga06r32_863395_c1
632 nmdc:mga08y16_242463_c1
633 nmdc:mga08y16_37872_c1
634 nmdc:mga0n895_687956_c1
635 nmdc:mga0a205_209926_c1
636 nmdc:mga0a205_266532_c1
637 Ga0500555_000048
638 Ga0500589_267709
639 Ga0500645_000118
640 Ga0501084_0077692
641 Ga0501084_0106022
642 Ga0501084_0333572
643 Ga0501084_0462709
644 Ga0501084_1075700
645 Ga0590071_001208
646 Ga0590071_079855
647 Ga0590071_148065
648 Ga0590075_029211
649 Ga0590077_164687
650 Ga0501082_0065398
651 Ga0501082_0128764
652 Ga0501082_0330604
653 Ga0501082_0367356
654 Ga0501082_1359856
655 Ga0530510_0006258
656 Ga0530510_0015536

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map