F409000

General Info

Members Datasets Scaffolds Average Seq Length
327 216 323 309

Family's Representative Sequence

Representative Sequence 3300053156|Ga0500622_0000049|Ga0500622_0000049_100094_101164
Length 356
Sequence MLVEDQNFHAANKRKVGISLCYTLFFLLLRSIFASDCQLFTNYALLGSPVLPKKPSSGYFIGGVIIGLAGAICFSTKAIVVKLAYRETDVDAVTLLALRMLFSLPFFLVSAALTSSKSGNVKFTGKQWVAVAVVGILGYYVSSLLDFLGLQYISAGMERLILFIYPTLVVLMSACFFKQKIGRYQWLALLITYAGLLLAFWSEVNWSETPEEHFYLGVWLIFLCAITYALYIVGSGRLIPIVGAGKFNSYAMTFAAAAVLVHFFLASERSLFHLSGKIYVYSFIMAILSTVIPSYLVSEGIKRMGSDNAAIVGSVGPVSTILQAYIFLQEPVYPVQIVGTMLILIGVLLISKKGRS

Samples

Sample ID Description Type Environment
1 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
2 2840677318 Chitinophaga alhagiae T22 Isolate Unclassified
3 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
4 2896085136 Chitinophaga alhagiae T22 Isolate Unclassified
5 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
6 2911138879 Spirosoma sp. KUDC1026 Isolate Rhizosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
126 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
127 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
128 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
129 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
130 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
131 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
132 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
133 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
134 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
135 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
136 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
137 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
138 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
139 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
140 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
141 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
142 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
143 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
144 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
145 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
146 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
147 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
148 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
149 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
150 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
151 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
152 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
153 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
154 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
155 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
156 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
157 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
158 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
159 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
162 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
163 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
164 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
175 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
176 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
177 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
178 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
179 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
180 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
181 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
182 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
183 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
184 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
185 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
186 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
187 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
188 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
189 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
190 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
191 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
192 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
193 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
194 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
195 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
196 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
197 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
198 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
199 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
202 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
203 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
204 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
205 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
206 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
207 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
208 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
209 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
210 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
211 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
212 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
213 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
214 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
215 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
216 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.17
Metatranscriptomes 0
Isolates 1.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.03
Nodule 0
Rhizoplane 1.53
Rhizosphere 79.82
Stem 0
Stem Tuber 0
Unclassified 11.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10001505 3300003215 Bacteria 13889
2 rootH1_10020706 3300003316 Bacteria 2563
3 rootH1_10130526 3300003316 Bacteria 2989
4 rootH1_10136499 3300003316 Bacteria 1392
5 rootH2_10044354 3300003320 Unclassified 3553
6 rootH2_10088204 3300003320 Bacteria 1355
7 rootH2_10104900 3300003320 Bacteria 5798
8 rootH2_10122341 3300003320 Bacteria 4076
9 rootH2_10185509 3300003320 Bacteria 1359
10 rootH2_10227098 3300003320 Archaea 1907
11 rootL2_10004760 3300003322 Bacteria 10616
12 rootL2_10010050 3300003322 Bacteria 5737
13 rootL2_10017269 3300003322 Bacteria 9184
14 rootL2_10024635 3300003322 Bacteria 7950
15 rootL2_10265907 3300003322 Bacteria 1141
16 rootH1_10003667 3300003323 Bacteria 128566
17 rootH1_10005611 3300003316 Bacteria 17859
18 rootH1_10005611 3300003323 Bacteria 26216
19 rootH1_10019440 3300003323 Bacteria 21517
20 rootH1_10021645 3300003323 Bacteria 11788
21 rootH1_10027430 3300003316 Bacteria 7834
22 rootH1_10027430 3300003323 Bacteria 13272
23 rootH1_10056965 3300003323 Bacteria 5860
24 rootH1_10057940 3300003323 Bacteria 2715
25 rootH1_10088241 3300003323 Bacteria 16095
26 rootH1_10224653 3300003323 Unclassified 1209
27 rootH1_10337783 3300003323 Bacteria 1523
28 Ga0055531_10000206 3300003794 Bacteria 64979
29 Ga0065715_10098560 3300005293 Bacteria 3531
30 Ga0070676_10039228 3300005328 Bacteria 2738
31 Ga0070676_10041049 3300005328 Bacteria 2681
32 Ga0070670_100008875 3300005331 Bacteria 8581
33 Ga0070670_100018297 3300005331 Bacteria 6011
34 Ga0070670_100114374 3300005331 Bacteria 2326
35 Ga0070670_100405068 3300005331 Bacteria 1205
36 Ga0070677_10087241 3300005333 Bacteria 1349
37 Ga0070666_10201802 3300005335 Unclassified 1399
38 Ga0070682_100045321 3300005337 Bacteria 2725
39 Ga0070660_100298524 3300005339 Bacteria 1320
40 Ga0070661_100050268 3300005344 Bacteria 3050
41 Ga0070675_100090251 3300005354 Bacteria 2566
42 Ga0070671_100133927 3300005355 Bacteria 2088
43 Ga0070674_100011255 3300005356 Bacteria 5440
44 Ga0070659_100220760 3300005366 Bacteria 1564
45 Ga0070701_10021430 3300005438 Bacteria 3084
46 Ga0070694_100114059 3300005444 Bacteria 1929
47 Ga0070708_100429282 3300005445 Bacteria 1246
48 Ga0070681_10038618 3300005458 Bacteria 4786
49 Ga0070685_10008116 3300005466 Bacteria 5380
50 Ga0070685_10143667 3300005466 Bacteria 1505
51 Ga0070706_100128842 3300005467 Bacteria 2361
52 Ga0070707_100217231 3300005468 Unclassified 1863
53 Ga0070684_100041206 3300005535 Bacteria 3980
54 Ga0068853_100021950 3300005539 Bacteria 5325
55 Ga0068853_100119188 3300005539 Bacteria 2352
56 Ga0070672_100001841 3300005543 Bacteria 13233
57 Ga0070686_100054705 3300005544 Bacteria 2554
58 Ga0070665_100097659 3300005548 Bacteria 2942
59 Ga0070704_100023263 3300005549 Bacteria 4043
60 Ga0068855_100013458 3300005563 Bacteria 9862
61 Ga0068855_100166534 3300005563 Bacteria 2498
62 Ga0068855_100194620 3300005563 Bacteria 2285
63 Ga0070664_100015911 3300005564 Bacteria 6159
64 Ga0068857_100003072 3300005577 Bacteria 13802
65 Ga0068854_100248369 3300005578 Bacteria 1420
66 Ga0068856_100045021 3300005614 Bacteria 4343
67 Ga0068856_100045836 3300005614 Bacteria 4306
68 Ga0068852_100001764 3300005616 Bacteria 14723
69 Ga0068859_100125693 3300005617 Bacteria 2633
70 Ga0068864_100232654 3300005618 Bacteria 1705
71 Ga0068866_10001027 3300005718 Bacteria 12279
72 Ga0068861_100241782 3300005719 Bacteria 1536
73 Ga0068861_100475740 3300005719 Unclassified 1124
74 Ga0068860_100009185 3300005843 Bacteria 9826
75 Ga0068862_100013715 3300005844 Bacteria 6715
76 Ga0075364_10001129 3300006051 Bacteria 14254
77 Ga0075364_10014588 3300006051 Bacteria 4857
78 Ga0070716_100243307 3300006173 Unclassified 1221
79 Ga0075366_10308098 3300006195 Bacteria 969
80 Ga0097621_100033593 3300006237 Bacteria 4086
81 Ga0097621_100152909 3300006237 Bacteria 1979
82 Ga0075428_100167049 3300006844 Bacteria 2387
83 Ga0075430_100240539 3300006846 Bacteria 1500
84 Ga0075431_100011765 3300006847 Bacteria 8829
85 Ga0075429_100034249 3300006880 Bacteria 4412
86 Ga0068865_100262197 3300006881 Bacteria 1369
87 Ga0097620_100125698 3300006931 Bacteria 2633
88 Ga0105240_10000753 3300009093 Bacteria 59090
89 Ga0105240_10010625 3300009093 Bacteria 12934
90 Ga0105240_10020000 3300009093 Bacteria 8938
91 Ga0105240_10031950 3300009093 Bacteria 6819
92 Ga0105240_10205948 3300009093 Bacteria 2302
93 Ga0105240_10395872 3300009093 Bacteria 1557
94 Ga0105240_10471196 3300009093 Bacteria 1401
95 Ga0111539_10020892 3300009094 Bacteria 8061
96 Ga0111539_10022999 3300009094 Bacteria 7654
97 Ga0111539_10328954 3300009094 Bacteria 1779
98 Ga0105245_10038729 3300009098 Bacteria 4242
99 Ga0114129_10015093 3300009147 Bacteria 10994
100 Ga0105243_10010470 3300009148 Bacteria 7043
101 Ga0105241_10004808 3300009174 Bacteria 9951
102 Ga0105241_10062830 3300009174 Bacteria 2864
103 Ga0105241_10306409 3300009174 Bacteria 1365
104 Ga0105242_10044071 3300009176 Bacteria 3611
105 Ga0105248_10126249 3300009177 Bacteria 2886
106 Ga0105237_10000365 3300009545 Bacteria 64152
107 Ga0105237_10237886 3300009545 Bacteria 1822
108 Ga0105238_10015347 3300009551 Bacteria 7757
109 Ga0105239_10001872 3300010375 Bacteria 27549
110 Ga0105239_10081736 3300010375 Bacteria 3556
111 Ga0157371_10014609 3300013102 Bacteria 5918
112 Ga0157371_10037883 3300013102 Bacteria 3450
113 Ga0157371_10171106 3300013102 Bacteria 1552
114 Ga0157370_10020204 3300013104 Bacteria 6655
115 Ga0157370_10043954 3300013104 Bacteria 4297
116 Ga0157370_10286447 3300013104 Bacteria 1522
117 Ga0157369_10152501 3300013105 Bacteria 2442
118 Ga0157369_10937214 3300013105 Bacteria 887
119 Ga0157374_10018999 3300013296 Bacteria 6079
120 Ga0157374_10520905 3300013296 Bacteria 1195
121 Ga0157378_10013671 3300013297 Bacteria 7099
122 Ga0157372_10005542 3300013307 Bacteria 13422
123 Ga0157372_10106883 3300013307 Bacteria 3201
124 Ga0157372_10351132 3300013307 Bacteria 1718
125 Ga0157372_10378630 3300013307 Bacteria 1649
126 Ga0157375_10108596 3300013308 Bacteria 2869
127 Ga0163163_10013034 3300014325 Bacteria 7590
128 Ga0163163_10158770 3300014325 Unclassified 2306
129 Ga0157380_10000745 3300014326 Bacteria 20296
130 Ga0157380_10019354 3300014326 Bacteria 5072
131 Ga0157380_10109037 3300014326 Bacteria 2322
132 Ga0157377_10011625 3300014745 Bacteria 4399
133 Ga0157379_10073436 3300014968 Bacteria 3062
134 Ga0157376_10196397 3300014969 Bacteria 1854
135 Ga0157376_10302954 3300014969 Bacteria 1513
136 Ga0163161_10129627 3300017792 Bacteria 1901
137 Ga0209050_1001560 3300025298 Bacteria 23881
138 Ga0209257_1000007 3300025304 Bacteria 1564415
139 Ga0207697_10006337 3300025315 Bacteria 5369
140 Ga0207642_10001432 3300025899 Bacteria 7404
141 Ga0207688_10019553 3300025901 Bacteria 3692
142 Ga0207680_10168934 3300025903 Unclassified 1472
143 Ga0207684_10102941 3300025910 Bacteria 2442
144 Ga0207654_10035542 3300025911 Bacteria 2777
145 Ga0207695_10000982 3300025913 Bacteria 50708
146 Ga0207695_10026067 3300025913 Bacteria 6530
147 Ga0207695_10028107 3300025913 Bacteria 6244
148 Ga0207671_10002759 3300025914 Bacteria 18342
149 Ga0207671_10151552 3300025914 Bacteria 1791
150 Ga0207662_10011565 3300025918 Bacteria 4901
151 Ga0207657_10432258 3300025919 Unclassified 1034
152 Ga0207646_10183724 3300025922 Unclassified 1889
153 Ga0207681_10098917 3300025923 Bacteria 2099
154 Ga0207694_10035564 3300025924 Bacteria 3822
155 Ga0207650_10001164 3300025925 Bacteria 19325
156 Ga0207650_10014166 3300025925 Bacteria 5539
157 Ga0207650_10116833 3300025925 Bacteria 2072
158 Ga0207659_10052922 3300025926 Bacteria 2894
159 Ga0207687_10051885 3300025927 Bacteria 2860
160 Ga0207687_10065787 3300025927 Bacteria 2575
161 Ga0207644_10009518 3300025931 Bacteria 6383
162 Ga0207706_10098903 3300025933 Unclassified 2566
163 Ga0207686_10035849 3300025934 Bacteria 2980
164 Ga0207669_10003300 3300025937 Bacteria 6980
165 Ga0207691_10003634 3300025940 Bacteria 14963
166 Ga0207691_10139591 3300025940 Bacteria 2136
167 Ga0207679_10064106 3300025945 Bacteria 2745
168 Ga0207667_10009515 3300025949 Bacteria 11435
169 Ga0207667_10046302 3300025949 Bacteria 4605
170 Ga0207651_10008198 3300025960 Bacteria 5626
171 Ga0207677_10175733 3300026023 Bacteria 1679
172 Ga0207703_10020202 3300026035 Bacteria 5208
173 Ga0207639_10014401 3300026041 Bacteria 5562
174 Ga0207639_10290302 3300026041 Unclassified 1442
175 Ga0207639_10306962 3300026041 Unclassified 1404
176 Ga0207708_10006727 3300026075 Bacteria 8505
177 Ga0207702_10023986 3300026078 Bacteria 5062
178 Ga0207702_10065129 3300026078 Bacteria 3120
179 Ga0207641_10013799 3300026088 Bacteria 6623
180 Ga0207648_10023642 3300026089 Bacteria 5502
181 Ga0207676_10168896 3300026095 Bacteria 1904
182 Ga0207674_10004689 3300026116 Bacteria 16408
183 Ga0207674_10070735 3300026116 Bacteria 3508
184 Ga0207675_100002229 3300026118 Bacteria 19266
185 Ga0207675_100535313 3300026118 Unclassified 1169
186 Ga0207683_10005276 3300026121 Bacteria 11091
187 Ga0207698_10020301 3300026142 Bacteria 4570
188 Ga0207428_10006992 3300027907 Bacteria 10334
189 Ga0268265_10343873 3300028380 Bacteria 1359
190 Ga0268264_10001431 3300028381 Bacteria 22308
191 Ga0268264_10034169 3300028381 Bacteria 4181
192 Ga0265318_10012192 3300028577 Bacteria 3668
193 Ga0307517_10001115 3300028786 Bacteria 45308
194 Ga0265330_10010457 3300031235 Bacteria 4373
195 Ga0265332_10001790 3300031238 Bacteria 11556
196 Ga0265328_10028021 3300031239 Bacteria 2109
197 Ga0265329_10044307 3300031242 Bacteria 1422
198 Ga0265340_10021931 3300031247 Bacteria 3271
199 Ga0265331_10003027 3300031250 Bacteria 11025
200 Ga0265331_10076156 3300031250 Bacteria 1564
201 Ga0265316_10014805 3300031344 Bacteria 6846
202 Ga0307513_10130167 3300031456 Bacteria 2464
203 Ga0307513_10132769 3300031456 Bacteria 2432
204 Ga0307513_10260128 3300031456 Unclassified 1526
205 Ga0307509_10019958 3300031507 Bacteria 7621
206 Ga0307509_10053211 3300031507 Bacteria 4318
207 Ga0307509_10276102 3300031507 Bacteria 1445
208 Ga0307408_100003690 3300031548 Bacteria 10432
209 Ga0307408_100105657 3300031548 Unclassified 2153
210 Ga0307508_10023906 3300031616 Bacteria 5545
211 Ga0307508_10110005 3300031616 Bacteria 2355
212 Ga0265314_10011703 3300031711 Bacteria 7218
213 Ga0265342_10009725 3300031712 Bacteria 6736
214 Ga0307516_10179650 3300031730 Bacteria 1851
215 Ga0307412_10094329 3300031911 Unclassified 2101
216 Ga0307409_100033529 3300031995 Unclassified 3738
217 Ga0307416_100001534 3300032002 Bacteria 12624
218 Ga0307414_10023745 3300032004 Bacteria 3895
219 Ga0395900_0046459 3300037418 Bacteria 4471
220 Ga0439465_0027125 3300041413 Bacteria 1813
221 Ga0451798_0555165 3300041458 Bacteria 1550
222 Ga0451804_0963848 3300041463 Bacteria 1086
223 Ga0451851_0400526 3300041507 Bacteria 1359
224 Ga0439445_0051435 3300042004 Bacteria 1113
225 Ga0466972_0012933 3300044658 Bacteria 4192
226 Ga0453683_0013816 3300044673 Bacteria 5253
227 Ga0466964_0027773 3300044706 Bacteria 2224
228 Ga0451576_0009583 3300045051 Bacteria 11211
229 Ga0451576_0023699 3300045051 Bacteria 6641
230 Ga0495638_0000004 3300046460 Bacteria 700795
231 Ga0495638_0160726 3300046460 Bacteria 1296
232 Ga0495598_0008260 3300046537 Bacteria 2418
233 Ga0495622_0117431 3300046557 Bacteria 1216
234 Ga0495625_0151793 3300046660 Bacteria 1557
235 Ga0495686_0000025 3300047472 Bacteria 388098
236 Ga0495686_0038327 3300047472 Bacteria 3066
237 Ga0495686_0161977 3300047472 Unclassified 1306
238 Ga0496104_0475676 3300048907 Bacteria 1161
239 Ga0496110_0356222 3300048913 Bacteria 1333
240 Ga0496114_0020847 3300048917 Bacteria 5323
241 Ga0501298_004056 3300049521 Bacteria 2291
242 Ga0501031_0001881 3300049568 Bacteria 13215
243 Ga0501031_0105907 3300049568 Bacteria 1835
244 Ga0501032_0000118 3300049569 Bacteria 66260
245 Ga0501032_0001917 3300049569 Bacteria 16395
246 Ga0501033_0001938 3300049570 Bacteria 18014
247 Ga0501033_0103105 3300049570 Bacteria 2081
248 Ga0501034_0024849 3300049571 Bacteria 6095
249 Ga0501034_0115597 3300049571 Bacteria 2671
250 Ga0501034_0195865 3300049571 Bacteria 1980
251 Ga0501034_0332151 3300049571 Bacteria 1451
252 Ga0501037_0014917 3300049573 Bacteria 5715
253 Ga0501037_0018585 3300049573 Bacteria 5123
254 Ga0501037_0075818 3300049573 Bacteria 2442
255 Ga0501037_0119734 3300049573 Bacteria 1893
256 Ga0501038_0003882 3300049574 Bacteria 13896
257 Ga0501038_0006741 3300049574 Bacteria 10609
258 Ga0501039_0027765 3300049575 Bacteria 4352
259 Ga0501043_0002545 3300049579 Bacteria 15415
260 Ga0501043_0006014 3300049579 Bacteria 9758
261 Ga0501046_0001314 3300049580 Bacteria 24074
262 Ga0501047_0002250 3300049581 Bacteria 18471
263 Ga0501047_0012002 3300049581 Bacteria 8198
264 Ga0501047_0033928 3300049581 Bacteria 4926
265 Ga0501067_0000075 3300049583 Bacteria 56684
266 Ga0501067_0045245 3300049583 Bacteria 2444
267 Ga0501068_0140351 3300049584 Bacteria 1515
268 Ga0501069_0136365 3300049585 Bacteria 1406
269 Ga0501073_0000006 3300049589 Bacteria 228761
270 Ga0501073_0002326 3300049589 Bacteria 14220
271 Ga0501077_0000005 3300049593 Bacteria 120228
272 Ga0501202_003726 3300049652 Bacteria 2626
273 Ga0501202_015977 3300049652 Bacteria 1451
274 Ga0501207_000673 3300049654 Bacteria 3989
275 Ga0501207_000926 3300049654 Bacteria 3532
276 Ga0501216_007142 3300049660 Bacteria 1731
277 Ga0501217_004422 3300049661 Bacteria 2889
278 Ga0501222_005953 3300049662 Bacteria 1640
279 Ga0501223_007755 3300049663 Bacteria 2191
280 Ga0501235_022684 3300049669 Bacteria 1396
281 Ga0501242_001235 3300049674 Bacteria 2518
282 Ga0501242_004471 3300049674 Bacteria 1551
283 Ga0501257_000316 3300049686 Bacteria 9346
284 Ga0501259_000879 3300049688 Bacteria 4949
285 Ga0501221_000389 3300049704 Bacteria 6729
286 Ga0501225_0013151 3300049705 Bacteria 2318
287 Ga0501234_010608 3300049707 Bacteria 1437
288 Ga0501245_001928 3300049708 Bacteria 2736
289 Ga0501080_0000533 3300049742 Bacteria 29967
290 Ga0501080_0000767 3300049742 Bacteria 26070
291 Ga0501083_0005808 3300049744 Bacteria 8742
292 Ga0501241_003277 3300049758 Bacteria 3060
293 Ga0501264_000114 3300049761 Bacteria 12301
294 Ga0501268_014628 3300049765 Bacteria 1281
295 Ga0501279_015744 3300049775 Bacteria 1049
296 Ga0501035_0001296 3300049822 Bacteria 25823
297 Ga0501035_0036981 3300049822 Bacteria 4423
298 Ga0501044_0000916 3300049823 Bacteria 35511
299 Ga0501044_0012016 3300049823 Bacteria 9380
300 Ga0501044_0017292 3300049823 Bacteria 7735
301 Ga0501212_016700 3300049851 Unclassified 1104
302 nmdc:mga00v17_175352_c1 3300050491 Bacteria 1383
303 nmdc:mga00v17_4629_c1 3300050491 Bacteria 7177
304 nmdc:mga05p37_50737_c1 3300050507 Bacteria 5103
305 nmdc:mga09592_103103_c1 3300050508 Bacteria 2444
306 nmdc:mga0qj67_285615_c1 3300050509 Bacteria 1337
307 nmdc:mga08y16_10923_c1 3300050511 Bacteria 9537
308 nmdc:mga08y16_15724_c1 3300050511 Bacteria 7959
309 nmdc:mga08y16_324277_c1 3300050511 Bacteria 1585
310 Ga0500555_000754 3300053103 Bacteria 11896
311 Ga0500562_000271 3300053108 Bacteria 12969
312 Ga0500562_000334 3300053108 Bacteria 11304
313 Ga0500593_000777 3300053117 Bacteria 11907
314 Ga0500595_004220 3300053119 Bacteria 6498
315 Ga0500655_000194 3300053133 Bacteria 14548
316 Ga0500588_0000512 3300053146 Bacteria 6210
317 Ga0500604_0000157 3300053151 Bacteria 19961
318 Ga0500616_0000015 3300053153 Bacteria 633259
319 Ga0500616_0001885 3300053153 Bacteria 18871
320 Ga0500616_0011573 3300053153 Bacteria 5200
321 Ga0500622_0000049 3300053156 Bacteria 145793
322 Ga0500622_0000056 3300053156 Bacteria 142254
323 Ga0500627_0002260 3300053158 Bacteria 5654

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013105 Ga0157369_10937214 Ga0157369_109372141 257
2 3300049765 Ga0501268_014628 Ga0501268_014628_15_800 258
3 3300003323 rootH1_10027430 rootH1_100274303 261
4 3300006195 Ga0075366_10308098 Ga0075366_103080981 262
5 3300025919 Ga0207657_10432258 Ga0207657_104322581 262
6 3300005331 Ga0070670_100018297 Ga0070670_1000182976 264
7 3300014325 Ga0163163_10013034 Ga0163163_100130341 264
8 3300025925 Ga0207650_10001164 Ga0207650_1000116412 264
9 3300025913 Ga0207695_10000982 Ga0207695_1000098231 266
10 3300003322 rootL2_10265907 rootL2_102659071 272
11 3300003323 rootH1_10057940 rootH1_100579404 272
12 3300003320 rootH2_10227098 rootH2_102270982 273
13 3300003320 rootH2_10088204 rootH2_100882042 274
14 3300047472 Ga0495686_0038327 Ga0495686_0038327_1244_2191 279
15 3300005563 Ga0068855_100013458 Ga0068855_1000134585 280
16 3300025949 Ga0207667_10046302 Ga0207667_100463022 280
17 3300005614 Ga0068856_100045836 Ga0068856_1000458362 283
18 3300026078 Ga0207702_10065129 Ga0207702_100651293 283
19 3300049851 Ga0501212_016700 Ga0501212_016700_84_1028 284
20 3300003320 rootH2_10104900 rootH2_101049002 286
21 3300031548 Ga0307408_100105657 Ga0307408_1001056573 286
22 3300031911 Ga0307412_10094329 Ga0307412_100943292 286
23 3300031995 Ga0307409_100033529 Ga0307409_1000335294 286
24 3300032002 Ga0307416_100001534 Ga0307416_1000015344 286
25 3300013307 Ga0157372_10378630 Ga0157372_103786302 287
26 3300009174 Ga0105241_10062830 Ga0105241_100628302 288
27 3300014969 Ga0157376_10196397 Ga0157376_101963971 288
28 3300025911 Ga0207654_10035542 Ga0207654_100355422 288
29 3300049758 Ga0501241_003277 Ga0501241_003277_1763_2671 288
30 3300049585 Ga0501069_0136365 Ga0501069_0136365_497_1372 289
31 3300050511 nmdc:mga08y16_324277_c1 nmdc:mga08y16_324277_c1_35_991 289
32 3300003320 rootH2_10122341 rootH2_101223412 290
33 3300003323 rootH1_10224653 rootH1_102246531 290
34 3300005293 Ga0065715_10098560 Ga0065715_100985603 290
35 3300005466 Ga0070685_10008116 Ga0070685_100081164 290
36 3300005617 Ga0068859_100125693 Ga0068859_1001256933 290
37 3300005718 Ga0068866_10001027 Ga0068866_1000102711 290
38 3300005719 Ga0068861_100241782 Ga0068861_1002417822 290
39 3300006846 Ga0075430_100240539 Ga0075430_1002405392 290
40 3300006931 Ga0097620_100125698 Ga0097620_1001256983 290
41 3300009098 Ga0105245_10038729 Ga0105245_100387293 290
42 3300009148 Ga0105243_10010470 Ga0105243_100104706 290
43 3300009176 Ga0105242_10044071 Ga0105242_100440713 290
44 3300009177 Ga0105248_10126249 Ga0105248_101262492 290
45 3300013296 Ga0157374_10018999 Ga0157374_100189993 290
46 3300013297 Ga0157378_10013671 Ga0157378_100136716 290
47 3300014326 Ga0157380_10109037 Ga0157380_101090373 290
48 3300014968 Ga0157379_10073436 Ga0157379_100734361 290
49 3300017792 Ga0163161_10129627 Ga0163161_101296272 290
50 3300025899 Ga0207642_10001432 Ga0207642_100014324 290
51 3300025901 Ga0207688_10019553 Ga0207688_100195532 290
52 3300025918 Ga0207662_10011565 Ga0207662_100115654 290
53 3300025923 Ga0207681_10098917 Ga0207681_100989172 290
54 3300025927 Ga0207687_10065787 Ga0207687_100657872 290
55 3300025931 Ga0207644_10009518 Ga0207644_100095185 290
56 3300025933 Ga0207706_10098903 Ga0207706_100989031 290
57 3300025934 Ga0207686_10035849 Ga0207686_100358493 290
58 3300025937 Ga0207669_10003300 Ga0207669_100033002 290
59 3300025940 Ga0207691_10139591 Ga0207691_101395912 290
60 3300025960 Ga0207651_10008198 Ga0207651_100081985 290
61 3300026035 Ga0207703_10020202 Ga0207703_100202024 290
62 3300026088 Ga0207641_10013799 Ga0207641_100137996 290
63 3300026089 Ga0207648_10023642 Ga0207648_100236425 290
64 3300026118 Ga0207675_100002229 Ga0207675_10000222921 290
65 3300028381 Ga0268264_10034169 Ga0268264_100341692 290
66 3300031250 Ga0265331_10076156 Ga0265331_100761562 290
67 3300046537 Ga0495598_0008260 Ga0495598_0008260_1503_2381 290
68 3300047472 Ga0495686_0000025 Ga0495686_0000025_83256_84242 290
69 3300048913 Ga0496110_0356222 Ga0496110_0356222_304_1260 290
70 3300048917 Ga0496114_0020847 Ga0496114_0020847_88_1044 290
71 3300049569 Ga0501032_0000118 Ga0501032_0000118_40271_41218 290
72 3300049571 Ga0501034_0195865 Ga0501034_0195865_275_1222 290
73 3300049573 Ga0501037_0018585 Ga0501037_0018585_2196_3110 290
74 3300049573 Ga0501037_0119734 Ga0501037_0119734_188_1135 290
75 3300049579 Ga0501043_0002545 Ga0501043_0002545_1378_2325 290
76 3300049583 Ga0501067_0000075 Ga0501067_0000075_36855_37802 290
77 3300049589 Ga0501073_0000006 Ga0501073_0000006_92068_93015 290
78 3300049593 Ga0501077_0000005 Ga0501077_0000005_99998_100945 290
79 3300049742 Ga0501080_0000533 Ga0501080_0000533_17390_18337 290
80 3300049823 Ga0501044_0017292 Ga0501044_0017292_5878_6825 290
81 3300050509 nmdc:mga0qj67_285615_c1 nmdc:mga0qj67_285615_c1_332_1279 290
82 3300003320 rootH2_10044354 rootH2_100443543 291
83 3300005328 Ga0070676_10039228 Ga0070676_100392282 291
84 3300005355 Ga0070671_100133927 Ga0070671_1001339272 291
85 3300005356 Ga0070674_100011255 Ga0070674_1000112553 291
86 3300005438 Ga0070701_10021430 Ga0070701_100214303 291
87 3300005549 Ga0070704_100023263 Ga0070704_1000232634 291
88 3300006051 Ga0075364_10014588 Ga0075364_100145882 291
89 3300006844 Ga0075428_100167049 Ga0075428_1001670493 291
90 3300009094 Ga0111539_10020892 Ga0111539_100208929 291
91 3300025927 Ga0207687_10051885 Ga0207687_100518852 291
92 3300027907 Ga0207428_10006992 Ga0207428_100069923 291
93 3300042004 Ga0439445_0051435 Ga0439445_0051435_158_1093 291
94 3300046557 Ga0495622_0117431 Ga0495622_0117431_109_993 291
95 3300047472 Ga0495686_0161977 Ga0495686_0161977_168_1130 291
96 3300049568 Ga0501031_0105907 Ga0501031_0105907_452_1351 291
97 3300050491 nmdc:mga00v17_175352_c1 nmdc:mga00v17_175352_c1_333_1226 291
98 3300050511 nmdc:mga08y16_10923_c1 nmdc:mga08y16_10923_c1_3313_4221 291
99 3300003323 rootH1_10005611 rootH1_1000561121 292
100 3300031247 Ga0265340_10021931 Ga0265340_100219315 292
101 3300032004 Ga0307414_10023745 Ga0307414_100237452 292
102 3300049568 Ga0501031_0001881 Ga0501031_0001881_11594_12514 292
103 3300049569 Ga0501032_0001917 Ga0501032_0001917_1760_2680 292
104 3300049570 Ga0501033_0001938 Ga0501033_0001938_6382_7302 292
105 3300049571 Ga0501034_0332151 Ga0501034_0332151_148_1068 292
106 3300049573 Ga0501037_0014917 Ga0501037_0014917_1054_1974 292
107 3300049574 Ga0501038_0006741 Ga0501038_0006741_9567_10487 292
108 3300049579 Ga0501043_0006014 Ga0501043_0006014_1712_2632 292
109 3300049580 Ga0501046_0001314 Ga0501046_0001314_7329_8249 292
110 3300049581 Ga0501047_0033928 Ga0501047_0033928_1094_2014 292
111 3300049822 Ga0501035_0001296 Ga0501035_0001296_19762_20682 292
112 3300049823 Ga0501044_0000916 Ga0501044_0000916_24626_25546 292
113 iso_pu_bacteria 2739367655 2739613349 292
114 iso_pu_bacteria 2881927736 2881927808 292
115 3300003322 rootL2_10010050 rootL2_100100502 293
116 3300003323 rootH1_10003667 rootH1_1000366728 293
117 3300003323 rootH1_10056965 rootH1_100569658 293
118 3300003323 rootH1_10088241 rootH1_100882419 293
119 3300025298 Ga0209050_1001560 Ga0209050_10015606 293
120 3300031456 Ga0307513_10132769 Ga0307513_101327692 293
121 3300031548 Ga0307408_100003690 Ga0307408_1000036907 293
122 3300044706 Ga0466964_0027773 Ga0466964_0027773_80_997 293
123 3300046460 Ga0495638_0000004 Ga0495638_0000004_463391_464305 293
124 3300049571 Ga0501034_0115597 Ga0501034_0115597_317_1303 293
125 3300049573 Ga0501037_0075818 Ga0501037_0075818_1052_2038 293
126 3300049574 Ga0501038_0003882 Ga0501038_0003882_8815_9801 293
127 3300049575 Ga0501039_0027765 Ga0501039_0027765_2226_3212 293
128 3300049581 Ga0501047_0002250 Ga0501047_0002250_12766_13752 293
129 3300049581 Ga0501047_0012002 Ga0501047_0012002_3114_4100 293
130 3300049583 Ga0501067_0045245 Ga0501067_0045245_440_1426 293
131 3300049584 Ga0501068_0140351 Ga0501068_0140351_97_1083 293
132 3300049589 Ga0501073_0002326 Ga0501073_0002326_5927_6913 293
133 3300049652 Ga0501202_015977 Ga0501202_015977_390_1307 293
134 3300049742 Ga0501080_0000767 Ga0501080_0000767_18935_19921 293
135 3300049744 Ga0501083_0005808 Ga0501083_0005808_6765_7751 293
136 3300049761 Ga0501264_000114 Ga0501264_000114_10284_11201 293
137 3300049822 Ga0501035_0036981 Ga0501035_0036981_2384_3370 293
138 3300049823 Ga0501044_0012016 Ga0501044_0012016_985_1971 293
139 3300053119 Ga0500595_004220 Ga0500595_004220_2578_3564 293
140 3300053153 Ga0500616_0000015 Ga0500616_0000015_361450_362364 293
141 iso_pu_bacteria 2911138879 2911139381 293
142 3300003316 rootH1_10020706 rootH1_100207062 294
143 3300003316 rootH1_10130526 rootH1_101305263 294
144 3300005331 Ga0070670_100008875 Ga0070670_1000088758 294
145 3300005331 Ga0070670_100114374 Ga0070670_1001143742 294
146 3300005466 Ga0070685_10143667 Ga0070685_101436671 294
147 3300005539 Ga0068853_100021950 Ga0068853_1000219503 294
148 3300006051 Ga0075364_10001129 Ga0075364_100011294 294
149 3300009093 Ga0105240_10031950 Ga0105240_100319504 294
150 3300014326 Ga0157380_10019354 Ga0157380_100193545 294
151 3300025913 Ga0207695_10028107 Ga0207695_100281074 294
152 3300025925 Ga0207650_10116833 Ga0207650_101168332 294
153 3300026041 Ga0207639_10014401 Ga0207639_100144012 294
154 3300031730 Ga0307516_10179650 Ga0307516_101796502 294
155 3300050491 nmdc:mga00v17_4629_c1 nmdc:mga00v17_4629_c1_4994_5938 294
156 3300003322 rootL2_10017269 rootL2_100172691 295
157 3300003323 rootH1_10019440 rootH1_100194404 295
158 3300006847 Ga0075431_100011765 Ga0075431_1000117655 295
159 3300006880 Ga0075429_100034249 Ga0075429_1000342493 295
160 3300009094 Ga0111539_10022999 Ga0111539_100229992 295
161 3300009545 Ga0105237_10237886 Ga0105237_102378862 295
162 3300025914 Ga0207671_10151552 Ga0207671_101515522 295
163 3300028577 Ga0265318_10012192 Ga0265318_100121922 295
164 3300031235 Ga0265330_10010457 Ga0265330_100104573 295
165 3300031238 Ga0265332_10001790 Ga0265332_100017908 295
166 3300031239 Ga0265328_10028021 Ga0265328_100280213 295
167 3300031242 Ga0265329_10044307 Ga0265329_100443072 295
168 3300031250 Ga0265331_10003027 Ga0265331_1000302713 295
169 3300031344 Ga0265316_10014805 Ga0265316_100148052 295
170 3300031711 Ga0265314_10011703 Ga0265314_100117033 295
171 3300031712 Ga0265342_10009725 Ga0265342_100097252 295
172 3300041413 Ga0439465_0027125 Ga0439465_0027125_535_1509 295
173 3300046660 Ga0495625_0151793 Ga0495625_0151793_396_1316 295
174 3300049571 Ga0501034_0024849 Ga0501034_0024849_4634_5569 295
175 3300049654 Ga0501207_000926 Ga0501207_000926_2018_2965 295
176 3300049674 Ga0501242_004471 Ga0501242_004471_374_1321 295
177 3300049686 Ga0501257_000316 Ga0501257_000316_1994_2941 295
178 3300049688 Ga0501259_000879 Ga0501259_000879_3230_4177 295
179 3300050507 nmdc:mga05p37_50737_c1 nmdc:mga05p37_50737_c1_3306_4280 295
180 3300050508 nmdc:mga09592_103103_c1 nmdc:mga09592_103103_c1_373_1347 295
181 3300050511 nmdc:mga08y16_15724_c1 nmdc:mga08y16_15724_c1_322_1245 295
182 3300053133 Ga0500655_000194 Ga0500655_000194_7387_8319 295
183 iso_pu_bacteria 2910245624 2910249016 295
184 3300003320 rootH2_10185509 rootH2_101855092 296
185 3300003322 rootL2_10024635 rootL2_100246355 296
186 3300003323 rootH1_10021645 rootH1_100216456 296
187 3300003323 rootH1_10337783 rootH1_103377832 296
188 3300003794 Ga0055531_10000206 Ga0055531_1000020650 296
189 3300005719 Ga0068861_100475740 Ga0068861_1004757401 296
190 3300013102 Ga0157371_10014609 Ga0157371_100146096 296
191 3300013102 Ga0157371_10171106 Ga0157371_101711062 296
192 3300013104 Ga0157370_10286447 Ga0157370_102864472 296
193 3300013296 Ga0157374_10520905 Ga0157374_105209052 296
194 3300013307 Ga0157372_10106883 Ga0157372_101068834 296
195 3300013307 Ga0157372_10351132 Ga0157372_103511321 296
196 3300025304 Ga0209257_1000007 Ga0209257_1000007998 296
197 3300026118 Ga0207675_100535313 Ga0207675_1005353132 296
198 3300026142 Ga0207698_10020301 Ga0207698_100203014 296
199 3300041458 Ga0451798_0555165 Ga0451798_0555165_518_1444 296
200 3300041507 Ga0451851_0400526 Ga0451851_0400526_415_1341 296
201 3300053103 Ga0500555_000754 Ga0500555_000754_5666_6604 296
202 3300053108 Ga0500562_000271 Ga0500562_000271_4823_5761 296
203 3300053108 Ga0500562_000334 Ga0500562_000334_5633_6571 296
204 3300053117 Ga0500593_000777 Ga0500593_000777_4588_5526 296
205 3300053151 Ga0500604_0000157 Ga0500604_0000157_8539_9477 296
206 3300053153 Ga0500616_0011573 Ga0500616_0011573_813_1736 296
207 3300053156 Ga0500622_0000049 Ga0500622_0000049_100094_101164 296
208 3300053156 Ga0500622_0000056 Ga0500622_0000056_45189_46127 296
209 3300053158 Ga0500627_0002260 Ga0500627_0002260_2471_3409 296
210 3300003316 rootH1_10136499 rootH1_101364992 297
211 3300005333 Ga0070677_10087241 Ga0070677_100872411 297
212 3300005544 Ga0070686_100054705 Ga0070686_1000547051 297
213 3300005548 Ga0070665_100097659 Ga0070665_1000976592 297
214 3300006237 Ga0097621_100152909 Ga0097621_1001529092 297
215 3300006881 Ga0068865_100262197 Ga0068865_1002621972 297
216 3300009094 Ga0111539_10328954 Ga0111539_103289542 297
217 3300009147 Ga0114129_10015093 Ga0114129_100150936 297
218 3300014325 Ga0163163_10158770 Ga0163163_101587703 297
219 3300014745 Ga0157377_10011625 Ga0157377_100116254 297
220 3300025315 Ga0207697_10006337 Ga0207697_100063372 297
221 3300025925 Ga0207650_10014166 Ga0207650_100141663 297
222 3300025926 Ga0207659_10052922 Ga0207659_100529222 297
223 3300026023 Ga0207677_10175733 Ga0207677_101757331 297
224 3300026075 Ga0207708_10006727 Ga0207708_100067277 297
225 3300026116 Ga0207674_10070735 Ga0207674_100707352 297
226 3300028380 Ga0268265_10343873 Ga0268265_103438732 297
227 3300044673 Ga0453683_0013816 Ga0453683_0013816_1212_2144 297
228 3300045051 Ga0451576_0009583 Ga0451576_0009583_708_1637 297
229 3300045051 Ga0451576_0023699 Ga0451576_0023699_2301_3233 297
230 3300049521 Ga0501298_004056 Ga0501298_004056_1315_2250 297
231 3300049652 Ga0501202_003726 Ga0501202_003726_854_1789 297
232 3300049654 Ga0501207_000673 Ga0501207_000673_1236_2171 297
233 3300049660 Ga0501216_007142 Ga0501216_007142_767_1702 297
234 3300049661 Ga0501217_004422 Ga0501217_004422_1226_2161 297
235 3300049662 Ga0501222_005953 Ga0501222_005953_170_1105 297
236 3300049663 Ga0501223_007755 Ga0501223_007755_1223_2158 297
237 3300049669 Ga0501235_022684 Ga0501235_022684_132_1067 297
238 3300049674 Ga0501242_001235 Ga0501242_001235_604_1539 297
239 3300049704 Ga0501221_000389 Ga0501221_000389_2650_3585 297
240 3300049705 Ga0501225_0013151 Ga0501225_0013151_1349_2284 297
241 3300049707 Ga0501234_010608 Ga0501234_010608_397_1332 297
242 3300049708 Ga0501245_001928 Ga0501245_001928_1544_2479 297
243 3300049775 Ga0501279_015744 Ga0501279_015744_73_1008 297
244 iso_pu_bacteria 2840677318 2840678267 297
245 iso_pu_bacteria 2896085136 2896086084 297
246 3300005331 Ga0070670_100405068 Ga0070670_1004050682 298
247 3300005535 Ga0070684_100041206 Ga0070684_1000412065 298
248 3300005564 Ga0070664_100015911 Ga0070664_1000159115 298
249 3300009174 Ga0105241_10306409 Ga0105241_103064091 298
250 3300013102 Ga0157371_10037883 Ga0157371_100378833 298
251 3300013104 Ga0157370_10020204 Ga0157370_100202044 298
252 3300014969 Ga0157376_10302954 Ga0157376_103029542 298
253 3300025945 Ga0207679_10064106 Ga0207679_100641063 298
254 3300031507 Ga0307509_10019958 Ga0307509_100199585 298
255 3300031507 Ga0307509_10053211 Ga0307509_100532112 298
256 3300031616 Ga0307508_10023906 Ga0307508_100239064 298
257 3300046460 Ga0495638_0160726 Ga0495638_0160726_329_1270 298
258 3300053146 Ga0500588_0000512 Ga0500588_0000512_2823_3764 298
259 3300005328 Ga0070676_10041049 Ga0070676_100410491 299
260 3300005344 Ga0070661_100050268 Ga0070661_1000502683 299
261 3300005354 Ga0070675_100090251 Ga0070675_1000902512 299
262 3300005444 Ga0070694_100114059 Ga0070694_1001140593 299
263 3300005445 Ga0070708_100429282 Ga0070708_1004292822 299
264 3300005458 Ga0070681_10038618 Ga0070681_100386183 299
265 3300005467 Ga0070706_100128842 Ga0070706_1001288422 299
266 3300005468 Ga0070707_100217231 Ga0070707_1002172312 299
267 3300005563 Ga0068855_100194620 Ga0068855_1001946202 299
268 3300005578 Ga0068854_100248369 Ga0068854_1002483692 299
269 3300006237 Ga0097621_100033593 Ga0097621_1000335933 299
270 3300009093 Ga0105240_10010625 Ga0105240_1001062513 299
271 3300013308 Ga0157375_10108596 Ga0157375_101085962 299
272 3300025910 Ga0207684_10102941 Ga0207684_101029412 299
273 3300025922 Ga0207646_10183724 Ga0207646_101837243 299
274 3300026121 Ga0207683_10005276 Ga0207683_1000527611 299
275 3300031507 Ga0307509_10276102 Ga0307509_102761022 299
276 3300048907 Ga0496104_0475676 Ga0496104_0475676_212_1138 299
277 3300003322 rootL2_10004760 rootL2_1000476013 300
278 3300005337 Ga0070682_100045321 Ga0070682_1000453211 300
279 3300005339 Ga0070660_100298524 Ga0070660_1002985242 300
280 3300005366 Ga0070659_100220760 Ga0070659_1002207602 300
281 3300005563 Ga0068855_100166534 Ga0068855_1001665342 300
282 3300005614 Ga0068856_100045021 Ga0068856_1000450213 300
283 3300005616 Ga0068852_100001764 Ga0068852_1000017648 300
284 3300009551 Ga0105238_10015347 Ga0105238_100153473 300
285 3300013104 Ga0157370_10043954 Ga0157370_100439543 300
286 3300013105 Ga0157369_10152501 Ga0157369_101525011 300
287 3300013307 Ga0157372_10005542 Ga0157372_100055424 300
288 3300025924 Ga0207694_10035564 Ga0207694_100355642 300
289 3300025949 Ga0207667_10009515 Ga0207667_100095154 300
290 3300026078 Ga0207702_10023986 Ga0207702_100239864 300
291 3300005543 Ga0070672_100001841 Ga0070672_1000018414 301
292 3300005618 Ga0068864_100232654 Ga0068864_1002326542 301
293 3300006173 Ga0070716_100243307 Ga0070716_1002433071 301
294 3300025903 Ga0207680_10168934 Ga0207680_101689342 301
295 3300025940 Ga0207691_10003634 Ga0207691_100036348 301
296 3300026095 Ga0207676_10168896 Ga0207676_101688962 301
297 3300031456 Ga0307513_10260128 Ga0307513_102601283 302
298 3300005843 Ga0068860_100009185 Ga0068860_1000091854 303
299 3300009093 Ga0105240_10020000 Ga0105240_100200006 303
300 3300009093 Ga0105240_10205948 Ga0105240_102059481 303
301 3300009545 Ga0105237_10000365 Ga0105237_1000036538 303
302 3300010375 Ga0105239_10001872 Ga0105239_1000187225 303
303 3300025913 Ga0207695_10026067 Ga0207695_100260679 303
304 3300025914 Ga0207671_10002759 Ga0207671_1000275914 303
305 3300028381 Ga0268264_10001431 Ga0268264_100014319 303
306 3300028786 Ga0307517_10001115 Ga0307517_100011157 303
307 3300005335 Ga0070666_10201802 Ga0070666_102018022 304
308 3300005577 Ga0068857_100003072 Ga0068857_1000030724 304
309 3300009093 Ga0105240_10471196 Ga0105240_104711961 304
310 3300014326 Ga0157380_10000745 Ga0157380_100007455 304
311 3300026041 Ga0207639_10306962 Ga0207639_103069622 304
312 3300026116 Ga0207674_10004689 Ga0207674_100046898 304
313 3300037418 Ga0395900_0046459 Ga0395900_0046459_627_1610 304
314 3300005539 Ga0068853_100119188 Ga0068853_1001191884 305
315 3300009093 Ga0105240_10000753 Ga0105240_1000075310 305
316 3300009174 Ga0105241_10004808 Ga0105241_100048088 305
317 3300010375 Ga0105239_10081736 Ga0105239_100817361 305
318 3300026041 Ga0207639_10290302 Ga0207639_102903021 305
319 3300044658 Ga0466972_0012933 Ga0466972_0012933_1573_2559 305
320 3300009093 Ga0105240_10395872 Ga0105240_103958722 309
321 3300005844 Ga0068862_100013715 Ga0068862_1000137153 311
322 3300041463 Ga0451804_0963848 Ga0451804_0963848_33_968 311
323 3300053153 Ga0500616_0001885 Ga0500616_0001885_1268_2221 311
324 3300031616 Ga0307508_10110005 Ga0307508_101100052 312
325 3300031456 Ga0307513_10130167 Ga0307513_101301673 313
326 3300003215 JGI25153J46596_10001505 JGI25153J46596_1000150517 314
327 3300049570 Ga0501033_0103105 Ga0501033_0103105_693_1673 314

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00892

EamA

EamA-like transporter family

61

201

0.96

PF00892

EamA

EamA-like transporter family

215

352

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5i20-assembly4.cif.gz_D crystal structure of protein 0.7102 6 291
5i20-assembly1.cif.gz_A crystal structure of protein 0.7057 4 290
7b0k-assembly1.cif.gz_A membrane protein structure 0.7014 7 291
7paf-assembly1.cif.gz_D streptococcus pneumoniae choline importer licb in lipid nanodiscs 0.7011 7 291
5i20-assembly5.cif.gz_E crystal structure of protein 0.6947 6 290
ID Description Score Start End Superfamily
af_A0A0P0WMA8_96_409_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.8395 7 292 1.20.1740.10
af_Q8RY83_36_351_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.7766 1 290 1.20.1740.10
af_G4S7C7_57_179_1.10.3730.20 Mainly Alpha;Orthogonal Bundle;ProC C-terminal domain-like fold; 0.7338 209 296 1.10.3730.20
af_Q8RY83_36_351_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.7212 1 290 1.20.1740.10
af_Q20583_6_327_1.20.1740.10 Mainly Alpha;Up-down Bundle;Amino acid/polyamine transporter I;Amino acid/polyamine transporter I 0.7068 5 291 1.20.1740.10
ID Description Score Start End GO Terms
AF-A0A345DAH7-F1-model_v4 EamA domain-containing protein 0.9797 2 293 GO:0005886
AF-A0A7W3UZT8-F1-model_v4 DMT family transporter 0.9778 2 293 GO:0005886
AF-A0A4R7UP23-F1-model_v4 deleted 0.9766 2 293
AF-A0A3N1QP99-F1-model_v4 deleted 0.976 2 293
AF-A0A2R5FAC1-F1-model_v4 Multidrug DMT transporter permease 0.9737 2 294 GO:0005886

Feature Viewer

pLDDT pTM Quality
84.06 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map