F408827

General Info

Members Datasets Scaffolds Average Seq Length
327 160 654 221

Family's Representative Sequence

Representative Sequence 3300026088|Ga0207641_10782943|Ga0207641_107829431
Length 207
Sequence MQALIFDLDGTLVDTVYAHVFAWQRALIDLGSPVDGWRIHRRIGMSGGDEAEALQRRHGEVFREILPERRPLPGAIELLAALRRGGVIHGIATSGRRPEIDRSLDALDIPPDMVVVERGDVLRAKPEPDLFLACQERLGVAARDCYVVGDAVWDLLAARRAGMLSVGLLTGGYGEDELRSAGAFRVYRDAAELHESLDELGIALGPG

Samples

Sample ID Description Type Environment
1 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
4 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
5 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
6 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
7 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
8 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
9 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
10 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
11 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
12 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
13 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
14 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
15 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
16 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
17 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
18 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
19 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
20 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
23 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
24 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
25 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
26 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
27 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
28 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
29 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
30 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
31 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
32 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
35 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
39 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
40 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
49 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
72 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
74 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
75 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
76 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
77 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
78 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
79 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
80 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
81 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
82 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
83 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
84 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
85 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
86 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
87 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
88 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
89 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
90 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
91 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
94 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
95 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
96 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
97 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
98 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
99 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
100 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
101 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
102 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
103 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
104 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
105 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
106 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
107 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
108 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
109 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
110 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
111 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
112 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
113 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
114 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
115 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
116 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
117 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
118 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
119 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
120 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
121 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
122 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
124 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
125 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
126 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
132 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
134 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
135 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
136 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
137 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
138 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
139 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
140 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
141 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
142 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
143 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
144 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
145 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
146 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
147 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
150 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
151 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
152 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
153 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
154 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
155 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
156 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
157 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
158 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
159 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
160 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.59
Rhizosphere 94.8
Stem 0
Stem Tuber 0
Unclassified 3.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207641_10782943 3300026088 Bacteria 943
2 Ga0070683_100926686 3300005329 Bacteria 836
3 Ga0068868_100086432 3300005338 Bacteria 2521
4 Ga0070660_100578233 3300005339 Bacteria 938
5 Ga0070692_10012964 3300005345 Bacteria 3875
6 Ga0070705_100047423 3300005440 Bacteria 2483
7 Ga0070694_100006859 3300005444 Bacteria 6920
8 Ga0070708_100032049 3300005445 Bacteria 4555
9 Ga0070708_100111737 3300005445 Bacteria 2512
10 Ga0070708_100137896 3300005445 Bacteria 2261
11 Ga0070681_10569735 3300005458 Bacteria 1046
12 Ga0068867_100224817 3300005459 Bacteria 1514
13 Ga0070706_100000374 3300005467 Bacteria 53751
14 Ga0070706_100000641 3300005467 Bacteria 40007
15 Ga0070706_100012747 3300005467 Bacteria 7778
16 Ga0070706_100081046 3300005467 Bacteria 3006
17 Ga0070706_100088731 3300005467 Bacteria 2867
18 Ga0070706_100187768 3300005467 Bacteria 1931
19 Ga0070706_100208423 3300005467 Bacteria 1825
20 Ga0070706_100389846 3300005467 Bacteria 1297
21 Ga0070706_100946486 3300005467 Bacteria 795
22 Ga0070707_100010414 3300005468 Bacteria 8661
23 Ga0070707_100059885 3300005468 Bacteria 3652
24 Ga0070707_100061306 3300005468 Bacteria 3607
25 Ga0070707_100080498 3300005468 Bacteria 3144
26 Ga0070707_100271721 3300005468 Bacteria 1648
27 Ga0070707_100563774 3300005468 Bacteria 1101
28 Ga0070698_100004634 3300005471 Bacteria 15112
29 Ga0070698_100068101 3300005471 Bacteria 3578
30 Ga0070698_100083530 3300005471 Bacteria 3183
31 Ga0070698_100352068 3300005471 Bacteria 1404
32 Ga0070698_100498188 3300005471 Bacteria 1156
33 Ga0070698_100771871 3300005471 Bacteria 905
34 Ga0070699_100016521 3300005518 Bacteria 6336
35 Ga0070699_100032561 3300005518 Bacteria 4502
36 Ga0070699_100059579 3300005518 Bacteria 3307
37 Ga0070699_100153060 3300005518 Bacteria 2040
38 Ga0070684_100739097 3300005535 Bacteria 918
39 Ga0070697_100031451 3300005536 Bacteria 4270
40 Ga0070697_100075701 3300005536 Bacteria 2767
41 Ga0070697_100111494 3300005536 Bacteria 2280
42 Ga0070697_100273436 3300005536 Bacteria 1448
43 Ga0068853_100070048 3300005539 Bacteria 3052
44 Ga0068853_100948387 3300005539 Bacteria 827
45 Ga0070695_100009319 3300005545 Bacteria 5837
46 Ga0070696_100004417 3300005546 Bacteria 9386
47 Ga0070696_100010014 3300005546 Bacteria 6340
48 Ga0070696_100109778 3300005546 Bacteria 1985
49 Ga0070696_100667726 3300005546 Bacteria 844
50 Ga0070704_100136421 3300005549 Bacteria 1909
51 Ga0070704_100272129 3300005549 Unclassified 1400
52 Ga0070704_100520324 3300005549 Bacteria 1035
53 Ga0068855_100144058 3300005563 Bacteria 2714
54 Ga0068854_100266892 3300005578 Unclassified 1373
55 Ga0068852_100658530 3300005616 Bacteria 1055
56 Ga0068858_100440319 3300005842 Bacteria 1255
57 Ga0068860_100132956 3300005843 Bacteria 2388
58 Ga0068860_100774843 3300005843 Bacteria 972
59 Ga0081538_10069057 3300005981 Bacteria 1960
60 Ga0081539_10007688 3300005985 Bacteria 9683
61 Ga0081539_10150962 3300005985 Bacteria 1118
62 Ga0070712_100818373 3300006175 Bacteria 800
63 Ga0075431_100633335 3300006847 Bacteria 1051
64 Ga0075433_10020636 3300006852 Bacteria 5514
65 Ga0075433_10148433 3300006852 Bacteria 2085
66 Ga0068865_100687006 3300006881 Bacteria 873
67 Ga0075436_100011486 3300006914 Bacteria 6077
68 Ga0075436_100071324 3300006914 Bacteria 2402
69 Ga0075436_100257927 3300006914 Bacteria 1243
70 Ga0075435_100100782 3300007076 Bacteria 2393
71 Ga0075435_100688601 3300007076 Bacteria 888
72 Ga0099794_10014079 3300007265 Bacteria 3496
73 Ga0111539_10020189 3300009094 Bacteria 8211
74 Ga0111539_10093749 3300009094 Bacteria 3527
75 Ga0114129_10013973 3300009147 Bacteria 11439
76 Ga0114129_10202968 3300009147 Bacteria 2684
77 Ga0114129_10294440 3300009147 Bacteria 2165
78 Ga0105243_10338232 3300009148 Bacteria 1378
79 Ga0105242_10039144 3300009176 Bacteria 3815
80 Ga0105248_10194176 3300009177 Bacteria 2287
81 Ga0105249_10365401 3300009553 Bacteria 1465
82 Ga0105239_10880375 3300010375 Bacteria 1028
83 Ga0105239_11062885 3300010375 Bacteria 931
84 Ga0157369_10012410 3300013105 Bacteria 9672
85 Ga0157374_10787965 3300013296 Bacteria 966
86 Ga0163162_11272161 3300013306 Bacteria 836
87 Ga0157375_10018461 3300013308 Bacteria 6326
88 Ga0157375_10071745 3300013308 Bacteria 3478
89 Ga0163163_10677084 3300014325 Bacteria 1095
90 Ga0163163_10926245 3300014325 Bacteria 935
91 Ga0157380_10741465 3300014326 Bacteria 992
92 Ga0157377_10220589 3300014745 Bacteria 1214
93 Ga0207684_10000094 3300025910 Bacteria 165810
94 Ga0207684_10000636 3300025910 Bacteria 41641
95 Ga0207684_10022591 3300025910 Bacteria 5370
96 Ga0207684_10077898 3300025910 Unclassified 2819
97 Ga0207684_10257142 3300025910 Bacteria 1507
98 Ga0207684_10377670 3300025910 Bacteria 1219
99 Ga0207652_10085722 3300025921 Bacteria 2760
100 Ga0207646_10001048 3300025922 Bacteria 35174
101 Ga0207646_10002468 3300025922 Bacteria 21845
102 Ga0207646_10022104 3300025922 Bacteria 5866
103 Ga0207646_10024576 3300025922 Bacteria 5518
104 Ga0207646_10050489 3300025922 Bacteria 3722
105 Ga0207646_10275495 3300025922 Bacteria 1520
106 Ga0207646_10444087 3300025922 Bacteria 1170
107 Ga0207646_10508549 3300025922 Unclassified 1085
108 Ga0207690_10144108 3300025932 Bacteria 1759
109 Ga0207686_10088354 3300025934 Bacteria 2040
110 Ga0207665_10205170 3300025939 Bacteria 1438
111 Ga0207711_10232533 3300025941 Bacteria 1688
112 Ga0207661_10619131 3300025944 Bacteria 994
113 Ga0207667_10167487 3300025949 Bacteria 2259
114 Ga0207667_10609693 3300025949 Bacteria 1100
115 Ga0207651_10546993 3300025960 Bacteria 1006
116 Ga0207712_10055661 3300025961 Bacteria 2784
117 Ga0207640_10035911 3300025981 Bacteria 3106
118 Ga0207640_10272822 3300025981 Bacteria 1324
119 Ga0207703_10433008 3300026035 Bacteria 1226
120 Ga0207703_10498748 3300026035 Bacteria 1142
121 Ga0207639_10044597 3300026041 Bacteria 3335
122 Ga0207708_10172547 3300026075 Bacteria 1714
123 Ga0207702_10003894 3300026078 Bacteria 13444
124 Ga0207675_100015050 3300026118 Bacteria 7218
125 Ga0209982_1001970 3300027552 Bacteria 2842
126 Ga0209983_1018710 3300027665 Bacteria 1439
127 Ga0209588_1006174 3300027671 Bacteria 3468
128 Ga0209971_1019608 3300027682 Bacteria 1606
129 Ga0209998_10000238 3300027717 Bacteria 18495
130 Ga0209974_10000079 3300027876 Bacteria 26414
131 Ga0268264_10129235 3300028381 Bacteria 2237
132 Ga0268264_10233372 3300028381 Bacteria 1700
133 Ga0268264_10510392 3300028381 Bacteria 1174
134 Ga0268264_10642678 3300028381 Bacteria 1049
135 Ga0265337_1006929 3300028556 Unclassified 4300
136 Ga0265322_10126056 3300028654 Unclassified 730
137 Ga0265330_10004301 3300031235 Bacteria 7242
138 Ga0265316_10032355 3300031344 Unclassified 4268
139 Ga0307513_10426726 3300031456 Bacteria 1054
140 Ga0307408_100141282 3300031548 Bacteria 1890
141 Ga0265342_10129709 3300031712 Unclassified 1414
142 Ga0316576_10020359 3300031727 Bacteria 4565
143 Ga0307405_10034688 3300031731 Bacteria 3005
144 Ga0307406_10456806 3300031901 Bacteria 1026
145 Ga0307409_100054705 3300031995 Bacteria 3076
146 Ga0307409_100060869 3300031995 Bacteria 2947
147 Ga0307409_101196502 3300031995 Bacteria 783
148 Ga0307416_100001663 3300032002 Bacteria 12281
149 Ga0307416_100577383 3300032002 Bacteria 1201
150 Ga0307416_100603396 3300032002 Bacteria 1178
151 Ga0307414_10436056 3300032004 Bacteria 1146
152 Ga0307411_10535216 3300032005 Bacteria 997
153 Ga0307415_100000129 3300032126 Bacteria 32651
154 Ga0307415_100224153 3300032126 Bacteria 1509
155 Ga0307415_100224306 3300032126 Bacteria 1509
156 Ga0373933_0345137 3300035724 Unclassified 967
157 Ga0395900_0188424 3300037418 Bacteria 2093
158 Ga0395900_0202316 3300037418 Bacteria 2009
159 Ga0395898_0056014 3300037466 Bacteria 3845
160 Ga0395905_0492896 3300037471 Bacteria 1125
161 Ga0395905_0518113 3300037471 Bacteria 1093
162 Ga0395905_0776654 3300037471 Bacteria 861
163 Ga0395901_0105848 3300038443 Bacteria 2953
164 Ga0395901_0223489 3300038443 Bacteria 1968
165 Ga0395901_0440739 3300038443 Bacteria 1333
166 Ga0451853_2706071 3300041512 Bacteria 1188
167 Ga0450923_007108 3300042125 Bacteria 1880
168 Ga0450910_012391 3300042147 Bacteria 1232
169 Ga0466963_0013002 3300044694 Bacteria 5102
170 Ga0466963_0386594 3300044694 Bacteria 986
171 Ga0466964_0016098 3300044706 Bacteria 2850
172 Ga0466964_0033567 3300044706 Bacteria 2045
173 Ga0453684_0000023 3300044712 Bacteria 857153
174 Ga0466970_0240779 3300044765 Bacteria 1012
175 Ga0466957_0188103 3300044842 Bacteria 1351
176 Ga0451576_0289874 3300045051 Bacteria 1711
177 Ga0466958_0005771 3300045836 Bacteria 6691
178 Ga0466967_0015846 3300045976 Bacteria 5924
179 Ga0466967_0016767 3300045976 Bacteria 5789
180 Ga0466967_0150851 3300045976 Bacteria 2172
181 Ga0495664_0213187 3300046477 Bacteria 1170
182 Ga0495630_0090646 3300046517 Bacteria 2310
183 Ga0495652_0062669 3300046529 Bacteria 3135
184 Ga0495645_0358713 3300046543 Bacteria 937
185 Ga0495589_0257247 3300046794 Bacteria 815
186 Ga0495674_0028521 3300047319 Bacteria 5088
187 Ga0495674_0156306 3300047319 Bacteria 1910
188 Ga0496101_0109530 3300048904 Bacteria 2077
189 Ga0496101_0429357 3300048904 Bacteria 1042
190 Ga0496102_0122467 3300048905 Bacteria 2430
191 Ga0496104_0028427 3300048907 Bacteria 5182
192 Ga0496106_0631844 3300048909 Bacteria 856
193 Ga0496108_0002942 3300048911 Bacteria 13702
194 Ga0496109_0007903 3300048912 Bacteria 9014
195 Ga0496109_0239149 3300048912 Bacteria 1709
196 Ga0496110_0053758 3300048913 Bacteria 3541
197 Ga0496111_0041418 3300048914 Bacteria 3305
198 Ga0496111_0042602 3300048914 Bacteria 3260
199 Ga0496112_0029268 3300048915 Bacteria 5325
200 Ga0496112_0812230 3300048915 Bacteria 860
201 Ga0496113_0242204 3300048916 Bacteria 1439
202 Ga0496114_0108969 3300048917 Bacteria 2371
203 Ga0501031_0030666 3300049568 Bacteria 3508
204 Ga0501031_0110909 3300049568 Bacteria 1791
205 Ga0501031_0410784 3300049568 Bacteria 875
206 Ga0501031_0529422 3300049568 Bacteria 759
207 Ga0501032_0045314 3300049569 Bacteria 2975
208 Ga0501032_0226375 3300049569 Bacteria 1216
209 Ga0501034_0512489 3300049571 Bacteria 1112
210 Ga0501036_0011948 3300049572 Bacteria 7199
211 Ga0501038_0084549 3300049574 Bacteria 2669
212 Ga0501038_0566893 3300049574 Bacteria 862
213 Ga0501039_0041230 3300049575 Bacteria 3565
214 Ga0501039_0092840 3300049575 Bacteria 2352
215 Ga0501039_0182090 3300049575 Bacteria 1652
216 Ga0501039_0225795 3300049575 Bacteria 1472
217 Ga0501040_0015274 3300049576 Bacteria 5075
218 Ga0501040_0069303 3300049576 Bacteria 2433
219 Ga0501040_0084861 3300049576 Bacteria 2197
220 Ga0501040_0190901 3300049576 Bacteria 1453
221 Ga0501040_0306663 3300049576 Bacteria 1135
222 Ga0501040_0454102 3300049576 Bacteria 922
223 Ga0501041_0011029 3300049577 Bacteria 5337
224 Ga0501041_0013310 3300049577 Bacteria 4875
225 Ga0501041_0425526 3300049577 Bacteria 842
226 Ga0501042_0028092 3300049578 Bacteria 3959
227 Ga0501042_0028146 3300049578 Bacteria 3956
228 Ga0501042_0132933 3300049578 Bacteria 1793
229 Ga0501042_0476680 3300049578 Unclassified 905
230 Ga0501043_0203483 3300049579 Bacteria 1536
231 Ga0501046_0024174 3300049580 Bacteria 4988
232 Ga0501046_0184024 3300049580 Bacteria 1561
233 Ga0501048_0016250 3300049582 Bacteria 5486
234 Ga0501048_0077943 3300049582 Bacteria 2339
235 Ga0501048_0211807 3300049582 Bacteria 1374
236 Ga0501068_0015812 3300049584 Bacteria 4343
237 Ga0501068_0091700 3300049584 Bacteria 1875
238 Ga0501068_0130902 3300049584 Bacteria 1568
239 Ga0501068_0143334 3300049584 Bacteria 1498
240 Ga0501068_0166863 3300049584 Bacteria 1389
241 Ga0501068_0248367 3300049584 Bacteria 1133
242 Ga0501068_0313090 3300049584 Bacteria 1006
243 Ga0501069_0242332 3300049585 Bacteria 1051
244 Ga0501070_0076459 3300049586 Bacteria 2772
245 Ga0501070_0482745 3300049586 Bacteria 997
246 Ga0501070_0519664 3300049586 Bacteria 955
247 Ga0501071_0011968 3300049587 Bacteria 5861
248 Ga0501071_0024253 3300049587 Bacteria 4241
249 Ga0501071_0055106 3300049587 Bacteria 2870
250 Ga0501071_0145446 3300049587 Bacteria 1767
251 Ga0501071_0549312 3300049587 Bacteria 887
252 Ga0501072_0001099 3300049588 Bacteria 20101
253 Ga0501072_0013167 3300049588 Bacteria 6333
254 Ga0501072_0088165 3300049588 Bacteria 2462
255 Ga0501072_0130721 3300049588 Bacteria 2001
256 Ga0501072_0134772 3300049588 Bacteria 1969
257 Ga0501072_0360996 3300049588 Bacteria 1153
258 Ga0501073_0069233 3300049589 Bacteria 2459
259 Ga0501074_0127871 3300049590 Bacteria 1818
260 Ga0501074_0157204 3300049590 Bacteria 1624
261 Ga0501075_0008992 3300049591 Bacteria 6969
262 Ga0501075_0017693 3300049591 Bacteria 5148
263 Ga0501075_0018286 3300049591 Bacteria 5070
264 Ga0501075_0048090 3300049591 Bacteria 3205
265 Ga0501075_0081100 3300049591 Bacteria 2456
266 Ga0501075_0219782 3300049591 Bacteria 1449
267 Ga0501075_0555355 3300049591 Bacteria 876
268 Ga0501076_0002620 3300049592 Bacteria 12392
269 Ga0501076_0006685 3300049592 Bacteria 8367
270 Ga0501076_0011890 3300049592 Bacteria 6500
271 Ga0501076_0052765 3300049592 Bacteria 3221
272 Ga0501077_0012244 3300049593 Bacteria 5372
273 Ga0501077_0036821 3300049593 Bacteria 3117
274 Ga0501079_0023965 3300049741 Bacteria 4681
275 Ga0501079_0039962 3300049741 Bacteria 3619
276 Ga0501079_0054040 3300049741 Bacteria 3098
277 Ga0501079_0082578 3300049741 Bacteria 2485
278 Ga0501080_0009915 3300049742 Bacteria 8704
279 Ga0501080_0065238 3300049742 Bacteria 3387
280 Ga0501080_0108467 3300049742 Bacteria 2573
281 Ga0501080_0131767 3300049742 Bacteria 2315
282 Ga0501080_0148458 3300049742 Bacteria 2168
283 Ga0501081_0002322 3300049743 Bacteria 11979
284 Ga0501081_0041106 3300049743 Bacteria 3166
285 Ga0501081_0059536 3300049743 Bacteria 2644
286 Ga0501081_0071562 3300049743 Bacteria 2417
287 Ga0501081_0107312 3300049743 Bacteria 1980
288 Ga0501083_0012720 3300049744 Bacteria 5886
289 Ga0501083_0111758 3300049744 Bacteria 1796
290 Ga0501035_0108876 3300049822 Bacteria 2429
291 Ga0501035_0156028 3300049822 Unclassified 1978
292 Ga0501035_0407124 3300049822 Bacteria 1131
293 Ga0501044_0152595 3300049823 Bacteria 2292
294 Ga0501045_0002102 3300049824 Bacteria 13468
295 Ga0501045_0068149 3300049824 Bacteria 2613
296 Ga0501045_0073492 3300049824 Bacteria 2518
297 Ga0501045_0318547 3300049824 Bacteria 1157
298 nmdc:mga05p37_3653_c1 3300050507 Bacteria 17993
299 nmdc:mga05p37_379863_c1 3300050507 Unclassified 1656
300 nmdc:mga05p37_447819_c1 3300050507 Bacteria 1495
301 nmdc:mga05p37_773651_c1 3300050507 Bacteria 1054
302 nmdc:mga08y16_42683_c1 3300050511 Bacteria 4749
303 nmdc:mga0n895_8376_c1 3300050512 Bacteria 8950
304 nmdc:mga0rr50_115871_c1 3300050513 Bacteria 2127
305 nmdc:mga0rr50_665949_c1 3300050513 Bacteria 888
306 nmdc:mga08x19_36198_c1 3300050514 Bacteria 3125
307 nmdc:mga0a205_119547_c1 3300050515 Bacteria 2534
308 nmdc:mga0a205_334971_c1 3300050515 Bacteria 1382
309 Ga0495601_0147927 3300053077 Bacteria 1533
310 Ga0495612_0064979 3300053078 Bacteria 1515
311 Ga0501084_0011771 3300054114 Bacteria 7244
312 Ga0501084_0016032 3300054114 Bacteria 6218
313 Ga0501084_0019808 3300054114 Bacteria 5607
314 Ga0501084_0268248 3300054114 Bacteria 1441
315 Ga0501084_0292959 3300054114 Bacteria 1374
316 Ga0501082_0002238 3300060353 Bacteria 16920
317 Ga0501082_0005419 3300060353 Bacteria 11074
318 Ga0501082_0013414 3300060353 Bacteria 7045
319 Ga0501082_0016448 3300060353 Bacteria 6367
320 Ga0501082_0086085 3300060353 Bacteria 2710
321 Ga0501082_0132462 3300060353 Bacteria 2163
322 Ga0501082_0315760 3300060353 Bacteria 1361
323 Ga0530510_0012094 3300061734 Bacteria 6056
324 Ga0530510_0016984 3300061734 Bacteria 5154
325 Ga0530510_0019657 3300061734 Bacteria 4795
326 Ga0530510_0044511 3300061734 Bacteria 3207
327 Ga0530510_0217582 3300061734 Bacteria 1419
328 Ga0207641_10782943
329 Ga0070683_100926686
330 Ga0068868_100086432
331 Ga0070660_100578233
332 Ga0070692_10012964
333 Ga0070705_100047423
334 Ga0070694_100006859
335 Ga0070708_100032049
336 Ga0070708_100111737
337 Ga0070708_100137896
338 Ga0070681_10569735
339 Ga0068867_100224817
340 Ga0070706_100000374
341 Ga0070706_100000641
342 Ga0070706_100012747
343 Ga0070706_100081046
344 Ga0070706_100088731
345 Ga0070706_100187768
346 Ga0070706_100208423
347 Ga0070706_100389846
348 Ga0070706_100946486
349 Ga0070707_100010414
350 Ga0070707_100059885
351 Ga0070707_100061306
352 Ga0070707_100080498
353 Ga0070707_100271721
354 Ga0070707_100563774
355 Ga0070698_100004634
356 Ga0070698_100068101
357 Ga0070698_100083530
358 Ga0070698_100352068
359 Ga0070698_100498188
360 Ga0070698_100771871
361 Ga0070699_100016521
362 Ga0070699_100032561
363 Ga0070699_100059579
364 Ga0070699_100153060
365 Ga0070684_100739097
366 Ga0070697_100031451
367 Ga0070697_100075701
368 Ga0070697_100111494
369 Ga0070697_100273436
370 Ga0068853_100070048
371 Ga0068853_100948387
372 Ga0070695_100009319
373 Ga0070696_100004417
374 Ga0070696_100010014
375 Ga0070696_100109778
376 Ga0070696_100667726
377 Ga0070704_100136421
378 Ga0070704_100272129
379 Ga0070704_100520324
380 Ga0068855_100144058
381 Ga0068854_100266892
382 Ga0068852_100658530
383 Ga0068858_100440319
384 Ga0068860_100132956
385 Ga0068860_100774843
386 Ga0081538_10069057
387 Ga0081539_10007688
388 Ga0081539_10150962
389 Ga0070712_100818373
390 Ga0075431_100633335
391 Ga0075433_10020636
392 Ga0075433_10148433
393 Ga0068865_100687006
394 Ga0075436_100011486
395 Ga0075436_100071324
396 Ga0075436_100257927
397 Ga0075435_100100782
398 Ga0075435_100688601
399 Ga0099794_10014079
400 Ga0111539_10020189
401 Ga0111539_10093749
402 Ga0114129_10013973
403 Ga0114129_10202968
404 Ga0114129_10294440
405 Ga0105243_10338232
406 Ga0105242_10039144
407 Ga0105248_10194176
408 Ga0105249_10365401
409 Ga0105239_10880375
410 Ga0105239_11062885
411 Ga0157369_10012410
412 Ga0157374_10787965
413 Ga0163162_11272161
414 Ga0157375_10018461
415 Ga0157375_10071745
416 Ga0163163_10677084
417 Ga0163163_10926245
418 Ga0157380_10741465
419 Ga0157377_10220589
420 Ga0207684_10000094
421 Ga0207684_10000636
422 Ga0207684_10022591
423 Ga0207684_10077898
424 Ga0207684_10257142
425 Ga0207684_10377670
426 Ga0207652_10085722
427 Ga0207646_10001048
428 Ga0207646_10002468
429 Ga0207646_10022104
430 Ga0207646_10024576
431 Ga0207646_10050489
432 Ga0207646_10275495
433 Ga0207646_10444087
434 Ga0207646_10508549
435 Ga0207690_10144108
436 Ga0207686_10088354
437 Ga0207665_10205170
438 Ga0207711_10232533
439 Ga0207661_10619131
440 Ga0207667_10167487
441 Ga0207667_10609693
442 Ga0207651_10546993
443 Ga0207712_10055661
444 Ga0207640_10035911
445 Ga0207640_10272822
446 Ga0207703_10433008
447 Ga0207703_10498748
448 Ga0207639_10044597
449 Ga0207708_10172547
450 Ga0207702_10003894
451 Ga0207675_100015050
452 Ga0209982_1001970
453 Ga0209983_1018710
454 Ga0209588_1006174
455 Ga0209971_1019608
456 Ga0209998_10000238
457 Ga0209974_10000079
458 Ga0268264_10129235
459 Ga0268264_10233372
460 Ga0268264_10510392
461 Ga0268264_10642678
462 Ga0265337_1006929
463 Ga0265322_10126056
464 Ga0265330_10004301
465 Ga0265316_10032355
466 Ga0307513_10426726
467 Ga0307408_100141282
468 Ga0265342_10129709
469 Ga0316576_10020359
470 Ga0307405_10034688
471 Ga0307406_10456806
472 Ga0307409_100054705
473 Ga0307409_100060869
474 Ga0307409_101196502
475 Ga0307416_100001663
476 Ga0307416_100577383
477 Ga0307416_100603396
478 Ga0307414_10436056
479 Ga0307411_10535216
480 Ga0307415_100000129
481 Ga0307415_100224153
482 Ga0307415_100224306
483 Ga0373933_0345137
484 Ga0395900_0188424
485 Ga0395900_0202316
486 Ga0395898_0056014
487 Ga0395905_0492896
488 Ga0395905_0518113
489 Ga0395905_0776654
490 Ga0395901_0105848
491 Ga0395901_0223489
492 Ga0395901_0440739
493 Ga0451853_2706071
494 Ga0450923_007108
495 Ga0450910_012391
496 Ga0466963_0013002
497 Ga0466963_0386594
498 Ga0466964_0016098
499 Ga0466964_0033567
500 Ga0453684_0000023
501 Ga0466970_0240779
502 Ga0466957_0188103
503 Ga0451576_0289874
504 Ga0466958_0005771
505 Ga0466967_0015846
506 Ga0466967_0016767
507 Ga0466967_0150851
508 Ga0495664_0213187
509 Ga0495630_0090646
510 Ga0495652_0062669
511 Ga0495645_0358713
512 Ga0495589_0257247
513 Ga0495674_0028521
514 Ga0495674_0156306
515 Ga0496101_0109530
516 Ga0496101_0429357
517 Ga0496102_0122467
518 Ga0496104_0028427
519 Ga0496106_0631844
520 Ga0496108_0002942
521 Ga0496109_0007903
522 Ga0496109_0239149
523 Ga0496110_0053758
524 Ga0496111_0041418
525 Ga0496111_0042602
526 Ga0496112_0029268
527 Ga0496112_0812230
528 Ga0496113_0242204
529 Ga0496114_0108969
530 Ga0501031_0030666
531 Ga0501031_0110909
532 Ga0501031_0410784
533 Ga0501031_0529422
534 Ga0501032_0045314
535 Ga0501032_0226375
536 Ga0501034_0512489
537 Ga0501036_0011948
538 Ga0501038_0084549
539 Ga0501038_0566893
540 Ga0501039_0041230
541 Ga0501039_0092840
542 Ga0501039_0182090
543 Ga0501039_0225795
544 Ga0501040_0015274
545 Ga0501040_0069303
546 Ga0501040_0084861
547 Ga0501040_0190901
548 Ga0501040_0306663
549 Ga0501040_0454102
550 Ga0501041_0011029
551 Ga0501041_0013310
552 Ga0501041_0425526
553 Ga0501042_0028092
554 Ga0501042_0028146
555 Ga0501042_0132933
556 Ga0501042_0476680
557 Ga0501043_0203483
558 Ga0501046_0024174
559 Ga0501046_0184024
560 Ga0501048_0016250
561 Ga0501048_0077943
562 Ga0501048_0211807
563 Ga0501068_0015812
564 Ga0501068_0091700
565 Ga0501068_0130902
566 Ga0501068_0143334
567 Ga0501068_0166863
568 Ga0501068_0248367
569 Ga0501068_0313090
570 Ga0501069_0242332
571 Ga0501070_0076459
572 Ga0501070_0482745
573 Ga0501070_0519664
574 Ga0501071_0011968
575 Ga0501071_0024253
576 Ga0501071_0055106
577 Ga0501071_0145446
578 Ga0501071_0549312
579 Ga0501072_0001099
580 Ga0501072_0013167
581 Ga0501072_0088165
582 Ga0501072_0130721
583 Ga0501072_0134772
584 Ga0501072_0360996
585 Ga0501073_0069233
586 Ga0501074_0127871
587 Ga0501074_0157204
588 Ga0501075_0008992
589 Ga0501075_0017693
590 Ga0501075_0018286
591 Ga0501075_0048090
592 Ga0501075_0081100
593 Ga0501075_0219782
594 Ga0501075_0555355
595 Ga0501076_0002620
596 Ga0501076_0006685
597 Ga0501076_0011890
598 Ga0501076_0052765
599 Ga0501077_0012244
600 Ga0501077_0036821
601 Ga0501079_0023965
602 Ga0501079_0039962
603 Ga0501079_0054040
604 Ga0501079_0082578
605 Ga0501080_0009915
606 Ga0501080_0065238
607 Ga0501080_0108467
608 Ga0501080_0131767
609 Ga0501080_0148458
610 Ga0501081_0002322
611 Ga0501081_0041106
612 Ga0501081_0059536
613 Ga0501081_0071562
614 Ga0501081_0107312
615 Ga0501083_0012720
616 Ga0501083_0111758
617 Ga0501035_0108876
618 Ga0501035_0156028
619 Ga0501035_0407124
620 Ga0501044_0152595
621 Ga0501045_0002102
622 Ga0501045_0068149
623 Ga0501045_0073492
624 Ga0501045_0318547
625 nmdc:mga05p37_3653_c1
626 nmdc:mga05p37_379863_c1
627 nmdc:mga05p37_447819_c1
628 nmdc:mga05p37_773651_c1
629 nmdc:mga08y16_42683_c1
630 nmdc:mga0n895_8376_c1
631 nmdc:mga0rr50_115871_c1
632 nmdc:mga0rr50_665949_c1
633 nmdc:mga08x19_36198_c1
634 nmdc:mga0a205_119547_c1
635 nmdc:mga0a205_334971_c1
636 Ga0495601_0147927
637 Ga0495612_0064979
638 Ga0501084_0011771
639 Ga0501084_0016032
640 Ga0501084_0019808
641 Ga0501084_0268248
642 Ga0501084_0292959
643 Ga0501082_0002238
644 Ga0501082_0005419
645 Ga0501082_0013414
646 Ga0501082_0016448
647 Ga0501082_0086085
648 Ga0501082_0132462
649 Ga0501082_0315760
650 Ga0530510_0012094
651 Ga0530510_0016984
652 Ga0530510_0019657
653 Ga0530510_0044511
654 Ga0530510_0217582

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

4

168

0.89

PF13242

Hydrolase_like

HAD-hyrolase-like

122

199

0.88

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

1

162

0.86

PF12710

HAD

haloacid dehalogenase-like hydrolase

4

159

0.68

Structural Annotation

Top 5 Hits

ID Description Score Start End
3s6j-assembly2.cif.gz_F the crystal structure of a hydrolase from pseudomonas syringae 0.9084 1 216
3s6j-assembly1.cif.gz_A the crystal structure of a hydrolase from pseudomonas syringae 0.9067 2 216
3s6j-assembly3.cif.gz_D the crystal structure of a hydrolase from pseudomonas syringae 0.9056 1 216
3s6j-assembly2.cif.gz_B the crystal structure of a hydrolase from pseudomonas syringae 0.904 1 216
3s6j-assembly2.cif.gz_F the crystal structure of a hydrolase from pseudomonas syringae 0.8967 1 216
ID Description Score Start End Superfamily
3s6jB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9525 86 216 3.40.50.1000
af_I1K4I3_171_289_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9026 88 203 3.40.50.1000
4eenA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9004 86 217 3.40.50.1000
3qu4E01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.8939 87 215 3.40.50.1000
af_A0A0R0KYK9_29_156_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.892 95 218 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A524PX28-F1-model_v4 HAD family hydrolase 0.9898 82 217 GO:0005829
GO:0006281
GO:0008967
AF-A0A538ML31-F1-model_v4 HAD family hydrolase 0.9554 2 217 GO:0005829
GO:0006281
GO:0008967
AF-A0A524PX28-F1-model_v4 HAD family hydrolase 0.955 82 217 GO:0005829
GO:0006281
GO:0008967
AF-A0A2V7F369-F1-model_v4 HAD family hydrolase 0.9451 1 217 GO:0005829
GO:0006281
GO:0008967
AF-A0A538LJE9-F1-model_v4 HAD family hydrolase 0.9445 2 218 GO:0005829
GO:0006281
GO:0008967

Map