F408700

General Info

Members Datasets Scaffolds Average Seq Length
327 171 654 286

Family's Representative Sequence

Representative Sequence 3300005841|Ga0068863_100376599|Ga0068863_1003765992
Length 307
Sequence MYRPNRNPPCFVRRQTGVVDRLMQPQFTKFHGLGNDYLVLEAQQLADVENLGEFARRICNRHYGAGGDGIAIIGKLTSDEADFSCRIFNPDGSEAGLSGNGTRCAVAYLYYKGLWSKEELVLSTKTGLKRYFLRGQPAPGKFLFESELGQPKFDTQSIPMSITPPLEKVVGYPLVVNGESFPVTAMQMGNPNCCIFVDDFDALNWRAIGKAIEVHPQFPDRTNVVFVRPVERSLIELRIWERGVGETTASGTCSCAGAVAAMVNERADRDVRVVMEGGEVRIRWRPDDQVVITGTAEVVYSGEWLQN

Samples

Sample ID Description Type Environment
1 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
61 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
129 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
130 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
131 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
132 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
137 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
138 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
139 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
140 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
141 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
142 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
143 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
144 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
145 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
146 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
147 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
148 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
149 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
152 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
153 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
154 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
155 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
156 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
157 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
158 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
159 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
160 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
161 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
162 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
163 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
164 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
165 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
166 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
167 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
168 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
169 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
170 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
171 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.14
Rhizosphere 97.55
Stem 0
Stem Tuber 0
Unclassified 25.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068863_100376599 3300005841 Unclassified 1386
2 Ga0065712_10004854 3300005290 Bacteria 4742
3 Ga0065712_10067731 3300005290 Bacteria 133054
4 Ga0065712_10081875 3300005290 Bacteria 2967
5 Ga0065715_10001584 3300005293 Bacteria 9747
6 Ga0065715_10089934 3300005293 Bacteria 8089
7 Ga0065715_10092887 3300005293 Unclassified 4888
8 Ga0065715_10128923 3300005293 Bacteria 2028
9 Ga0065707_10000755 3300005295 Bacteria 11843
10 Ga0065707_10115974 3300005295 Bacteria 2251
11 Ga0070690_100017365 3300005330 Bacteria 4325
12 Ga0070670_100030421 3300005331 Unclassified 4650
13 Ga0070670_100372592 3300005331 Unclassified 1257
14 Ga0068869_100012375 3300005334 Bacteria 5638
15 Ga0068869_100028068 3300005334 Unclassified 3929
16 Ga0068869_100045657 3300005334 Bacteria 3155
17 Ga0068869_100062126 3300005334 Bacteria 2741
18 Ga0068869_100096321 3300005334 Unclassified 2233
19 Ga0068869_100177782 3300005334 Bacteria 1667
20 Ga0070666_10021620 3300005335 Bacteria 4170
21 Ga0070680_100129527 3300005336 Unclassified 2110
22 Ga0070682_100009530 3300005337 Bacteria 5496
23 Ga0068868_100015626 3300005338 Bacteria 5621
24 Ga0068868_100315320 3300005338 Bacteria 1331
25 Ga0068868_100381430 3300005338 Bacteria 1213
26 Ga0070689_100010827 3300005340 Bacteria 6518
27 Ga0070689_100065754 3300005340 Bacteria 2825
28 Ga0070692_10040935 3300005345 Bacteria 2372
29 Ga0070675_100131797 3300005354 Bacteria 2131
30 Ga0070675_100136623 3300005354 Bacteria 2092
31 Ga0070671_100000433 3300005355 Bacteria 29121
32 Ga0070673_100042627 3300005364 Bacteria 3500
33 Ga0070673_100082815 3300005364 Bacteria 2605
34 Ga0070701_10072361 3300005438 Unclassified 1846
35 Ga0070701_10098115 3300005438 Bacteria 1618
36 Ga0070705_100009332 3300005440 Bacteria 4874
37 Ga0070705_100260776 3300005440 Unclassified 1222
38 Ga0070700_100000120 3300005441 Bacteria 48358
39 Ga0070700_100070554 3300005441 Unclassified 2228
40 Ga0070700_100129012 3300005441 Bacteria 1704
41 Ga0070694_100016862 3300005444 Unclassified 4606
42 Ga0070694_100043896 3300005444 Unclassified 2991
43 Ga0070694_100305270 3300005444 Bacteria 1221
44 Ga0070708_100302589 3300005445 Bacteria 1506
45 Ga0070662_100289495 3300005457 Unclassified 1328
46 Ga0070681_10009669 3300005458 Bacteria 9486
47 Ga0068867_100021090 3300005459 Bacteria 4646
48 Ga0068867_100066815 3300005459 Unclassified 2679
49 Ga0070685_10007706 3300005466 Bacteria 5509
50 Ga0070706_100000017 3300005467 Bacteria 172828
51 Ga0070707_100000304 3300005468 Bacteria 48115
52 Ga0070707_100018365 3300005468 Bacteria 6580
53 Ga0070698_100011596 3300005471 Bacteria 9355
54 Ga0070698_100016028 3300005471 Bacteria 7914
55 Ga0070698_100038449 3300005471 Bacteria 4930
56 Ga0070698_100572510 3300005471 Unclassified 1069
57 Ga0070699_100003916 3300005518 Bacteria 13147
58 Ga0070699_100032064 3300005518 Unclassified 4537
59 Ga0070699_100374275 3300005518 Bacteria 1285
60 Ga0070697_100062215 3300005536 Unclassified 3046
61 Ga0068853_100555499 3300005539 Unclassified 1088
62 Ga0070695_100009272 3300005545 Bacteria 5850
63 Ga0070695_100177503 3300005545 Bacteria 1507
64 Ga0070696_100009270 3300005546 Bacteria 6589
65 Ga0070696_100052327 3300005546 Unclassified 2841
66 Ga0070696_100066411 3300005546 Bacteria 2529
67 Ga0070696_100119262 3300005546 Unclassified 1908
68 Ga0070696_100248351 3300005546 Bacteria 1345
69 Ga0070693_100000864 3300005547 Bacteria 13512
70 Ga0070693_100009822 3300005547 Bacteria 4773
71 Ga0070693_100132418 3300005547 Bacteria 1560
72 Ga0070693_100153382 3300005547 Unclassified 1461
73 Ga0070665_100137425 3300005548 Bacteria 2447
74 Ga0070704_100002794 3300005549 Bacteria 9877
75 Ga0070664_100177176 3300005564 Unclassified 1893
76 Ga0068857_100074462 3300005577 Bacteria 3025
77 Ga0068857_100274926 3300005577 Unclassified 1548
78 Ga0068854_100028770 3300005578 Bacteria 3843
79 Ga0070702_100008691 3300005615 Unclassified 4932
80 Ga0070702_100009867 3300005615 Bacteria 4687
81 Ga0070702_100026386 3300005615 Unclassified 3121
82 Ga0070702_100093961 3300005615 Unclassified 1825
83 Ga0068852_100486602 3300005616 Bacteria 1227
84 Ga0068859_100007896 3300005617 Bacteria 10797
85 Ga0068859_100041253 3300005617 Unclassified 4636
86 Ga0068859_100049303 3300005617 Bacteria 4229
87 Ga0068859_100102559 3300005617 Bacteria 2918
88 Ga0068864_100018699 3300005618 Bacteria 5790
89 Ga0068864_100051046 3300005618 Unclassified 3561
90 Ga0068864_100101394 3300005618 Bacteria 2553
91 Ga0068861_100001040 3300005719 Bacteria 17027
92 Ga0068851_10081833 3300005834 Bacteria 1687
93 Ga0068870_10130993 3300005840 Unclassified 1457
94 Ga0068863_100137985 3300005841 Unclassified 2330
95 Ga0068863_100180422 3300005841 Unclassified 2026
96 Ga0068863_100804806 3300005841 Unclassified 937
97 Ga0068858_100069238 3300005842 Bacteria 3271
98 Ga0068858_100440690 3300005842 Unclassified 1254
99 Ga0068860_100095619 3300005843 Bacteria 2832
100 Ga0068862_100252925 3300005844 Unclassified 1606
101 Ga0081539_10000408 3300005985 Bacteria 91634
102 Ga0081539_10003555 3300005985 Bacteria 18928
103 Ga0097621_100019218 3300006237 Bacteria 5240
104 Ga0068871_100006151 3300006358 Bacteria 8459
105 Ga0068871_100019992 3300006358 Bacteria 5122
106 Ga0075428_100182447 3300006844 Bacteria 2271
107 Ga0075428_100187313 3300006844 Bacteria 2239
108 Ga0075430_100065959 3300006846 Bacteria 3040
109 Ga0075431_100045219 3300006847 Unclassified 4539
110 Ga0075431_100282432 3300006847 Bacteria 1681
111 Ga0075433_10072960 3300006852 Unclassified 3018
112 Ga0075433_10112469 3300006852 Unclassified 2415
113 Ga0075433_10283987 3300006852 Bacteria 1466
114 Ga0075434_100042230 3300006871 Unclassified 4520
115 Ga0075434_100084369 3300006871 Bacteria 3175
116 Ga0075434_100295615 3300006871 Bacteria 1639
117 Ga0068865_100056301 3300006881 Bacteria 2739
118 Ga0097620_100007897 3300006931 Bacteria 10797
119 Ga0097620_100041254 3300006931 Unclassified 4636
120 Ga0097620_100049299 3300006931 Bacteria 4229
121 Ga0097620_100102556 3300006931 Bacteria 2918
122 Ga0097620_100250168 3300006931 Bacteria 1863
123 Ga0105240_10090570 3300009093 Unclassified 3738
124 Ga0105240_10135156 3300009093 Bacteria 2953
125 Ga0111539_10016677 3300009094 Bacteria 9103
126 Ga0111539_10022310 3300009094 Bacteria 7780
127 Ga0111539_10063897 3300009094 Bacteria 4356
128 Ga0111539_10181869 3300009094 Bacteria 2455
129 Ga0105245_10730638 3300009098 Unclassified 1025
130 Ga0105247_10011610 3300009101 Bacteria 5307
131 Ga0105247_10395940 3300009101 Bacteria 983
132 Ga0105247_10396130 3300009101 Unclassified 983
133 Ga0114129_10037807 3300009147 Bacteria 6813
134 Ga0114129_10056548 3300009147 Bacteria 5494
135 Ga0114129_10068778 3300009147 Bacteria 4937
136 Ga0114129_10097645 3300009147 Bacteria 4067
137 Ga0114129_10623387 3300009147 Unclassified 1395
138 Ga0105243_10006160 3300009148 Bacteria 9274
139 Ga0105243_10059448 3300009148 Unclassified 3051
140 Ga0105241_10046585 3300009174 Unclassified 3293
141 Ga0105241_10412872 3300009174 Bacteria 1186
142 Ga0105242_10004694 3300009176 Bacteria 10579
143 Ga0105242_10082744 3300009176 Bacteria 2687
144 Ga0105242_10111358 3300009176 Bacteria 2334
145 Ga0105242_10531683 3300009176 Unclassified 1124
146 Ga0105248_10001077 3300009177 Bacteria 30152
147 Ga0105248_10005549 3300009177 Bacteria 13861
148 Ga0105248_10015293 3300009177 Bacteria 8461
149 Ga0105248_10202752 3300009177 Bacteria 2235
150 Ga0105248_10447249 3300009177 Bacteria 1456
151 Ga0105237_10001454 3300009545 Bacteria 31247
152 Ga0105237_10832869 3300009545 Bacteria 929
153 Ga0105238_10117935 3300009551 Viruses 2634
154 Ga0105249_10012075 3300009553 Bacteria 7605
155 Ga0105249_10041284 3300009553 Bacteria 4193
156 Ga0105246_10087921 3300011119 Unclassified 2232
157 Ga0105246_10454536 3300011119 Unclassified 1077
158 Ga0157373_10010366 3300013100 Bacteria 6860
159 Ga0157373_10012566 3300013100 Bacteria 6224
160 Ga0157374_10019174 3300013296 Bacteria 6052
161 Ga0157374_10127432 3300013296 Bacteria 2461
162 Ga0157378_10011186 3300013297 Bacteria 7851
163 Ga0157378_10015585 3300013297 Bacteria 6656
164 Ga0157378_10173207 3300013297 Bacteria 2025
165 Ga0163162_10001385 3300013306 Bacteria 22571
166 Ga0163162_10057871 3300013306 Unclassified 3904
167 Ga0163162_10191336 3300013306 Bacteria 2174
168 Ga0163162_10408141 3300013306 Bacteria 1491
169 Ga0163162_10498749 3300013306 Unclassified 1348
170 Ga0157372_10041694 3300013307 Bacteria 5074
171 Ga0157375_10045110 3300013308 Bacteria 4289
172 Ga0157375_10409963 3300013308 Bacteria 1521
173 Ga0157375_10950020 3300013308 Unclassified 1001
174 Ga0163163_10002348 3300014325 Bacteria 16018
175 Ga0163163_10005449 3300014325 Bacteria 11001
176 Ga0163163_10015991 3300014325 Bacteria 6954
177 Ga0163163_10043982 3300014325 Bacteria 4380
178 Ga0163163_10054653 3300014325 Bacteria 3945
179 Ga0163163_10094682 3300014325 Bacteria 3005
180 Ga0163163_10144065 3300014325 Bacteria 2426
181 Ga0163163_10343781 3300014325 Bacteria 1547
182 Ga0157380_10098469 3300014326 Bacteria 2430
183 Ga0157380_10294846 3300014326 Unclassified 1491
184 Ga0157380_10305964 3300014326 Unclassified 1466
185 Ga0157377_10002296 3300014745 Bacteria 8412
186 Ga0157379_10156912 3300014968 Bacteria 2053
187 Ga0157379_10236996 3300014968 Bacteria 1654
188 Ga0157376_10087956 3300014969 Bacteria 2682
189 Ga0163161_10007235 3300017792 Bacteria 7670
190 Ga0207697_10017579 3300025315 Bacteria 2938
191 Ga0207653_10002096 3300025885 Bacteria 6357
192 Ga0207642_10003524 3300025899 Bacteria 4954
193 Ga0207710_10003871 3300025900 Bacteria 6615
194 Ga0207710_10024672 3300025900 Bacteria 2591
195 Ga0207680_10024026 3300025903 Bacteria 3338
196 Ga0207647_10005806 3300025904 Bacteria 9001
197 Ga0207647_10081219 3300025904 Bacteria 1943
198 Ga0207643_10035859 3300025908 Unclassified 2782
199 Ga0207684_10000079 3300025910 Bacteria 179842
200 Ga0207654_10061649 3300025911 Unclassified 2195
201 Ga0207707_10010741 3300025912 Bacteria 7955
202 Ga0207707_10418517 3300025912 Bacteria 1149
203 Ga0207695_10033755 3300025913 Bacteria 5575
204 Ga0207671_10001103 3300025914 Bacteria 32557
205 Ga0207662_10164531 3300025918 Unclassified 1419
206 Ga0207646_10000870 3300025922 Bacteria 38972
207 Ga0207646_10015001 3300025922 Bacteria 7335
208 Ga0207681_10027012 3300025923 Bacteria 3708
209 Ga0207694_10181001 3300025924 Bacteria 1709
210 Ga0207650_10020208 3300025925 Unclassified 4694
211 Ga0207650_10081461 3300025925 Unclassified 2455
212 Ga0207687_10049295 3300025927 Bacteria 2928
213 Ga0207644_10002043 3300025931 Bacteria 13070
214 Ga0207644_10059226 3300025931 Bacteria 2770
215 Ga0207706_10010899 3300025933 Bacteria 8295
216 Ga0207706_10279665 3300025933 Unclassified 1455
217 Ga0207686_10019132 3300025934 Bacteria 3889
218 Ga0207709_10002884 3300025935 Bacteria 10519
219 Ga0207670_10005174 3300025936 Bacteria 7130
220 Ga0207670_10048497 3300025936 Bacteria 2835
221 Ga0207665_10217380 3300025939 Bacteria 1399
222 Ga0207711_10002136 3300025941 Bacteria 17815
223 Ga0207711_10054379 3300025941 Bacteria 3435
224 Ga0207711_10208545 3300025941 Unclassified 1785
225 Ga0207711_10279992 3300025941 Bacteria 1536
226 Ga0207689_10002367 3300025942 Bacteria 17605
227 Ga0207689_10003629 3300025942 Bacteria 14109
228 Ga0207689_10007658 3300025942 Bacteria 9459
229 Ga0207689_10019391 3300025942 Bacteria 5733
230 Ga0207689_10057576 3300025942 Unclassified 3197
231 Ga0207689_10061871 3300025942 Bacteria 3079
232 Ga0207689_10063795 3300025942 Unclassified 3031
233 Ga0207689_10123250 3300025942 Unclassified 2132
234 Ga0207689_10336346 3300025942 Bacteria 1254
235 Ga0207679_10142547 3300025945 Bacteria 1939
236 Ga0207651_10119892 3300025960 Bacteria 1993
237 Ga0207651_10220373 3300025960 Bacteria 1533
238 Ga0207712_10048039 3300025961 Bacteria 2967
239 Ga0207640_10256688 3300025981 Bacteria 1360
240 Ga0207703_10163323 3300026035 Unclassified 1952
241 Ga0207703_10498992 3300026035 Bacteria 1142
242 Ga0207708_10000196 3300026075 Bacteria 47880
243 Ga0207708_10039909 3300026075 Unclassified 3578
244 Ga0207708_10056754 3300026075 Bacteria 2987
245 Ga0207708_10141390 3300026075 Bacteria 1888
246 Ga0207641_10044338 3300026088 Bacteria 3740
247 Ga0207641_10122510 3300026088 Unclassified 2323
248 Ga0207641_10137647 3300026088 Unclassified 2199
249 Ga0207648_10041047 3300026089 Bacteria 4064
250 Ga0207648_10210674 3300026089 Bacteria 1725
251 Ga0207676_10006569 3300026095 Bacteria 8222
252 Ga0207676_10008014 3300026095 Bacteria 7508
253 Ga0207676_10043917 3300026095 Bacteria 3444
254 Ga0207675_100002638 3300026118 Bacteria 17700
255 Ga0207675_100013490 3300026118 Bacteria 7624
256 Ga0207683_10037694 3300026121 Bacteria 4210
257 Ga0207698_10078753 3300026142 Bacteria 2648
258 Ga0207698_10443081 3300026142 Unclassified 1252
259 Ga0207428_10007799 3300027907 Bacteria 9744
260 Ga0268265_10512597 3300028380 Unclassified 1132
261 Ga0268264_10077145 3300028381 Bacteria 2837
262 Ga0307513_10142452 3300031456 Bacteria 2321
263 Ga0307408_100007302 3300031548 Bacteria 7309
264 Ga0307408_100060815 3300031548 Unclassified 2755
265 Ga0307405_10070586 3300031731 Bacteria 2244
266 Ga0307405_10232391 3300031731 Bacteria 1360
267 Ga0307413_10023340 3300031824 Bacteria 3352
268 Ga0307410_10018473 3300031852 Bacteria 4214
269 Ga0307406_10000966 3300031901 Bacteria 16055
270 Ga0307412_10006552 3300031911 Bacteria 6592
271 Ga0307416_100008159 3300032002 Bacteria 6730
272 Ga0307416_100093287 3300032002 Bacteria 2593
273 Ga0307414_10005124 3300032004 Bacteria 7187
274 Ga0307414_10401970 3300032004 Bacteria 1190
275 Ga0307411_10015974 3300032005 Bacteria 4237
276 Ga0307415_100001938 3300032126 Bacteria 10188
277 Ga0373942_0009190 3300035207 Bacteria 2310
278 Ga0395900_0124329 3300037418 Unclassified 2646
279 Ga0395898_0246132 3300037466 Bacteria 1705
280 Ga0395901_0136785 3300038443 Bacteria 2575
281 Ga0395901_0233749 3300038443 Unclassified 1919
282 Ga0439464_0011411 3300042439 Bacteria 2355
283 Ga0451577_0121410 3300042876 Unclassified 2341
284 Ga0453683_0050720 3300044673 Bacteria 2600
285 Ga0453684_0855708 3300044712 Unclassified 977
286 Ga0451576_0082699 3300045051 Unclassified 3339
287 Ga0495636_0027472 3300047318 Bacteria 2318
288 Ga0496102_0375927 3300048905 Unclassified 1337
289 Ga0496103_0077812 3300048906 Bacteria 2083
290 Ga0496108_0117600 3300048911 Bacteria 2278
291 Ga0496112_0155946 3300048915 Bacteria 2250
292 Ga0496112_0309543 3300048915 Bacteria 1525
293 Ga0496112_0417336 3300048915 Bacteria 1281
294 Ga0496112_0626162 3300048915 Bacteria 1007
295 Ga0501291_001727 3300049514 Bacteria 2551
296 Ga0501294_007441 3300049517 Unclassified 1058
297 Ga0501298_001956 3300049521 Unclassified 3074
298 Ga0501198_019185 3300049649 Bacteria 1076
299 Ga0501217_019540 3300049661 Unclassified 1583
300 Ga0501223_001388 3300049663 Bacteria 5590
301 Ga0501223_004965 3300049663 Bacteria 2815
302 Ga0501227_001314 3300049665 Bacteria 5571
303 Ga0501233_001217 3300049668 Bacteria 4383
304 Ga0501235_000996 3300049669 Bacteria 5870
305 Ga0501235_002574 3300049669 Unclassified 3902
306 Ga0501235_028118 3300049669 Unclassified 1263
307 Ga0501225_0002991 3300049705 Bacteria 5166
308 Ga0501225_0009952 3300049705 Bacteria 2700
309 Ga0501234_000906 3300049707 Bacteria 4686
310 Ga0501273_012225 3300049770 Bacteria 1079
311 Ga0501283_001156 3300049779 Unclassified 3473
312 Ga0501226_000244 3300049853 Bacteria 8370
313 nmdc:mga05p37_21641_c3 3300050507 Bacteria 3433
314 nmdc:mga05p37_406609_c2 3300050507 Bacteria 1270
315 nmdc:mga05p37_412858_c1 3300050507 Bacteria 1573
316 nmdc:mga05p37_447606_c1 3300050507 Bacteria 1496
317 nmdc:mga06r32_115252_c1 3300050510 Bacteria 2646
318 nmdc:mga08y16_21204_c1 3300050511 Bacteria 6861
319 nmdc:mga08y16_241775_c1 3300050511 Unclassified 1866
320 nmdc:mga08y16_319710_c1 3300050511 Bacteria 1598
321 nmdc:mga08y16_8816_c1 3300050511 Bacteria 10585
322 nmdc:mga0n895_165307_c1 3300050512 Bacteria 2244
323 nmdc:mga0n895_29664_c1 3300050512 Bacteria 5220
324 nmdc:mga0rr50_128122_c1 3300050513 Bacteria 2029
325 nmdc:mga0a205_152404_c1 3300050515 Bacteria 2210
326 nmdc:mga0a205_535761_c1 3300050515 Unclassified 1027
327 Ga0530510_0005449 3300061734 Bacteria 8806
328 Ga0068863_100376599
329 Ga0065712_10004854
330 Ga0065712_10067731
331 Ga0065712_10081875
332 Ga0065715_10001584
333 Ga0065715_10089934
334 Ga0065715_10092887
335 Ga0065715_10128923
336 Ga0065707_10000755
337 Ga0065707_10115974
338 Ga0070690_100017365
339 Ga0070670_100030421
340 Ga0070670_100372592
341 Ga0068869_100012375
342 Ga0068869_100028068
343 Ga0068869_100045657
344 Ga0068869_100062126
345 Ga0068869_100096321
346 Ga0068869_100177782
347 Ga0070666_10021620
348 Ga0070680_100129527
349 Ga0070682_100009530
350 Ga0068868_100015626
351 Ga0068868_100315320
352 Ga0068868_100381430
353 Ga0070689_100010827
354 Ga0070689_100065754
355 Ga0070692_10040935
356 Ga0070675_100131797
357 Ga0070675_100136623
358 Ga0070671_100000433
359 Ga0070673_100042627
360 Ga0070673_100082815
361 Ga0070701_10072361
362 Ga0070701_10098115
363 Ga0070705_100009332
364 Ga0070705_100260776
365 Ga0070700_100000120
366 Ga0070700_100070554
367 Ga0070700_100129012
368 Ga0070694_100016862
369 Ga0070694_100043896
370 Ga0070694_100305270
371 Ga0070708_100302589
372 Ga0070662_100289495
373 Ga0070681_10009669
374 Ga0068867_100021090
375 Ga0068867_100066815
376 Ga0070685_10007706
377 Ga0070706_100000017
378 Ga0070707_100000304
379 Ga0070707_100018365
380 Ga0070698_100011596
381 Ga0070698_100016028
382 Ga0070698_100038449
383 Ga0070698_100572510
384 Ga0070699_100003916
385 Ga0070699_100032064
386 Ga0070699_100374275
387 Ga0070697_100062215
388 Ga0068853_100555499
389 Ga0070695_100009272
390 Ga0070695_100177503
391 Ga0070696_100009270
392 Ga0070696_100052327
393 Ga0070696_100066411
394 Ga0070696_100119262
395 Ga0070696_100248351
396 Ga0070693_100000864
397 Ga0070693_100009822
398 Ga0070693_100132418
399 Ga0070693_100153382
400 Ga0070665_100137425
401 Ga0070704_100002794
402 Ga0070664_100177176
403 Ga0068857_100074462
404 Ga0068857_100274926
405 Ga0068854_100028770
406 Ga0070702_100008691
407 Ga0070702_100009867
408 Ga0070702_100026386
409 Ga0070702_100093961
410 Ga0068852_100486602
411 Ga0068859_100007896
412 Ga0068859_100041253
413 Ga0068859_100049303
414 Ga0068859_100102559
415 Ga0068864_100018699
416 Ga0068864_100051046
417 Ga0068864_100101394
418 Ga0068861_100001040
419 Ga0068851_10081833
420 Ga0068870_10130993
421 Ga0068863_100137985
422 Ga0068863_100180422
423 Ga0068863_100804806
424 Ga0068858_100069238
425 Ga0068858_100440690
426 Ga0068860_100095619
427 Ga0068862_100252925
428 Ga0081539_10000408
429 Ga0081539_10003555
430 Ga0097621_100019218
431 Ga0068871_100006151
432 Ga0068871_100019992
433 Ga0075428_100182447
434 Ga0075428_100187313
435 Ga0075430_100065959
436 Ga0075431_100045219
437 Ga0075431_100282432
438 Ga0075433_10072960
439 Ga0075433_10112469
440 Ga0075433_10283987
441 Ga0075434_100042230
442 Ga0075434_100084369
443 Ga0075434_100295615
444 Ga0068865_100056301
445 Ga0097620_100007897
446 Ga0097620_100041254
447 Ga0097620_100049299
448 Ga0097620_100102556
449 Ga0097620_100250168
450 Ga0105240_10090570
451 Ga0105240_10135156
452 Ga0111539_10016677
453 Ga0111539_10022310
454 Ga0111539_10063897
455 Ga0111539_10181869
456 Ga0105245_10730638
457 Ga0105247_10011610
458 Ga0105247_10395940
459 Ga0105247_10396130
460 Ga0114129_10037807
461 Ga0114129_10056548
462 Ga0114129_10068778
463 Ga0114129_10097645
464 Ga0114129_10623387
465 Ga0105243_10006160
466 Ga0105243_10059448
467 Ga0105241_10046585
468 Ga0105241_10412872
469 Ga0105242_10004694
470 Ga0105242_10082744
471 Ga0105242_10111358
472 Ga0105242_10531683
473 Ga0105248_10001077
474 Ga0105248_10005549
475 Ga0105248_10015293
476 Ga0105248_10202752
477 Ga0105248_10447249
478 Ga0105237_10001454
479 Ga0105237_10832869
480 Ga0105238_10117935
481 Ga0105249_10012075
482 Ga0105249_10041284
483 Ga0105246_10087921
484 Ga0105246_10454536
485 Ga0157373_10010366
486 Ga0157373_10012566
487 Ga0157374_10019174
488 Ga0157374_10127432
489 Ga0157378_10011186
490 Ga0157378_10015585
491 Ga0157378_10173207
492 Ga0163162_10001385
493 Ga0163162_10057871
494 Ga0163162_10191336
495 Ga0163162_10408141
496 Ga0163162_10498749
497 Ga0157372_10041694
498 Ga0157375_10045110
499 Ga0157375_10409963
500 Ga0157375_10950020
501 Ga0163163_10002348
502 Ga0163163_10005449
503 Ga0163163_10015991
504 Ga0163163_10043982
505 Ga0163163_10054653
506 Ga0163163_10094682
507 Ga0163163_10144065
508 Ga0163163_10343781
509 Ga0157380_10098469
510 Ga0157380_10294846
511 Ga0157380_10305964
512 Ga0157377_10002296
513 Ga0157379_10156912
514 Ga0157379_10236996
515 Ga0157376_10087956
516 Ga0163161_10007235
517 Ga0207697_10017579
518 Ga0207653_10002096
519 Ga0207642_10003524
520 Ga0207710_10003871
521 Ga0207710_10024672
522 Ga0207680_10024026
523 Ga0207647_10005806
524 Ga0207647_10081219
525 Ga0207643_10035859
526 Ga0207684_10000079
527 Ga0207654_10061649
528 Ga0207707_10010741
529 Ga0207707_10418517
530 Ga0207695_10033755
531 Ga0207671_10001103
532 Ga0207662_10164531
533 Ga0207646_10000870
534 Ga0207646_10015001
535 Ga0207681_10027012
536 Ga0207694_10181001
537 Ga0207650_10020208
538 Ga0207650_10081461
539 Ga0207687_10049295
540 Ga0207644_10002043
541 Ga0207644_10059226
542 Ga0207706_10010899
543 Ga0207706_10279665
544 Ga0207686_10019132
545 Ga0207709_10002884
546 Ga0207670_10005174
547 Ga0207670_10048497
548 Ga0207665_10217380
549 Ga0207711_10002136
550 Ga0207711_10054379
551 Ga0207711_10208545
552 Ga0207711_10279992
553 Ga0207689_10002367
554 Ga0207689_10003629
555 Ga0207689_10007658
556 Ga0207689_10019391
557 Ga0207689_10057576
558 Ga0207689_10061871
559 Ga0207689_10063795
560 Ga0207689_10123250
561 Ga0207689_10336346
562 Ga0207679_10142547
563 Ga0207651_10119892
564 Ga0207651_10220373
565 Ga0207712_10048039
566 Ga0207640_10256688
567 Ga0207703_10163323
568 Ga0207703_10498992
569 Ga0207708_10000196
570 Ga0207708_10039909
571 Ga0207708_10056754
572 Ga0207708_10141390
573 Ga0207641_10044338
574 Ga0207641_10122510
575 Ga0207641_10137647
576 Ga0207648_10041047
577 Ga0207648_10210674
578 Ga0207676_10006569
579 Ga0207676_10008014
580 Ga0207676_10043917
581 Ga0207675_100002638
582 Ga0207675_100013490
583 Ga0207683_10037694
584 Ga0207698_10078753
585 Ga0207698_10443081
586 Ga0207428_10007799
587 Ga0268265_10512597
588 Ga0268264_10077145
589 Ga0307513_10142452
590 Ga0307408_100007302
591 Ga0307408_100060815
592 Ga0307405_10070586
593 Ga0307405_10232391
594 Ga0307413_10023340
595 Ga0307410_10018473
596 Ga0307406_10000966
597 Ga0307412_10006552
598 Ga0307416_100008159
599 Ga0307416_100093287
600 Ga0307414_10005124
601 Ga0307414_10401970
602 Ga0307411_10015974
603 Ga0307415_100001938
604 Ga0373942_0009190
605 Ga0395900_0124329
606 Ga0395898_0246132
607 Ga0395901_0136785
608 Ga0395901_0233749
609 Ga0439464_0011411
610 Ga0451577_0121410
611 Ga0453683_0050720
612 Ga0453684_0855708
613 Ga0451576_0082699
614 Ga0495636_0027472
615 Ga0496102_0375927
616 Ga0496103_0077812
617 Ga0496108_0117600
618 Ga0496112_0155946
619 Ga0496112_0309543
620 Ga0496112_0417336
621 Ga0496112_0626162
622 Ga0501291_001727
623 Ga0501294_007441
624 Ga0501298_001956
625 Ga0501198_019185
626 Ga0501217_019540
627 Ga0501223_001388
628 Ga0501223_004965
629 Ga0501227_001314
630 Ga0501233_001217
631 Ga0501235_000996
632 Ga0501235_002574
633 Ga0501235_028118
634 Ga0501225_0002991
635 Ga0501225_0009952
636 Ga0501234_000906
637 Ga0501273_012225
638 Ga0501283_001156
639 Ga0501226_000244
640 nmdc:mga05p37_21641_c3
641 nmdc:mga05p37_406609_c2
642 nmdc:mga05p37_412858_c1
643 nmdc:mga05p37_447606_c1
644 nmdc:mga06r32_115252_c1
645 nmdc:mga08y16_21204_c1
646 nmdc:mga08y16_241775_c1
647 nmdc:mga08y16_319710_c1
648 nmdc:mga08y16_8816_c1
649 nmdc:mga0n895_165307_c1
650 nmdc:mga0n895_29664_c1
651 nmdc:mga0rr50_128122_c1
652 nmdc:mga0a205_152404_c1
653 nmdc:mga0a205_535761_c1
654 Ga0530510_0005449

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01678

DAP_epimerase

Diaminopimelate epimerase

27

138

0.97

PF01678

DAP_epimerase

Diaminopimelate epimerase

184

299

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7vdy-assembly1.cif.gz_B crystal structure of o-ureidoserine racemase 0.9239 2 282
7vdy-assembly1.cif.gz_B crystal structure of o-ureidoserine racemase 0.9082 2 282
3ejx-assembly5.cif.gz_D crystal structure of diaminopimelate epimerase from arabidopsis thaliana in complex with ll-azidap 0.8987 1 280
1gqz-assembly1.cif.gz_A refinement of haemophilus influenzae diaminopimelate epimerase at 1.7a 0.8927 3 279
5ha4-assembly1.cif.gz_A structure of a diaminopimelate epimerase from acinetobacter baumannii 0.8868 1 280
ID Description Score Start End Superfamily
af_Q55GS8_377_492_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9448 156 270 3.10.310.10
af_C6T990_209_343_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9401 146 263 3.10.310.10
2gkjA02 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.937 125 270 3.10.310.10
af_Q55GS8_377_492_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9292 156 270 3.10.310.10
af_Q58519_128_282_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9146 129 269 3.10.310.10
ID Description Score Start End GO Terms
AF-A0A2E7UIF4-F1-model_v4 Diaminopimelate epimerase 0.974 183 281 GO:0005829
GO:0008837
GO:0009089
AF-A0A351HDI1-F1-model_v4 Diaminopimelate epimerase (EC 5.1.1.7) 0.9716 192 269 GO:0005829
GO:0008837
GO:0009089
AF-A0A7W0SLP9-F1-model_v4 Diaminopimelate epimerase (EC 5.1.1.7) 0.9702 67 281 GO:0005829
GO:0008837
GO:0009089
AF-A0A3D1ZD28-F1-model_v4 Diaminopimelate epimerase 0.97 192 269 GO:0005829
GO:0008837
GO:0009089
AF-A0A258L9G1-F1-model_v4 Diaminopimelate epimerase (EC 5.1.1.7) 0.9635 167 279 GO:0005829
GO:0008837
GO:0009089

Map