F408651

General Info

Members Datasets Scaffolds Average Seq Length
327 175 654 300

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_100008520|Ga0070671_1000085204
Length 336
Sequence MQCTLEPTTKYTNQQKPLKRRAERVGMRIDPTKKKEFITLGVVFAGVLVISALAVYLIGGRRTSTDSSRRPAEQQPAGVVRETPQARPPVRDTNSDNVLDRLFGNSSNEDLASGERWTENLGRLSLRLLLAALLGAALAFRPRKRVLALKRNPYVSETEILLAIVAAALMIIVGDNAARAFGIFAAVSLVRFRTNIRDPKETTVLLISLALGLASGVGRWDLALILAAFSLLVLWLIEWREPQVVSRSMEVKVTTRNVAATQQALRTVFKKHSFDSELRTIDRDVSEDSLGALVFAVDVSPVVSTDELSEEILRLDGADVEGIEWDQKKSYSYLYQ

Samples

Sample ID Description Type Environment
1 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
130 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
131 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
132 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
136 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
137 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
138 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
139 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
140 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
143 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
144 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
145 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
146 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
147 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
148 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
149 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
150 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
151 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
152 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
153 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
154 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
155 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
156 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
157 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
158 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
159 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
160 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
161 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
162 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
163 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
164 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
165 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
166 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
167 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
168 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
169 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
170 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
171 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
172 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
173 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
174 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
175 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.83
Rhizosphere 97.86
Stem 0
Stem Tuber 0
Unclassified 13.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070671_100008520 3300005355 Bacteria 8219
2 SwRhRL2b_contig_1771431 2162886007 Bacteria 6526
3 MRS1b_contig_1081100 2162886011 Bacteria 1256
4 CNAas_1000150 3300000532 Bacteria 6150
5 JGI25406J46586_10012501 3300003203 Bacteria 3681
6 rootL2_10178971 3300003322 Unclassified 3642
7 Ga0065714_10064522 3300005288 Bacteria 42339
8 Ga0065712_10000141 3300005290 Bacteria 57657
9 Ga0065715_10282533 3300005293 Unclassified 1083
10 Ga0065707_10001184 3300005295 Bacteria 11198
11 Ga0065707_10084758 3300005295 Bacteria 6811
12 Ga0068869_100262977 3300005334 Unclassified 1382
13 Ga0070680_100047521 3300005336 Bacteria 3495
14 Ga0070680_100057008 3300005336 Bacteria 3193
15 Ga0070660_100023475 3300005339 Unclassified 4568
16 Ga0070687_100139710 3300005343 Bacteria 1409
17 Ga0070692_10003335 3300005345 Bacteria 6494
18 Ga0070692_10006911 3300005345 Bacteria 4962
19 Ga0070669_100019036 3300005353 Bacteria 4908
20 Ga0070675_100152712 3300005354 Bacteria 1981
21 Ga0070674_100047771 3300005356 Unclassified 2935
22 Ga0070673_100126412 3300005364 Bacteria 2140
23 Ga0070659_100003236 3300005366 Bacteria 11592
24 Ga0070703_10003746 3300005406 Bacteria 4302
25 Ga0070705_100005267 3300005440 Bacteria 6286
26 Ga0070700_100000123 3300005441 Bacteria 47619
27 Ga0070694_100002250 3300005444 Bacteria 11408
28 Ga0070694_100118155 3300005444 Bacteria 1899
29 Ga0070708_100001024 3300005445 Bacteria 21275
30 Ga0070708_100062407 3300005445 Bacteria 3333
31 Ga0070662_100237122 3300005457 Bacteria 1462
32 Ga0070681_10000383 3300005458 Bacteria 35789
33 Ga0070681_10117472 3300005458 Bacteria 2596
34 Ga0068867_100089670 3300005459 Unclassified 2332
35 Ga0070685_10078542 3300005466 Bacteria 1973
36 Ga0070706_100017948 3300005467 Bacteria 6528
37 Ga0070707_100007711 3300005468 Bacteria 9997
38 Ga0070707_100009936 3300005468 Bacteria 8856
39 Ga0070698_100002895 3300005471 Bacteria 18893
40 Ga0070698_100006600 3300005471 Bacteria 12579
41 Ga0070698_100011527 3300005471 Bacteria 9381
42 Ga0070698_100027480 3300005471 Bacteria 5916
43 Ga0070699_100004425 3300005518 Bacteria 12420
44 Ga0070699_100007970 3300005518 Bacteria 9197
45 Ga0070699_100046431 3300005518 Bacteria 3758
46 Ga0070699_100201247 3300005518 Bacteria 1771
47 Ga0070699_100210354 3300005518 Bacteria 1731
48 Ga0070679_100002673 3300005530 Bacteria 16231
49 Ga0070679_100010086 3300005530 Bacteria 8951
50 Ga0070697_100158099 3300005536 Bacteria 1914
51 Ga0070697_100315680 3300005536 Bacteria 1345
52 Ga0068853_100032142 3300005539 Bacteria 4444
53 Ga0068853_100038536 3300005539 Bacteria 4071
54 Ga0070695_100047282 3300005545 Bacteria 2748
55 Ga0070695_100154480 3300005545 Bacteria 1605
56 Ga0070696_100197485 3300005546 Bacteria 1500
57 Ga0070696_100415311 3300005546 Unclassified 1055
58 Ga0070693_100003429 3300005547 Bacteria 7396
59 Ga0070704_100067640 3300005549 Bacteria 2581
60 Ga0070704_100099935 3300005549 Unclassified 2183
61 Ga0070704_100330267 3300005549 Bacteria 1281
62 Ga0068855_100201043 3300005563 Bacteria 2243
63 Ga0070664_100008780 3300005564 Bacteria 8186
64 Ga0068857_100015342 3300005577 Bacteria 6690
65 Ga0068857_100024419 3300005577 Bacteria 5321
66 Ga0068857_100270777 3300005577 Bacteria 1561
67 Ga0068856_100022825 3300005614 Bacteria 6085
68 Ga0070702_100003467 3300005615 Bacteria 7057
69 Ga0070702_100096358 3300005615 Bacteria 1805
70 Ga0068852_100200862 3300005616 Bacteria 1887
71 Ga0068859_100004320 3300005617 Bacteria 14494
72 Ga0068859_100008200 3300005617 Bacteria 10596
73 Ga0068859_100018589 3300005617 Bacteria 6987
74 Ga0068859_100088795 3300005617 Bacteria 3140
75 Ga0068859_100104626 3300005617 Bacteria 2889
76 Ga0068859_100137072 3300005617 Bacteria 2521
77 Ga0068859_100305428 3300005617 Bacteria 1684
78 Ga0068859_100378820 3300005617 Unclassified 1510
79 Ga0068864_100008733 3300005618 Bacteria 8356
80 Ga0068864_100371467 3300005618 Bacteria 1353
81 Ga0068861_100013024 3300005719 Bacteria 5814
82 Ga0068861_100024019 3300005719 Bacteria 4403
83 Ga0068851_10004221 3300005834 Bacteria 6466
84 Ga0068870_10016002 3300005840 Bacteria 3574
85 Ga0068870_10018490 3300005840 Bacteria 3367
86 Ga0068863_100073379 3300005841 Bacteria 3237
87 Ga0068863_100134204 3300005841 Bacteria 2364
88 Ga0068863_100175824 3300005841 Bacteria 2055
89 Ga0068863_100604096 3300005841 Bacteria 1086
90 Ga0068858_100022513 3300005842 Bacteria 5879
91 Ga0068858_100079605 3300005842 Bacteria 3045
92 Ga0068858_100082482 3300005842 Bacteria 2989
93 Ga0068858_100132784 3300005842 Unclassified 2335
94 Ga0068858_100354069 3300005842 Bacteria 1406
95 Ga0068860_100029098 3300005843 Bacteria 5313
96 Ga0068860_100058513 3300005843 Bacteria 3664
97 Ga0068860_100062256 3300005843 Bacteria 3545
98 Ga0068862_100012783 3300005844 Bacteria 6947
99 Ga0068862_100024511 3300005844 Bacteria 5063
100 Ga0068862_100088751 3300005844 Bacteria 2690
101 Ga0081539_10001483 3300005985 Bacteria 39785
102 Ga0081539_10010043 3300005985 Bacteria 7785
103 Ga0081539_10024619 3300005985 Bacteria 3899
104 Ga0097621_100096312 3300006237 Bacteria 2483
105 Ga0075430_100019553 3300006846 Bacteria 5760
106 Ga0075431_100070777 3300006847 Bacteria 3599
107 Ga0075433_10013867 3300006852 Bacteria 6571
108 Ga0075433_10097100 3300006852 Bacteria 2608
109 Ga0075433_10234059 3300006852 Unclassified 1631
110 Ga0075434_100114586 3300006871 Bacteria 2709
111 Ga0075434_100139692 3300006871 Bacteria 2442
112 Ga0075434_100227004 3300006871 Unclassified 1887
113 Ga0075429_100421576 3300006880 Eukaryota 1169
114 Ga0075436_100031007 3300006914 Bacteria 3679
115 Ga0097620_100004320 3300006931 Bacteria 14494
116 Ga0097620_100008200 3300006931 Bacteria 10596
117 Ga0097620_100018589 3300006931 Bacteria 6987
118 Ga0097620_100088797 3300006931 Bacteria 3140
119 Ga0097620_100104630 3300006931 Bacteria 2889
120 Ga0097620_100137067 3300006931 Bacteria 2521
121 Ga0097620_100305434 3300006931 Bacteria 1684
122 Ga0097620_100378849 3300006931 Unclassified 1510
123 Ga0075435_100132012 3300007076 Bacteria 2090
124 Ga0075435_100165845 3300007076 Bacteria 1862
125 Ga0075435_100215033 3300007076 Bacteria 1631
126 Ga0105240_10012637 3300009093 Bacteria 11641
127 Ga0111539_10005047 3300009094 Bacteria 17153
128 Ga0105247_10050012 3300009101 Bacteria 2571
129 Ga0114129_10005569 3300009147 Bacteria 17815
130 Ga0114129_10016662 3300009147 Bacteria 10465
131 Ga0114129_10024396 3300009147 Bacteria 8569
132 Ga0114129_10064077 3300009147 Bacteria 5129
133 Ga0114129_10091843 3300009147 Bacteria 4205
134 Ga0114129_10125974 3300009147 Bacteria 3521
135 Ga0114129_10234615 3300009147 Bacteria 2469
136 Ga0114129_10430746 3300009147 Unclassified 1733
137 Ga0114129_10467081 3300009147 Bacteria 1653
138 Ga0114129_10741608 3300009147 Bacteria 1258
139 Ga0114129_10945581 3300009147 Unclassified 1089
140 Ga0105243_10013080 3300009148 Bacteria 6271
141 Ga0105243_10200725 3300009148 Bacteria 1749
142 Ga0105243_10428514 3300009148 Bacteria 1236
143 Ga0105241_10050583 3300009174 Bacteria 3168
144 Ga0105242_10211546 3300009176 Bacteria 1729
145 Ga0105248_10015298 3300009177 Bacteria 8459
146 Ga0105237_10002702 3300009545 Bacteria 21702
147 Ga0105237_10192350 3300009545 Bacteria 2040
148 Ga0105238_10023959 3300009551 Bacteria 6222
149 Ga0105249_10004612 3300009553 Bacteria 11899
150 Ga0105249_10006321 3300009553 Bacteria 10295
151 Ga0105249_10028103 3300009553 Bacteria 5077
152 Ga0105249_10371259 3300009553 Unclassified 1454
153 Ga0105249_10601146 3300009553 Unclassified 1155
154 Ga0105239_10238790 3300010375 Bacteria 2040
155 Ga0105246_10048538 3300011119 Bacteria 2902
156 Ga0105246_10105352 3300011119 Unclassified 2061
157 Ga0105246_10388814 3300011119 Unclassified 1155
158 Ga0157373_10000652 3300013100 Bacteria 27251
159 Ga0157373_10012401 3300013100 Bacteria 6268
160 Ga0157373_10095567 3300013100 Bacteria 2092
161 Ga0157378_10504800 3300013297 Bacteria 1209
162 Ga0163162_10138995 3300013306 Unclassified 2541
163 Ga0163162_10276078 3300013306 Bacteria 1813
164 Ga0157372_10008136 3300013307 Bacteria 11152
165 Ga0157372_10046247 3300013307 Unclassified 4831
166 Ga0157372_10270456 3300013307 Bacteria 1974
167 Ga0157375_10009939 3300013308 Bacteria 8369
168 Ga0157375_10552317 3300013308 Bacteria 1313
169 Ga0157375_10767083 3300013308 Bacteria 1115
170 Ga0163163_10006363 3300014325 Bacteria 10311
171 Ga0163163_10021616 3300014325 Bacteria 6075
172 Ga0163163_10035473 3300014325 Bacteria 4839
173 Ga0157380_10004816 3300014326 Bacteria 9404
174 Ga0157380_10062357 3300014326 Unclassified 2986
175 Ga0157377_10073725 3300014745 Unclassified 1979
176 Ga0157379_10019508 3300014968 Bacteria 5990
177 Ga0157376_10153241 3300014969 Bacteria 2081
178 Ga0207656_10001975 3300025321 Bacteria 6831
179 Ga0207653_10030690 3300025885 Unclassified 1734
180 Ga0207710_10024540 3300025900 Bacteria 2597
181 Ga0207647_10006811 3300025904 Bacteria 8284
182 Ga0207647_10040007 3300025904 Bacteria 2955
183 Ga0207643_10003238 3300025908 Bacteria 8784
184 Ga0207643_10006853 3300025908 Bacteria 6113
185 Ga0207643_10058583 3300025908 Bacteria 2196
186 Ga0207684_10010256 3300025910 Bacteria 8247
187 Ga0207707_10000004 3300025912 Bacteria 391281
188 Ga0207707_10026133 3300025912 Bacteria 5105
189 Ga0207671_10001988 3300025914 Bacteria 22555
190 Ga0207671_10052625 3300025914 Bacteria 3017
191 Ga0207660_10002093 3300025917 Bacteria 13235
192 Ga0207652_10000302 3300025921 Bacteria 50773
193 Ga0207652_10156866 3300025921 Bacteria 2039
194 Ga0207646_10022415 3300025922 Bacteria 5819
195 Ga0207681_10018575 3300025923 Bacteria 4382
196 Ga0207681_10067219 3300025923 Bacteria 2484
197 Ga0207694_10013609 3300025924 Bacteria 6132
198 Ga0207650_10019753 3300025925 Bacteria 4738
199 Ga0207650_10157222 3300025925 Unclassified 1798
200 Ga0207650_10171682 3300025925 Bacteria 1724
201 Ga0207650_10412199 3300025925 Bacteria 1120
202 Ga0207659_10092983 3300025926 Unclassified 2256
203 Ga0207644_10033929 3300025931 Bacteria 3570
204 Ga0207690_10051080 3300025932 Bacteria 2763
205 Ga0207686_10120681 3300025934 Unclassified 1784
206 Ga0207709_10000844 3300025935 Bacteria 23477
207 Ga0207670_10002594 3300025936 Bacteria 9506
208 Ga0207665_10071821 3300025939 Unclassified 2363
209 Ga0207665_10119181 3300025939 Bacteria 1863
210 Ga0207711_10005746 3300025941 Bacteria 10468
211 Ga0207711_10016820 3300025941 Bacteria 6074
212 Ga0207689_10064062 3300025942 Bacteria 3024
213 Ga0207689_10124103 3300025942 Unclassified 2124
214 Ga0207651_10453964 3300025960 Bacteria 1100
215 Ga0207712_10000809 3300025961 Bacteria 23036
216 Ga0207712_10005124 3300025961 Bacteria 8294
217 Ga0207712_10018235 3300025961 Bacteria 4569
218 Ga0207640_10284230 3300025981 Unclassified 1301
219 Ga0207703_10019637 3300026035 Bacteria 5281
220 Ga0207703_10109708 3300026035 Bacteria 2352
221 Ga0207639_10018544 3300026041 Bacteria 4947
222 Ga0207708_10000542 3300026075 Bacteria 29179
223 Ga0207708_10001283 3300026075 Bacteria 18865
224 Ga0207708_10009956 3300026075 Bacteria 7059
225 Ga0207708_10013085 3300026075 Bacteria 6193
226 Ga0207708_10018764 3300026075 Bacteria 5211
227 Ga0207702_10021702 3300026078 Bacteria 5316
228 Ga0207641_10011032 3300026088 Bacteria 7410
229 Ga0207641_10141354 3300026088 Bacteria 2172
230 Ga0207641_10218473 3300026088 Bacteria 1766
231 Ga0207641_10244562 3300026088 Bacteria 1673
232 Ga0207648_10026004 3300026089 Bacteria 5205
233 Ga0207648_10049174 3300026089 Bacteria 3691
234 Ga0207676_10002955 3300026095 Bacteria 12125
235 Ga0207676_10136935 3300026095 Bacteria 2090
236 Ga0207676_10429987 3300026095 Unclassified 1240
237 Ga0207674_10001135 3300026116 Bacteria 34563
238 Ga0207674_10023363 3300026116 Bacteria 6625
239 Ga0207674_10107987 3300026116 Bacteria 2760
240 Ga0207674_10130580 3300026116 Bacteria 2476
241 Ga0207674_10138909 3300026116 Unclassified 2390
242 Ga0207674_10237774 3300026116 Bacteria 1768
243 Ga0207674_10384081 3300026116 Bacteria 1358
244 Ga0207675_100005246 3300026118 Bacteria 12469
245 Ga0207675_100011509 3300026118 Bacteria 8279
246 Ga0207675_100039507 3300026118 Bacteria 4403
247 Ga0207675_100089399 3300026118 Bacteria 2894
248 Ga0207698_10280395 3300026142 Bacteria 1541
249 Ga0207428_10015613 3300027907 Bacteria 6563
250 Ga0207428_10345845 3300027907 Bacteria 1095
251 Ga0268265_10028728 3300028380 Bacteria 3985
252 Ga0268265_10156584 3300028380 Bacteria 1929
253 Ga0268265_10342483 3300028380 Bacteria 1362
254 Ga0268264_10017804 3300028381 Bacteria 5816
255 Ga0268264_10030788 3300028381 Bacteria 4398
256 Ga0268264_10223122 3300028381 Bacteria 1736
257 Ga0307408_100002679 3300031548 Bacteria 12354
258 Ga0307408_100117994 3300031548 Unclassified 2051
259 Ga0307405_10001923 3300031731 Bacteria 8949
260 Ga0307405_10005925 3300031731 Bacteria 5961
261 Ga0307413_10004577 3300031824 Bacteria 6040
262 Ga0307413_10084211 3300031824 Bacteria 2049
263 Ga0307410_10092292 3300031852 Bacteria 2152
264 Ga0307410_10342941 3300031852 Bacteria 1191
265 Ga0307406_10007140 3300031901 Bacteria 6186
266 Ga0307412_10000856 3300031911 Bacteria 17502
267 Ga0307412_10048428 3300031911 Bacteria 2795
268 Ga0307416_100003595 3300032002 Bacteria 9147
269 Ga0307416_100178414 3300032002 Unclassified 1988
270 Ga0307414_10001181 3300032004 Bacteria 13410
271 Ga0307411_10244357 3300032005 Bacteria 1407
272 Ga0307415_100000706 3300032126 Bacteria 14888
273 Ga0307415_100176038 3300032126 Bacteria 1673
274 Ga0373951_0000827 3300035091 Bacteria 8411
275 Ga0373931_0016030 3300035691 Bacteria 3684
276 Ga0395898_0018625 3300037466 Bacteria 7079
277 Ga0395901_0113455 3300038443 Bacteria 2846
278 Ga0242419_001067 3300038698 Bacteria 1639
279 Ga0242422_00123 3300038699 Bacteria 3915
280 Ga0242420_002245 3300038996 Bacteria 2735
281 Ga0439462_0057772 3300042015 Bacteria 1048
282 Ga0439458_0000245 3300042157 Bacteria 13127
283 Ga0451576_0101455 3300045051 Bacteria 2993
284 Ga0496106_0389715 3300048909 Unclassified 1119
285 Ga0496108_0302696 3300048911 Bacteria 1393
286 Ga0496108_0482245 3300048911 Unclassified 1083
287 Ga0496110_0419997 3300048913 Unclassified 1219
288 Ga0496110_0468420 3300048913 Bacteria 1148
289 Ga0496112_0280127 3300048915 Bacteria 1615
290 Ga0501298_029799 3300049521 Bacteria 1065
291 Ga0501202_000596 3300049652 Bacteria 5286
292 Ga0501216_000607 3300049660 Bacteria 4362
293 Ga0501217_002034 3300049661 Bacteria 3912
294 Ga0501223_003109 3300049663 Unclassified 3628
295 Ga0501223_010916 3300049663 Bacteria 1824
296 Ga0501227_000890 3300049665 Bacteria 6543
297 Ga0501227_005188 3300049665 Bacteria 2794
298 Ga0501227_007470 3300049665 Bacteria 2342
299 Ga0501227_027466 3300049665 Bacteria 1347
300 Ga0501228_003860 3300049666 Bacteria 1259
301 Ga0501230_000551 3300049667 Bacteria 3867
302 Ga0501233_000443 3300049668 Bacteria 6552
303 Ga0501235_000734 3300049669 Bacteria 6692
304 Ga0501252_004631 3300049682 Unclassified 1470
305 Ga0501257_014940 3300049686 Unclassified 1790
306 Ga0501221_011691 3300049704 Unclassified 1585
307 Ga0501225_0000459 3300049705 Bacteria 12778
308 Ga0501234_000149 3300049707 Bacteria 9394
309 Ga0501283_013386 3300049779 Bacteria 1243
310 nmdc:mga05p37_232824_c1 3300050507 Unclassified 2218
311 nmdc:mga05p37_28196_c1 3300050507 Bacteria 6845
312 nmdc:mga05p37_4633_c1 3300050507 Bacteria 16081
313 nmdc:mga05p37_72320_c2 3300050507 Bacteria 3233
314 nmdc:mga05p37_80510_c1 3300050507 Unclassified 4012
315 nmdc:mga09592_329759_c1 3300050508 Unclassified 1321
316 nmdc:mga08y16_359956_c1 3300050511 Bacteria 1494
317 nmdc:mga08y16_366927_c1 3300050511 Bacteria 1477
318 nmdc:mga08y16_424438_c1 3300050511 Bacteria 1359
319 nmdc:mga08y16_483_c1 3300050511 Bacteria 36839
320 nmdc:mga0n895_153207_c1 3300050512 Bacteria 2336
321 nmdc:mga0n895_413961_c1 3300050512 Bacteria 1363
322 nmdc:mga0rr50_174321_c1 3300050513 Bacteria 1754
323 nmdc:mga08x19_27699_c1 3300050514 Bacteria 3545
324 nmdc:mga0a205_179927_c1 3300050515 Bacteria 2009
325 nmdc:mga0a205_365719_c1 3300050515 Bacteria 1309
326 nmdc:mga0a205_76860_c1 3300050515 Bacteria 3227
327 Ga0530510_0095652 3300061734 Bacteria 2170
328 Ga0070671_100008520
329 SwRhRL2b_contig_1771431
330 MRS1b_contig_1081100
331 CNAas_1000150
332 JGI25406J46586_10012501
333 rootL2_10178971
334 Ga0065714_10064522
335 Ga0065712_10000141
336 Ga0065715_10282533
337 Ga0065707_10001184
338 Ga0065707_10084758
339 Ga0068869_100262977
340 Ga0070680_100047521
341 Ga0070680_100057008
342 Ga0070660_100023475
343 Ga0070687_100139710
344 Ga0070692_10003335
345 Ga0070692_10006911
346 Ga0070669_100019036
347 Ga0070675_100152712
348 Ga0070674_100047771
349 Ga0070673_100126412
350 Ga0070659_100003236
351 Ga0070703_10003746
352 Ga0070705_100005267
353 Ga0070700_100000123
354 Ga0070694_100002250
355 Ga0070694_100118155
356 Ga0070708_100001024
357 Ga0070708_100062407
358 Ga0070662_100237122
359 Ga0070681_10000383
360 Ga0070681_10117472
361 Ga0068867_100089670
362 Ga0070685_10078542
363 Ga0070706_100017948
364 Ga0070707_100007711
365 Ga0070707_100009936
366 Ga0070698_100002895
367 Ga0070698_100006600
368 Ga0070698_100011527
369 Ga0070698_100027480
370 Ga0070699_100004425
371 Ga0070699_100007970
372 Ga0070699_100046431
373 Ga0070699_100201247
374 Ga0070699_100210354
375 Ga0070679_100002673
376 Ga0070679_100010086
377 Ga0070697_100158099
378 Ga0070697_100315680
379 Ga0068853_100032142
380 Ga0068853_100038536
381 Ga0070695_100047282
382 Ga0070695_100154480
383 Ga0070696_100197485
384 Ga0070696_100415311
385 Ga0070693_100003429
386 Ga0070704_100067640
387 Ga0070704_100099935
388 Ga0070704_100330267
389 Ga0068855_100201043
390 Ga0070664_100008780
391 Ga0068857_100015342
392 Ga0068857_100024419
393 Ga0068857_100270777
394 Ga0068856_100022825
395 Ga0070702_100003467
396 Ga0070702_100096358
397 Ga0068852_100200862
398 Ga0068859_100004320
399 Ga0068859_100008200
400 Ga0068859_100018589
401 Ga0068859_100088795
402 Ga0068859_100104626
403 Ga0068859_100137072
404 Ga0068859_100305428
405 Ga0068859_100378820
406 Ga0068864_100008733
407 Ga0068864_100371467
408 Ga0068861_100013024
409 Ga0068861_100024019
410 Ga0068851_10004221
411 Ga0068870_10016002
412 Ga0068870_10018490
413 Ga0068863_100073379
414 Ga0068863_100134204
415 Ga0068863_100175824
416 Ga0068863_100604096
417 Ga0068858_100022513
418 Ga0068858_100079605
419 Ga0068858_100082482
420 Ga0068858_100132784
421 Ga0068858_100354069
422 Ga0068860_100029098
423 Ga0068860_100058513
424 Ga0068860_100062256
425 Ga0068862_100012783
426 Ga0068862_100024511
427 Ga0068862_100088751
428 Ga0081539_10001483
429 Ga0081539_10010043
430 Ga0081539_10024619
431 Ga0097621_100096312
432 Ga0075430_100019553
433 Ga0075431_100070777
434 Ga0075433_10013867
435 Ga0075433_10097100
436 Ga0075433_10234059
437 Ga0075434_100114586
438 Ga0075434_100139692
439 Ga0075434_100227004
440 Ga0075429_100421576
441 Ga0075436_100031007
442 Ga0097620_100004320
443 Ga0097620_100008200
444 Ga0097620_100018589
445 Ga0097620_100088797
446 Ga0097620_100104630
447 Ga0097620_100137067
448 Ga0097620_100305434
449 Ga0097620_100378849
450 Ga0075435_100132012
451 Ga0075435_100165845
452 Ga0075435_100215033
453 Ga0105240_10012637
454 Ga0111539_10005047
455 Ga0105247_10050012
456 Ga0114129_10005569
457 Ga0114129_10016662
458 Ga0114129_10024396
459 Ga0114129_10064077
460 Ga0114129_10091843
461 Ga0114129_10125974
462 Ga0114129_10234615
463 Ga0114129_10430746
464 Ga0114129_10467081
465 Ga0114129_10741608
466 Ga0114129_10945581
467 Ga0105243_10013080
468 Ga0105243_10200725
469 Ga0105243_10428514
470 Ga0105241_10050583
471 Ga0105242_10211546
472 Ga0105248_10015298
473 Ga0105237_10002702
474 Ga0105237_10192350
475 Ga0105238_10023959
476 Ga0105249_10004612
477 Ga0105249_10006321
478 Ga0105249_10028103
479 Ga0105249_10371259
480 Ga0105249_10601146
481 Ga0105239_10238790
482 Ga0105246_10048538
483 Ga0105246_10105352
484 Ga0105246_10388814
485 Ga0157373_10000652
486 Ga0157373_10012401
487 Ga0157373_10095567
488 Ga0157378_10504800
489 Ga0163162_10138995
490 Ga0163162_10276078
491 Ga0157372_10008136
492 Ga0157372_10046247
493 Ga0157372_10270456
494 Ga0157375_10009939
495 Ga0157375_10552317
496 Ga0157375_10767083
497 Ga0163163_10006363
498 Ga0163163_10021616
499 Ga0163163_10035473
500 Ga0157380_10004816
501 Ga0157380_10062357
502 Ga0157377_10073725
503 Ga0157379_10019508
504 Ga0157376_10153241
505 Ga0207656_10001975
506 Ga0207653_10030690
507 Ga0207710_10024540
508 Ga0207647_10006811
509 Ga0207647_10040007
510 Ga0207643_10003238
511 Ga0207643_10006853
512 Ga0207643_10058583
513 Ga0207684_10010256
514 Ga0207707_10000004
515 Ga0207707_10026133
516 Ga0207671_10001988
517 Ga0207671_10052625
518 Ga0207660_10002093
519 Ga0207652_10000302
520 Ga0207652_10156866
521 Ga0207646_10022415
522 Ga0207681_10018575
523 Ga0207681_10067219
524 Ga0207694_10013609
525 Ga0207650_10019753
526 Ga0207650_10157222
527 Ga0207650_10171682
528 Ga0207650_10412199
529 Ga0207659_10092983
530 Ga0207644_10033929
531 Ga0207690_10051080
532 Ga0207686_10120681
533 Ga0207709_10000844
534 Ga0207670_10002594
535 Ga0207665_10071821
536 Ga0207665_10119181
537 Ga0207711_10005746
538 Ga0207711_10016820
539 Ga0207689_10064062
540 Ga0207689_10124103
541 Ga0207651_10453964
542 Ga0207712_10000809
543 Ga0207712_10005124
544 Ga0207712_10018235
545 Ga0207640_10284230
546 Ga0207703_10019637
547 Ga0207703_10109708
548 Ga0207639_10018544
549 Ga0207708_10000542
550 Ga0207708_10001283
551 Ga0207708_10009956
552 Ga0207708_10013085
553 Ga0207708_10018764
554 Ga0207702_10021702
555 Ga0207641_10011032
556 Ga0207641_10141354
557 Ga0207641_10218473
558 Ga0207641_10244562
559 Ga0207648_10026004
560 Ga0207648_10049174
561 Ga0207676_10002955
562 Ga0207676_10136935
563 Ga0207676_10429987
564 Ga0207674_10001135
565 Ga0207674_10023363
566 Ga0207674_10107987
567 Ga0207674_10130580
568 Ga0207674_10138909
569 Ga0207674_10237774
570 Ga0207674_10384081
571 Ga0207675_100005246
572 Ga0207675_100011509
573 Ga0207675_100039507
574 Ga0207675_100089399
575 Ga0207698_10280395
576 Ga0207428_10015613
577 Ga0207428_10345845
578 Ga0268265_10028728
579 Ga0268265_10156584
580 Ga0268265_10342483
581 Ga0268264_10017804
582 Ga0268264_10030788
583 Ga0268264_10223122
584 Ga0307408_100002679
585 Ga0307408_100117994
586 Ga0307405_10001923
587 Ga0307405_10005925
588 Ga0307413_10004577
589 Ga0307413_10084211
590 Ga0307410_10092292
591 Ga0307410_10342941
592 Ga0307406_10007140
593 Ga0307412_10000856
594 Ga0307412_10048428
595 Ga0307416_100003595
596 Ga0307416_100178414
597 Ga0307414_10001181
598 Ga0307411_10244357
599 Ga0307415_100000706
600 Ga0307415_100176038
601 Ga0373951_0000827
602 Ga0373931_0016030
603 Ga0395898_0018625
604 Ga0395901_0113455
605 Ga0242419_001067
606 Ga0242422_00123
607 Ga0242420_002245
608 Ga0439462_0057772
609 Ga0439458_0000245
610 Ga0451576_0101455
611 Ga0496106_0389715
612 Ga0496108_0302696
613 Ga0496108_0482245
614 Ga0496110_0419997
615 Ga0496110_0468420
616 Ga0496112_0280127
617 Ga0501298_029799
618 Ga0501202_000596
619 Ga0501216_000607
620 Ga0501217_002034
621 Ga0501223_003109
622 Ga0501223_010916
623 Ga0501227_000890
624 Ga0501227_005188
625 Ga0501227_007470
626 Ga0501227_027466
627 Ga0501228_003860
628 Ga0501230_000551
629 Ga0501233_000443
630 Ga0501235_000734
631 Ga0501252_004631
632 Ga0501257_014940
633 Ga0501221_011691
634 Ga0501225_0000459
635 Ga0501234_000149
636 Ga0501283_013386
637 nmdc:mga05p37_232824_c1
638 nmdc:mga05p37_28196_c1
639 nmdc:mga05p37_4633_c1
640 nmdc:mga05p37_72320_c2
641 nmdc:mga05p37_80510_c1
642 nmdc:mga09592_329759_c1
643 nmdc:mga08y16_359956_c1
644 nmdc:mga08y16_366927_c1
645 nmdc:mga08y16_424438_c1
646 nmdc:mga08y16_483_c1
647 nmdc:mga0n895_153207_c1
648 nmdc:mga0n895_413961_c1
649 nmdc:mga0rr50_174321_c1
650 nmdc:mga08x19_27699_c1
651 nmdc:mga0a205_179927_c1
652 nmdc:mga0a205_365719_c1
653 nmdc:mga0a205_76860_c1
654 Ga0530510_0095652

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16316

DUF4956

Domain of unknown function (DUF4956)

142

283

0.79

Map