F408494
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 326 | 198 | 315 | 179 |
Family's Representative Sequence
| Representative Sequence | 3300047443|Ga0495687_002474|Ga0495687_002474_7286_7885 |
| Length | 199 |
| Sequence | MFKHLFLYYLCINKKEIKIMATETATKWVIDPMHSEVQFKVKHLVISTVSGFFKSFNGELLTDNDDFDNAEIDFALDINSIDTNQTQRDEHLKSAEFFDAEKYPQITFKSTSFTKTDDEEYELKGNLTIKDQTKPVTLDVEFGGSAADFYGNTKAGFEISGKINRKDFGLTWDGVTEAGSIVVGEDIKLLINIQFTKQA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2522125168 | Dyadobacter beijingensis DSM 21582 | Isolate | Rhizosphere |
| 3 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 4 | 2842903701 | Olivibacter sp. R-72191 | Isolate | Unclassified |
| 5 | 2852623160 | Mucilaginibacter sp. AK015 | Isolate | Rhizosphere |
| 6 | 2884933994 | Mucilaginibacter sp. 14171R-50 | Isolate | Rhizosphere |
| 7 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 8 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 9 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 10 | 2929239360 | Chitinophaga sp. R-73072 Hybrid assembly | Isolate | Unclassified |
| 11 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 12 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 13 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 14 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 15 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 16 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 17 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 18 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 19 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 20 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 21 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 22 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 23 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 24 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 25 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 26 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 27 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 28 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 29 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 35 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 48 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 49 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 50 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 51 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 52 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 53 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 55 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 56 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 79 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 80 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 81 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 82 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 83 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 84 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 85 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 86 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 90 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 122 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 123 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 124 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 125 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 126 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 127 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 128 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 129 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 130 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 131 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 132 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 133 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 134 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 135 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 136 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 137 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 138 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 139 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 140 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 141 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 142 | 3300041446 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT | Metatranscriptome | Rhizoplane |
| 143 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 144 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 145 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 146 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 147 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 148 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 178 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 179 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 180 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 182 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 183 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 184 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 185 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 186 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 187 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 188 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 189 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 190 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 191 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 192 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 193 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 194 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 195 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 196 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 197 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 198 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 88.34 |
| Metatranscriptomes | 8.59 |
| Isolates | 3.07 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.59 |
| Nodule | 0 |
| Rhizoplane | 1.84 |
| Rhizosphere | 82.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.75 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_445390 | 2162886007 | Bacteria | 1020 |
| 2 | JGI24736J21556_1002031 | 3300001904 | Bacteria | 3599 |
| 3 | JGI24736J21556_1003568 | 3300001904 | Bacteria | 2691 |
| 4 | JGI24740J21852_10034402 | 3300001979 | Bacteria | 1596 |
| 5 | JGI24737J22298_10002429 | 3300001990 | Bacteria | 6642 |
| 6 | JGI24737J22298_10009574 | 3300001990 | Bacteria | 3215 |
| 7 | JGI24737J22298_10071228 | 3300001990 | Bacteria | 1038 |
| 8 | JGI24735J21928_10000028 | 3300002067 | Bacteria | 83192 |
| 9 | JGI24735J21928_10122562 | 3300002067 | Bacteria | 749 |
| 10 | JGI24744J21845_10006132 | 3300002077 | Bacteria | 2492 |
| 11 | JGI25162J39368_1000779 | 3300002737 | Bacteria | 21435 |
| 12 | JGI25164J39214_1002113 | 3300002772 | Bacteria | 3370 |
| 13 | JGI25165J46597_1000978 | 3300003214 | Bacteria | 19157 |
| 14 | rootH1_10015994 | 3300003316 | Bacteria | 7435 |
| 15 | rootH2_10008988 | 3300003320 | Bacteria | 1557 |
| 16 | rootH2_10195773 | 3300003320 | Bacteria | 3047 |
| 17 | rootL2_10091311 | 3300003322 | Bacteria | 3634 |
| 18 | rootH1_10050118 | 3300003323 | Bacteria | 18955 |
| 19 | rootH1_10126289 | 3300003323 | Bacteria | 2508 |
| 20 | rootH1_10138304 | 3300003323 | Bacteria | 3869 |
| 21 | rootH1_10210384 | 3300003323 | Bacteria | 4153 |
| 22 | Ga0055536_1012340 | 3300003781 | Bacteria | 3180 |
| 23 | Ga0058863_11967364 | 3300004799 | Bacteria | 1548 |
| 24 | Ga0058861_10098132 | 3300004800 | Bacteria | 1333 |
| 25 | Ga0065165_1000131 | 3300005262 | Bacteria | 128880 |
| 26 | Ga0065714_10021210 | 3300005288 | Bacteria | 1382 |
| 27 | Ga0065714_10119652 | 3300005288 | Bacteria | 1364 |
| 28 | Ga0065704_10146652 | 3300005289 | Bacteria | 1465 |
| 29 | Ga0070658_10000091 | 3300005327 | Bacteria | 81263 |
| 30 | Ga0070658_10024684 | 3300005327 | Bacteria | 4820 |
| 31 | Ga0070658_10284030 | 3300005327 | Bacteria | 1409 |
| 32 | Ga0070658_10447751 | 3300005327 | Bacteria | 1112 |
| 33 | Ga0070658_10745663 | 3300005327 | Bacteria | 850 |
| 34 | Ga0070658_10880815 | 3300005327 | Bacteria | 778 |
| 35 | Ga0070676_10000187 | 3300005328 | Bacteria | 25771 |
| 36 | Ga0070683_100643439 | 3300005329 | Bacteria | 1015 |
| 37 | Ga0070680_100029221 | 3300005336 | Bacteria | 4428 |
| 38 | Ga0068868_100122281 | 3300005338 | Bacteria | 2124 |
| 39 | Ga0068868_100263994 | 3300005338 | Bacteria | 1453 |
| 40 | Ga0070660_100019852 | 3300005339 | Bacteria | 4930 |
| 41 | Ga0070688_100197846 | 3300005365 | Bacteria | 1404 |
| 42 | Ga0070659_100011576 | 3300005366 | Bacteria | 6529 |
| 43 | Ga0070678_100023731 | 3300005456 | Bacteria | 4093 |
| 44 | Ga0070662_100000011 | 3300005457 | Bacteria | 133652 |
| 45 | Ga0070681_10349807 | 3300005458 | Bacteria | 1388 |
| 46 | Ga0070679_100024113 | 3300005530 | Bacteria | 5961 |
| 47 | Ga0068853_100136936 | 3300005539 | Bacteria | 2196 |
| 48 | Ga0068853_100145671 | 3300005539 | Bacteria | 2128 |
| 49 | Ga0068853_100500451 | 3300005539 | Bacteria | 1147 |
| 50 | Ga0070665_100000003 | 3300005548 | Bacteria | 811857 |
| 51 | Ga0068855_100000887 | 3300005563 | Bacteria | 37113 |
| 52 | Ga0068855_100024100 | 3300005563 | Bacteria | 7284 |
| 53 | Ga0068855_100154630 | 3300005563 | Bacteria | 2607 |
| 54 | Ga0068855_100252207 | 3300005563 | Bacteria | 1968 |
| 55 | Ga0068855_101040023 | 3300005563 | Bacteria | 859 |
| 56 | Ga0068857_100061929 | 3300005577 | Bacteria | 3325 |
| 57 | Ga0068857_101191198 | 3300005577 | Bacteria | 737 |
| 58 | Ga0068856_100233850 | 3300005614 | Bacteria | 1853 |
| 59 | Ga0068856_100294747 | 3300005614 | Bacteria | 1639 |
| 60 | Ga0068856_100415087 | 3300005614 | Bacteria | 1366 |
| 61 | Ga0068852_100012163 | 3300005616 | Bacteria | 6519 |
| 62 | Ga0068852_100505188 | 3300005616 | Bacteria | 1204 |
| 63 | Ga0068859_101884533 | 3300005617 | Bacteria | 660 |
| 64 | Ga0068866_10539108 | 3300005718 | Unclassified | 778 |
| 65 | Ga0068851_10322368 | 3300005834 | Bacteria | 893 |
| 66 | Ga0068858_100499383 | 3300005842 | Bacteria | 1175 |
| 67 | Ga0068858_100575771 | 3300005842 | Bacteria | 1091 |
| 68 | Ga0075366_10000333 | 3300006195 | Bacteria | 21671 |
| 69 | Ga0075366_10000475 | 3300006195 | Bacteria | 18607 |
| 70 | Ga0097621_100000485 | 3300006237 | Bacteria | 27776 |
| 71 | Ga0068871_100001864 | 3300006358 | Bacteria | 14258 |
| 72 | Ga0068865_100000547 | 3300006881 | Bacteria | 20866 |
| 73 | Ga0097620_101884544 | 3300006931 | Bacteria | 660 |
| 74 | Ga0105240_10000722 | 3300009093 | Bacteria | 60400 |
| 75 | Ga0105240_10002918 | 3300009093 | Bacteria | 26976 |
| 76 | Ga0105240_10062177 | 3300009093 | Bacteria | 4649 |
| 77 | Ga0105240_10100481 | 3300009093 | Bacteria | 3520 |
| 78 | Ga0105240_10558934 | 3300009093 | Bacteria | 1265 |
| 79 | Ga0105243_10262324 | 3300009148 | Bacteria | 1547 |
| 80 | Ga0105241_10007064 | 3300009174 | Bacteria | 8267 |
| 81 | Ga0105241_10011716 | 3300009174 | Bacteria | 6438 |
| 82 | Ga0105241_10048381 | 3300009174 | Bacteria | 3236 |
| 83 | Ga0105241_10078508 | 3300009174 | Bacteria | 2579 |
| 84 | Ga0105242_10111699 | 3300009176 | Bacteria | 2331 |
| 85 | Ga0105237_10001361 | 3300009545 | Bacteria | 32387 |
| 86 | Ga0105237_10021690 | 3300009545 | Bacteria | 6601 |
| 87 | Ga0105237_10027123 | 3300009545 | Bacteria | 5851 |
| 88 | Ga0105237_10163323 | 3300009545 | Bacteria | 2226 |
| 89 | Ga0105237_10238354 | 3300009545 | Bacteria | 1820 |
| 90 | Ga0105237_10831658 | 3300009545 | Bacteria | 930 |
| 91 | Ga0105238_10041692 | 3300009551 | Bacteria | 4649 |
| 92 | Ga0105238_10989180 | 3300009551 | Bacteria | 862 |
| 93 | Ga0105249_10086560 | 3300009553 | Bacteria | 2922 |
| 94 | Ga0105239_10000002 | 3300010375 | Bacteria | 610298 |
| 95 | Ga0105239_10000055 | 3300010375 | Bacteria | 158211 |
| 96 | Ga0105239_10007036 | 3300010375 | Bacteria | 12946 |
| 97 | Ga0105239_10016428 | 3300010375 | Bacteria | 8184 |
| 98 | Ga0105239_10053411 | 3300010375 | Bacteria | 4433 |
| 99 | Ga0105239_10071694 | 3300010375 | Bacteria | 3806 |
| 100 | Ga0105239_10516688 | 3300010375 | Bacteria | 1358 |
| 101 | Ga0105246_10054856 | 3300011119 | Bacteria | 2748 |
| 102 | Ga0157373_10000273 | 3300013100 | Bacteria | 41492 |
| 103 | Ga0157373_10010268 | 3300013100 | Bacteria | 6898 |
| 104 | Ga0157373_10070779 | 3300013100 | Bacteria | 2465 |
| 105 | Ga0157373_10276416 | 3300013100 | Bacteria | 1190 |
| 106 | Ga0157371_10000216 | 3300013102 | Bacteria | 83975 |
| 107 | Ga0157371_10058176 | 3300013102 | Bacteria | 2742 |
| 108 | Ga0157371_10135474 | 3300013102 | Bacteria | 1753 |
| 109 | Ga0157370_10040951 | 3300013104 | Bacteria | 4471 |
| 110 | Ga0157370_10062792 | 3300013104 | Bacteria | 3522 |
| 111 | Ga0157370_10317828 | 3300013104 | Unclassified | 1436 |
| 112 | Ga0157369_10139434 | 3300013105 | Bacteria | 2566 |
| 113 | Ga0157369_10332728 | 3300013105 | Bacteria | 1578 |
| 114 | Ga0157374_10009378 | 3300013296 | Bacteria | 8398 |
| 115 | Ga0157378_10108685 | 3300013297 | Bacteria | 2540 |
| 116 | Ga0163162_10000024 | 3300013306 | Bacteria | 188515 |
| 117 | Ga0163162_10018481 | 3300013306 | Bacteria | 6831 |
| 118 | Ga0163162_10332409 | 3300013306 | Bacteria | 1652 |
| 119 | Ga0157372_10000196 | 3300013307 | Bacteria | 66430 |
| 120 | Ga0157372_10000428 | 3300013307 | Bacteria | 46270 |
| 121 | Ga0157372_10024509 | 3300013307 | Bacteria | 6555 |
| 122 | Ga0157372_10057431 | 3300013307 | Bacteria | 4350 |
| 123 | Ga0157372_11348759 | 3300013307 | Bacteria | 823 |
| 124 | Ga0157375_10092242 | 3300013308 | Bacteria | 3092 |
| 125 | Ga0157375_10390867 | 3300013308 | Bacteria | 1558 |
| 126 | Ga0157375_10643280 | 3300013308 | Bacteria | 1217 |
| 127 | Ga0163163_11909974 | 3300014325 | Bacteria | 654 |
| 128 | Ga0157377_10007183 | 3300014745 | Bacteria | 5362 |
| 129 | Ga0157377_10371974 | 3300014745 | Bacteria | 965 |
| 130 | Ga0157376_10671448 | 3300014969 | Bacteria | 1039 |
| 131 | Ga0182007_10067087 | 3300015262 | Bacteria | 1175 |
| 132 | Ga0206349_1127433 | 3300020075 | Bacteria | 636 |
| 133 | Ga0206349_1969753 | 3300020075 | Bacteria | 665 |
| 134 | Ga0206352_10504457 | 3300020078 | Bacteria | 660 |
| 135 | Ga0206352_10960216 | 3300020078 | Bacteria | 1878 |
| 136 | Ga0206352_11233509 | 3300020078 | Bacteria | 619 |
| 137 | Ga0206350_10608541 | 3300020080 | Bacteria | 729 |
| 138 | Ga0206354_10540776 | 3300020081 | Bacteria | 706 |
| 139 | Ga0206353_10901459 | 3300020082 | Bacteria | 807 |
| 140 | Ga0154015_1679143 | 3300020610 | Bacteria | 794 |
| 141 | Ga0224712_10165741 | 3300022467 | Bacteria | 988 |
| 142 | Ga0224712_10334625 | 3300022467 | Bacteria | 713 |
| 143 | Ga0209563_107933 | 3300025230 | Bacteria | 1706 |
| 144 | Ga0207427_100580 | 3300025231 | Bacteria | 18471 |
| 145 | Ga0209437_100024 | 3300025233 | Bacteria | 592878 |
| 146 | Ga0209437_100101 | 3300025233 | Bacteria | 226668 |
| 147 | Ga0209026_1000834 | 3300025250 | Bacteria | 16276 |
| 148 | Ga0209233_1000124 | 3300025261 | Bacteria | 226743 |
| 149 | Ga0209233_1000396 | 3300025261 | Bacteria | 36455 |
| 150 | Ga0209233_1034049 | 3300025261 | Bacteria | 1163 |
| 151 | Ga0209455_1010888 | 3300025272 | Bacteria | 2278 |
| 152 | Ga0209676_1001085 | 3300025292 | Bacteria | 30593 |
| 153 | Ga0207647_10000051 | 3300025904 | Bacteria | 87826 |
| 154 | Ga0207647_10000149 | 3300025904 | Bacteria | 55611 |
| 155 | Ga0207647_10038954 | 3300025904 | Bacteria | 3002 |
| 156 | Ga0207645_10000758 | 3300025907 | Bacteria | 26866 |
| 157 | Ga0207705_10000132 | 3300025909 | Bacteria | 81270 |
| 158 | Ga0207705_10017607 | 3300025909 | Bacteria | 5114 |
| 159 | Ga0207705_10214060 | 3300025909 | Bacteria | 1462 |
| 160 | Ga0207654_10028434 | 3300025911 | Bacteria | 3047 |
| 161 | Ga0207654_10041386 | 3300025911 | Bacteria | 2601 |
| 162 | Ga0207707_10248427 | 3300025912 | Bacteria | 1546 |
| 163 | Ga0207695_10000013 | 3300025913 | Bacteria | 821265 |
| 164 | Ga0207695_10014993 | 3300025913 | Bacteria | 9144 |
| 165 | Ga0207695_10047616 | 3300025913 | Bacteria | 4535 |
| 166 | Ga0207695_10099555 | 3300025913 | Bacteria | 2904 |
| 167 | Ga0207695_10210737 | 3300025913 | Bacteria | 1854 |
| 168 | Ga0207671_10002500 | 3300025914 | Bacteria | 19619 |
| 169 | Ga0207671_10010063 | 3300025914 | Bacteria | 7841 |
| 170 | Ga0207671_10010874 | 3300025914 | Bacteria | 7464 |
| 171 | Ga0207671_10074859 | 3300025914 | Bacteria | 2531 |
| 172 | Ga0207660_10130748 | 3300025917 | Bacteria | 1911 |
| 173 | Ga0207657_10197038 | 3300025919 | Bacteria | 1622 |
| 174 | Ga0207652_10016686 | 3300025921 | Bacteria | 6001 |
| 175 | Ga0207694_10269078 | 3300025924 | Bacteria | 1397 |
| 176 | Ga0207694_10474198 | 3300025924 | Bacteria | 1046 |
| 177 | Ga0207690_10007381 | 3300025932 | Bacteria | 6526 |
| 178 | Ga0207706_10000122 | 3300025933 | Bacteria | 83838 |
| 179 | Ga0207686_10115401 | 3300025934 | Bacteria | 1818 |
| 180 | Ga0207704_10000041 | 3300025938 | Bacteria | 89976 |
| 181 | Ga0207661_10343735 | 3300025944 | Bacteria | 1345 |
| 182 | Ga0207667_10000009 | 3300025949 | Bacteria | 603135 |
| 183 | Ga0207667_10009241 | 3300025949 | Bacteria | 11638 |
| 184 | Ga0207667_10068263 | 3300025949 | Bacteria | 3702 |
| 185 | Ga0207667_10102086 | 3300025949 | Bacteria | 2958 |
| 186 | Ga0207667_10614533 | 3300025949 | Bacteria | 1095 |
| 187 | Ga0207712_10167378 | 3300025961 | Bacteria | 1714 |
| 188 | Ga0207640_10184735 | 3300025981 | Bacteria | 1566 |
| 189 | Ga0207677_10004296 | 3300026023 | Bacteria | 7629 |
| 190 | Ga0207677_10448133 | 3300026023 | Bacteria | 1105 |
| 191 | Ga0207703_10501290 | 3300026035 | Bacteria | 1140 |
| 192 | Ga0207639_10014118 | 3300026041 | Bacteria | 5609 |
| 193 | Ga0207639_10120706 | 3300026041 | Bacteria | 2153 |
| 194 | Ga0207702_10000463 | 3300026078 | Bacteria | 45983 |
| 195 | Ga0207702_10320875 | 3300026078 | Bacteria | 1475 |
| 196 | Ga0207702_11271937 | 3300026078 | Bacteria | 730 |
| 197 | Ga0207648_10005037 | 3300026089 | Bacteria | 13403 |
| 198 | Ga0207674_10207377 | 3300026116 | Bacteria | 1909 |
| 199 | Ga0207683_10020990 | 3300026121 | Bacteria | 5590 |
| 200 | Ga0207698_10043256 | 3300026142 | Bacteria | 3373 |
| 201 | Ga0207698_10478570 | 3300026142 | Bacteria | 1207 |
| 202 | Ga0268266_10000137 | 3300028379 | Bacteria | 140685 |
| 203 | Ga0307517_10002409 | 3300028786 | Bacteria | 29976 |
| 204 | Ga0307515_10001136 | 3300028794 | Bacteria | 61007 |
| 205 | Ga0307515_10001915 | 3300028794 | Bacteria | 46153 |
| 206 | Ga0307515_10105586 | 3300028794 | Bacteria | 3351 |
| 207 | Ga0265338_10021246 | 3300028800 | Bacteria | 6780 |
| 208 | Ga0265338_10128406 | 3300028800 | Bacteria | 2007 |
| 209 | Ga0316177_1153433 | 3300030731 | Bacteria | 4028 |
| 210 | Ga0316176_1047921 | 3300030732 | Bacteria | 7939 |
| 211 | Ga0316183_1151961 | 3300030742 | Bacteria | 8748 |
| 212 | Ga0316181_1221153 | 3300030744 | Bacteria | 21505 |
| 213 | Ga0316182_1007477 | 3300030745 | Bacteria | 1508 |
| 214 | Ga0307408_100260066 | 3300031548 | Bacteria | 1436 |
| 215 | Ga0307405_10084439 | 3300031731 | Bacteria | 2084 |
| 216 | Ga0307412_10082815 | 3300031911 | Bacteria | 2222 |
| 217 | Ga0307414_10017890 | 3300032004 | Bacteria | 4348 |
| 218 | Ga0307414_10032297 | 3300032004 | Bacteria | 3445 |
| 219 | Ga0307414_10335608 | 3300032004 | Bacteria | 1292 |
| 220 | Ga0316593_10055307 | 3300032168 | Unclassified | 1348 |
| 221 | Ga0316593_10067633 | 3300032168 | Bacteria | 1231 |
| 222 | Ga0307507_10000036 | 3300033179 | Bacteria | 187512 |
| 223 | Ga0307510_10008820 | 3300033180 | Bacteria | 12018 |
| 224 | Ga0395899_0000033 | 3300037312 | Bacteria | 306589 |
| 225 | Ga0395899_0000559 | 3300037312 | Bacteria | 39854 |
| 226 | Ga0395899_0301463 | 3300037312 | Bacteria | 1084 |
| 227 | Ga0395900_0000014 | 3300037418 | Bacteria | 386513 |
| 228 | Ga0395900_0041697 | 3300037418 | Bacteria | 4731 |
| 229 | Ga0395900_0711873 | 3300037418 | Bacteria | 937 |
| 230 | Ga0395898_0055085 | 3300037466 | Bacteria | 3879 |
| 231 | Ga0395905_0000241 | 3300037471 | Bacteria | 82847 |
| 232 | Ga0395901_0000582 | 3300038443 | Bacteria | 42425 |
| 233 | Ga0395901_0203291 | 3300038443 | Bacteria | 2076 |
| 234 | Ga0451789_0989257 | 3300041443 | Bacteria | 572 |
| 235 | Ga0451794_21441 | 3300041446 | Bacteria | 535 |
| 236 | Ga0451794_32275 | 3300041446 | Bacteria | 587 |
| 237 | Ga0451793_1272196 | 3300041452 | Bacteria | 3350 |
| 238 | Ga0451807_2076529 | 3300041486 | Bacteria | 791 |
| 239 | Ga0451843_0956451 | 3300041509 | Bacteria | 687 |
| 240 | Ga0439448_0033131 | 3300042005 | Bacteria | 1647 |
| 241 | Ga0453684_0874720 | 3300044712 | Unclassified | 964 |
| 242 | Ga0495651_0052852 | 3300046462 | Bacteria | 3128 |
| 243 | Ga0495650_0000036 | 3300046471 | Bacteria | 400633 |
| 244 | Ga0495639_0100834 | 3300046475 | Bacteria | 1363 |
| 245 | Ga0495585_0000638 | 3300046492 | Bacteria | 32286 |
| 246 | Ga0495585_0000831 | 3300046492 | Bacteria | 26632 |
| 247 | Ga0495607_0246064 | 3300046501 | Bacteria | 863 |
| 248 | Ga0495606_0000008 | 3300046507 | Bacteria | 321373 |
| 249 | Ga0495606_0011907 | 3300046507 | Bacteria | 7036 |
| 250 | Ga0495606_0119535 | 3300046507 | Bacteria | 1578 |
| 251 | Ga0495610_0000757 | 3300046512 | Bacteria | 30503 |
| 252 | Ga0495616_0018093 | 3300046513 | Bacteria | 3877 |
| 253 | Ga0495616_0019504 | 3300046513 | Bacteria | 3700 |
| 254 | Ga0495631_0025183 | 3300046518 | Bacteria | 2742 |
| 255 | Ga0495631_0112463 | 3300046518 | Bacteria | 1171 |
| 256 | Ga0495637_0112421 | 3300046520 | Bacteria | 1054 |
| 257 | Ga0495648_0026895 | 3300046524 | Bacteria | 3862 |
| 258 | Ga0495642_0436329 | 3300046528 | Unclassified | 578 |
| 259 | Ga0495609_0040270 | 3300046538 | Bacteria | 2103 |
| 260 | Ga0495633_0000015 | 3300046558 | Bacteria | 254484 |
| 261 | Ga0495633_0008678 | 3300046558 | Bacteria | 5704 |
| 262 | Ga0495668_0000010 | 3300046616 | Bacteria | 487308 |
| 263 | Ga0495625_0000379 | 3300046660 | Bacteria | 67828 |
| 264 | Ga0495625_0000668 | 3300046660 | Bacteria | 48864 |
| 265 | Ga0495625_0002805 | 3300046660 | Bacteria | 18362 |
| 266 | Ga0495625_0013569 | 3300046660 | Bacteria | 6537 |
| 267 | Ga0495625_0141636 | 3300046660 | Bacteria | 1621 |
| 268 | Ga0495625_0607081 | 3300046660 | Bacteria | 656 |
| 269 | Ga0495661_0001087 | 3300046665 | Bacteria | 23875 |
| 270 | Ga0495661_0018152 | 3300046665 | Bacteria | 4632 |
| 271 | Ga0495661_0327880 | 3300046665 | Unclassified | 759 |
| 272 | Ga0495658_0027360 | 3300046683 | Bacteria | 3068 |
| 273 | Ga0495671_0403710 | 3300046692 | Bacteria | 654 |
| 274 | Ga0495649_0000010 | 3300046694 | Bacteria | 430552 |
| 275 | Ga0495589_0206093 | 3300046794 | Bacteria | 927 |
| 276 | Ga0495660_0026516 | 3300046810 | Bacteria | 3285 |
| 277 | Ga0495683_0126958 | 3300047323 | Bacteria | 1206 |
| 278 | Ga0495683_0270974 | 3300047323 | Bacteria | 738 |
| 279 | Ga0495687_000736 | 3300047443 | Bacteria | 35743 |
| 280 | Ga0495687_002474 | 3300047443 | Bacteria | 14740 |
| 281 | Ga0495677_0039820 | 3300047445 | Bacteria | 1718 |
| 282 | Ga0495677_0121624 | 3300047445 | Bacteria | 996 |
| 283 | Ga0495679_096402 | 3300047446 | Bacteria | 825 |
| 284 | Ga0495673_0061505 | 3300047469 | Bacteria | 1607 |
| 285 | Ga0495686_0041105 | 3300047472 | Bacteria | 2945 |
| 286 | Ga0495686_0152593 | 3300047472 | Bacteria | 1355 |
| 287 | Ga0495686_0196696 | 3300047472 | Bacteria | 1159 |
| 288 | Ga0495614_0071458 | 3300048089 | Bacteria | 1496 |
| 289 | Ga0496125_0000031 | 3300048928 | Bacteria | 365156 |
| 290 | Ga0496126_0001893 | 3300048929 | Bacteria | 30186 |
| 291 | Ga0501305_082575 | 3300049161 | Bacteria | 579 |
| 292 | Ga0495678_050717 | 3300049459 | Bacteria | 1607 |
| 293 | Ga0501316_059596 | 3300049532 | Bacteria | 563 |
| 294 | Ga0501320_027636 | 3300049536 | Bacteria | 691 |
| 295 | Ga0501225_0018500 | 3300049705 | Bacteria | 1931 |
| 296 | Ga0501280_035884 | 3300049776 | Bacteria | 789 |
| 297 | nmdc:mga0k408_105_c1 | 3300050493 | Bacteria | 39936 |
| 298 | nmdc:mga0k408_276_c1 | 3300050493 | Bacteria | 27939 |
| 299 | nmdc:mga0k408_37489_c1 | 3300050493 | Bacteria | 2783 |
| 300 | nmdc:mga07m45_286464_c1 | 3300050496 | Bacteria | 958 |
| 301 | Ga0500635_0002489 | 3300053080 | Bacteria | 4570 |
| 302 | Ga0500608_021605 | 3300053122 | Bacteria | 2975 |
| 303 | Ga0500618_000163 | 3300053125 | Bacteria | 55548 |
| 304 | Ga0500618_001717 | 3300053125 | Bacteria | 9331 |
| 305 | Ga0500618_071996 | 3300053125 | Bacteria | 775 |
| 306 | Ga0500655_090223 | 3300053133 | Bacteria | 636 |
| 307 | Ga0500622_0115083 | 3300053156 | Bacteria | 1310 |
| 308 | Ga0500624_000278 | 3300053157 | Bacteria | 17649 |
| 309 | Ga0587066_107249 | 3300059490 | Bacteria | 643 |
| 310 | Ga0587070_097497 | 3300059491 | Bacteria | 671 |
| 311 | Ga0587070_145365 | 3300059491 | Bacteria | 590 |
| 312 | Ga0587073_0120824 | 3300059492 | Bacteria | 707 |
| 313 | Ga0587090_018786 | 3300059510 | Bacteria | 1060 |
| 314 | Ga0587072_131906 | 3300059643 | Bacteria | 589 |
| 315 | Ga0587076_075991 | 3300059645 | Bacteria | 707 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | iso_pu_bacteria | 2842903701 | 2842908076 | 150 |
| 2 | 3300047472 | Ga0495686_0152593 | Ga0495686_0152593_64_582 | 160 |
| 3 | 3300038443 | Ga0395901_0203291 | Ga0395901_0203291_30_518 | 162 |
| 4 | 3300041446 | Ga0451794_21441 | Ga0451794_21441_18_521 | 167 |
| 5 | 3300046660 | Ga0495625_0607081 | Ga0495625_0607081_126_629 | 167 |
| 6 | 3300049532 | Ga0501316_059596 | Ga0501316_059596_11_535 | 167 |
| 7 | iso_pu_bacteria | 2929239360 | 2929242229 | 167 |
| 8 | 3300003323 | rootH1_10050118 | rootH1_100501183 | 169 |
| 9 | 3300032168 | Ga0316593_10067633 | Ga0316593_100676332 | 171 |
| 10 | 3300001904 | JGI24736J21556_1003568 | JGI24736J21556_10035682 | 172 |
| 11 | 3300001979 | JGI24740J21852_10034402 | JGI24740J21852_100344022 | 172 |
| 12 | 3300001990 | JGI24737J22298_10071228 | JGI24737J22298_100712282 | 172 |
| 13 | 3300002067 | JGI24735J21928_10122562 | JGI24735J21928_101225621 | 172 |
| 14 | 3300002737 | JGI25162J39368_1000779 | JGI25162J39368_100077910 | 172 |
| 15 | 3300002772 | JGI25164J39214_1002113 | JGI25164J39214_10021134 | 172 |
| 16 | 3300003214 | JGI25165J46597_1000978 | JGI25165J46597_100097813 | 172 |
| 17 | 3300005327 | Ga0070658_10880815 | Ga0070658_108808152 | 172 |
| 18 | 3300005329 | Ga0070683_100643439 | Ga0070683_1006434392 | 172 |
| 19 | 3300005366 | Ga0070659_100011576 | Ga0070659_1000115761 | 172 |
| 20 | 3300005577 | Ga0068857_100061929 | Ga0068857_1000619295 | 172 |
| 21 | 3300009093 | Ga0105240_10100481 | Ga0105240_101004812 | 172 |
| 22 | 3300009093 | Ga0105240_10558934 | Ga0105240_105589342 | 172 |
| 23 | 3300010375 | Ga0105239_10000002 | Ga0105239_10000002364 | 172 |
| 24 | 3300013100 | Ga0157373_10000273 | Ga0157373_100002732 | 172 |
| 25 | 3300013100 | Ga0157373_10010268 | Ga0157373_100102688 | 172 |
| 26 | 3300013102 | Ga0157371_10000216 | Ga0157371_1000021669 | 172 |
| 27 | 3300013104 | Ga0157370_10040951 | Ga0157370_100409511 | 172 |
| 28 | 3300013105 | Ga0157369_10139434 | Ga0157369_101394342 | 172 |
| 29 | 3300013307 | Ga0157372_10000196 | Ga0157372_1000019627 | 172 |
| 30 | 3300013307 | Ga0157372_10000428 | Ga0157372_1000042821 | 172 |
| 31 | 3300014745 | Ga0157377_10371974 | Ga0157377_103719742 | 172 |
| 32 | 3300020075 | Ga0206349_1969753 | Ga0206349_19697531 | 172 |
| 33 | 3300020078 | Ga0206352_10504457 | Ga0206352_105044572 | 172 |
| 34 | 3300020078 | Ga0206352_11233509 | Ga0206352_112335091 | 172 |
| 35 | 3300025230 | Ga0209563_107933 | Ga0209563_1079331 | 172 |
| 36 | 3300025231 | Ga0207427_100580 | Ga0207427_1005808 | 172 |
| 37 | 3300025233 | Ga0209437_100101 | Ga0209437_10010115 | 172 |
| 38 | 3300025261 | Ga0209233_1000124 | Ga0209233_1000124221 | 172 |
| 39 | 3300025261 | Ga0209233_1000396 | Ga0209233_100039617 | 172 |
| 40 | 3300025904 | Ga0207647_10000149 | Ga0207647_1000014944 | 172 |
| 41 | 3300025913 | Ga0207695_10210737 | Ga0207695_102107372 | 172 |
| 42 | 3300025932 | Ga0207690_10007381 | Ga0207690_100073818 | 172 |
| 43 | 3300025944 | Ga0207661_10343735 | Ga0207661_103437352 | 172 |
| 44 | 3300026116 | Ga0207674_10207377 | Ga0207674_102073771 | 172 |
| 45 | 3300032168 | Ga0316593_10055307 | Ga0316593_100553072 | 172 |
| 46 | 3300037418 | Ga0395900_0711873 | Ga0395900_0711873_358_876 | 172 |
| 47 | 3300047472 | Ga0495686_0041105 | Ga0495686_0041105_229_756 | 172 |
| 48 | iso_pu_bacteria | 2852623160 | 2852623864 | 172 |
| 49 | iso_pu_bacteria | 2884933994 | 2884937232 | 172 |
| 50 | 3300030731 | Ga0316177_1153433 | Ga0316177_11534333 | 173 |
| 51 | 3300030732 | Ga0316176_1047921 | Ga0316176_10479214 | 173 |
| 52 | 3300030742 | Ga0316183_1151961 | Ga0316183_11519613 | 173 |
| 53 | 3300030744 | Ga0316181_1221153 | Ga0316181_12211536 | 173 |
| 54 | 3300030745 | Ga0316182_1007477 | Ga0316182_10074772 | 173 |
| 55 | iso_pu_bacteria | 2522125168 | 2522549483 | 173 |
| 56 | 3300032004 | Ga0307414_10335608 | Ga0307414_103356082 | 174 |
| 57 | iso_pu_bacteria | 2599185184 | 2599480985 | 174 |
| 58 | iso_pu_bacteria | 2919437846 | 2919438489 | 174 |
| 59 | iso_pu_bacteria | 2928078545 | 2928080898 | 174 |
| 60 | iso_pu_bacteria | 2928147474 | 2928150196 | 174 |
| 61 | iso_pu_bacteria | 2932082852 | 2932088236 | 174 |
| 62 | 3300009093 | Ga0105240_10000722 | Ga0105240_1000072261 | 175 |
| 63 | 3300009174 | Ga0105241_10007064 | Ga0105241_100070644 | 175 |
| 64 | 3300009545 | Ga0105237_10021690 | Ga0105237_100216906 | 175 |
| 65 | 3300009551 | Ga0105238_10989180 | Ga0105238_109891801 | 175 |
| 66 | 3300010375 | Ga0105239_10053411 | Ga0105239_100534114 | 175 |
| 67 | 3300025913 | Ga0207695_10000013 | Ga0207695_10000013103 | 175 |
| 68 | 3300025914 | Ga0207671_10002500 | Ga0207671_1000250011 | 175 |
| 69 | 3300025924 | Ga0207694_10269078 | Ga0207694_102690781 | 175 |
| 70 | 3300003320 | rootH2_10195773 | rootH2_101957733 | 176 |
| 71 | 3300005288 | Ga0065714_10021210 | Ga0065714_100212102 | 176 |
| 72 | 3300006195 | Ga0075366_10000333 | Ga0075366_1000033313 | 176 |
| 73 | 3300025272 | Ga0209455_1010888 | Ga0209455_10108882 | 176 |
| 74 | 3300028794 | Ga0307515_10105586 | Ga0307515_101055862 | 176 |
| 75 | 3300032004 | Ga0307414_10032297 | Ga0307414_100322973 | 176 |
| 76 | 3300037312 | Ga0395899_0301463 | Ga0395899_0301463_21_575 | 176 |
| 77 | 3300037418 | Ga0395900_0041697 | Ga0395900_0041697_523_1077 | 176 |
| 78 | 3300041446 | Ga0451794_32275 | Ga0451794_32275_32_565 | 176 |
| 79 | 3300041452 | Ga0451793_1272196 | Ga0451793_1272196_1824_2357 | 176 |
| 80 | 3300041486 | Ga0451807_2076529 | Ga0451807_2076529_164_694 | 176 |
| 81 | 3300044712 | Ga0453684_0874720 | Ga0453684_0874720_107_646 | 176 |
| 82 | 3300048928 | Ga0496125_0000031 | Ga0496125_0000031_253750_254280 | 176 |
| 83 | 3300048929 | Ga0496126_0001893 | Ga0496126_0001893_11989_12519 | 176 |
| 84 | 3300049536 | Ga0501320_027636 | Ga0501320_027636_145_675 | 176 |
| 85 | 3300050493 | nmdc:mga0k408_105_c1 | nmdc:mga0k408_105_c1_6032_6565 | 176 |
| 86 | 2162886007 | SwRhRL2b_contig_445390 | SwRhRL2b_0900.00002230 | 177 |
| 87 | 3300001904 | JGI24736J21556_1002031 | JGI24736J21556_10020314 | 177 |
| 88 | 3300001990 | JGI24737J22298_10002429 | JGI24737J22298_100024294 | 177 |
| 89 | 3300001990 | JGI24737J22298_10009574 | JGI24737J22298_100095742 | 177 |
| 90 | 3300002067 | JGI24735J21928_10000028 | JGI24735J21928_1000002860 | 177 |
| 91 | 3300002077 | JGI24744J21845_10006132 | JGI24744J21845_100061322 | 177 |
| 92 | 3300003316 | rootH1_10015994 | rootH1_100159942 | 177 |
| 93 | 3300003320 | rootH2_10008988 | rootH2_100089883 | 177 |
| 94 | 3300003322 | rootL2_10091311 | rootL2_100913112 | 177 |
| 95 | 3300003323 | rootH1_10126289 | rootH1_101262891 | 177 |
| 96 | 3300003323 | rootH1_10138304 | rootH1_101383045 | 177 |
| 97 | 3300003323 | rootH1_10210384 | rootH1_102103842 | 177 |
| 98 | 3300003781 | Ga0055536_1012340 | Ga0055536_10123403 | 177 |
| 99 | 3300004799 | Ga0058863_11967364 | Ga0058863_119673643 | 177 |
| 100 | 3300004800 | Ga0058861_10098132 | Ga0058861_100981321 | 177 |
| 101 | 3300005262 | Ga0065165_1000131 | Ga0065165_1000131109 | 177 |
| 102 | 3300005288 | Ga0065714_10119652 | Ga0065714_101196521 | 177 |
| 103 | 3300005289 | Ga0065704_10146652 | Ga0065704_101466521 | 177 |
| 104 | 3300005327 | Ga0070658_10000091 | Ga0070658_1000009161 | 177 |
| 105 | 3300005327 | Ga0070658_10024684 | Ga0070658_100246842 | 177 |
| 106 | 3300005327 | Ga0070658_10284030 | Ga0070658_102840302 | 177 |
| 107 | 3300005327 | Ga0070658_10447751 | Ga0070658_104477512 | 177 |
| 108 | 3300005327 | Ga0070658_10745663 | Ga0070658_107456631 | 177 |
| 109 | 3300005328 | Ga0070676_10000187 | Ga0070676_100001873 | 177 |
| 110 | 3300005336 | Ga0070680_100029221 | Ga0070680_1000292212 | 177 |
| 111 | 3300005338 | Ga0068868_100122281 | Ga0068868_1001222812 | 177 |
| 112 | 3300005338 | Ga0068868_100263994 | Ga0068868_1002639942 | 177 |
| 113 | 3300005339 | Ga0070660_100019852 | Ga0070660_1000198521 | 177 |
| 114 | 3300005365 | Ga0070688_100197846 | Ga0070688_1001978462 | 177 |
| 115 | 3300005456 | Ga0070678_100023731 | Ga0070678_1000237314 | 177 |
| 116 | 3300005457 | Ga0070662_100000011 | Ga0070662_10000001160 | 177 |
| 117 | 3300005458 | Ga0070681_10349807 | Ga0070681_103498072 | 177 |
| 118 | 3300005530 | Ga0070679_100024113 | Ga0070679_1000241134 | 177 |
| 119 | 3300005539 | Ga0068853_100136936 | Ga0068853_1001369363 | 177 |
| 120 | 3300005539 | Ga0068853_100145671 | Ga0068853_1001456712 | 177 |
| 121 | 3300005539 | Ga0068853_100500451 | Ga0068853_1005004511 | 177 |
| 122 | 3300005548 | Ga0070665_100000003 | Ga0070665_100000003128 | 177 |
| 123 | 3300005563 | Ga0068855_100000887 | Ga0068855_10000088721 | 177 |
| 124 | 3300005563 | Ga0068855_100024100 | Ga0068855_1000241003 | 177 |
| 125 | 3300005563 | Ga0068855_100154630 | Ga0068855_1001546301 | 177 |
| 126 | 3300005563 | Ga0068855_100252207 | Ga0068855_1002522072 | 177 |
| 127 | 3300005563 | Ga0068855_101040023 | Ga0068855_1010400232 | 177 |
| 128 | 3300005577 | Ga0068857_101191198 | Ga0068857_1011911982 | 177 |
| 129 | 3300005614 | Ga0068856_100233850 | Ga0068856_1002338502 | 177 |
| 130 | 3300005614 | Ga0068856_100294747 | Ga0068856_1002947471 | 177 |
| 131 | 3300005614 | Ga0068856_100415087 | Ga0068856_1004150871 | 177 |
| 132 | 3300005616 | Ga0068852_100012163 | Ga0068852_1000121638 | 177 |
| 133 | 3300005616 | Ga0068852_100505188 | Ga0068852_1005051882 | 177 |
| 134 | 3300005617 | Ga0068859_101884533 | Ga0068859_1018845331 | 177 |
| 135 | 3300005718 | Ga0068866_10539108 | Ga0068866_105391081 | 177 |
| 136 | 3300005834 | Ga0068851_10322368 | Ga0068851_103223682 | 177 |
| 137 | 3300005842 | Ga0068858_100499383 | Ga0068858_1004993832 | 177 |
| 138 | 3300005842 | Ga0068858_100575771 | Ga0068858_1005757711 | 177 |
| 139 | 3300006195 | Ga0075366_10000475 | Ga0075366_100004757 | 177 |
| 140 | 3300006237 | Ga0097621_100000485 | Ga0097621_10000048519 | 177 |
| 141 | 3300006358 | Ga0068871_100001864 | Ga0068871_1000018641 | 177 |
| 142 | 3300006881 | Ga0068865_100000547 | Ga0068865_10000054723 | 177 |
| 143 | 3300006931 | Ga0097620_101884544 | Ga0097620_1018845441 | 177 |
| 144 | 3300009093 | Ga0105240_10002918 | Ga0105240_1000291822 | 177 |
| 145 | 3300009093 | Ga0105240_10062177 | Ga0105240_100621776 | 177 |
| 146 | 3300009148 | Ga0105243_10262324 | Ga0105243_102623242 | 177 |
| 147 | 3300009174 | Ga0105241_10011716 | Ga0105241_100117166 | 177 |
| 148 | 3300009174 | Ga0105241_10048381 | Ga0105241_100483815 | 177 |
| 149 | 3300009174 | Ga0105241_10078508 | Ga0105241_100785082 | 177 |
| 150 | 3300009176 | Ga0105242_10111699 | Ga0105242_101116993 | 177 |
| 151 | 3300009545 | Ga0105237_10001361 | Ga0105237_100013612 | 177 |
| 152 | 3300009545 | Ga0105237_10027123 | Ga0105237_100271233 | 177 |
| 153 | 3300009545 | Ga0105237_10163323 | Ga0105237_101633231 | 177 |
| 154 | 3300009545 | Ga0105237_10238354 | Ga0105237_102383541 | 177 |
| 155 | 3300009545 | Ga0105237_10831658 | Ga0105237_108316581 | 177 |
| 156 | 3300009551 | Ga0105238_10041692 | Ga0105238_100416923 | 177 |
| 157 | 3300009553 | Ga0105249_10086560 | Ga0105249_100865602 | 177 |
| 158 | 3300010375 | Ga0105239_10000055 | Ga0105239_100000556 | 177 |
| 159 | 3300010375 | Ga0105239_10007036 | Ga0105239_1000703616 | 177 |
| 160 | 3300010375 | Ga0105239_10016428 | Ga0105239_100164282 | 177 |
| 161 | 3300010375 | Ga0105239_10071694 | Ga0105239_100716942 | 177 |
| 162 | 3300010375 | Ga0105239_10516688 | Ga0105239_105166882 | 177 |
| 163 | 3300011119 | Ga0105246_10054856 | Ga0105246_100548562 | 177 |
| 164 | 3300013100 | Ga0157373_10070779 | Ga0157373_100707792 | 177 |
| 165 | 3300013100 | Ga0157373_10276416 | Ga0157373_102764161 | 177 |
| 166 | 3300013102 | Ga0157371_10058176 | Ga0157371_100581762 | 177 |
| 167 | 3300013102 | Ga0157371_10135474 | Ga0157371_101354742 | 177 |
| 168 | 3300013104 | Ga0157370_10062792 | Ga0157370_100627922 | 177 |
| 169 | 3300013104 | Ga0157370_10317828 | Ga0157370_103178282 | 177 |
| 170 | 3300013105 | Ga0157369_10332728 | Ga0157369_103327281 | 177 |
| 171 | 3300013296 | Ga0157374_10009378 | Ga0157374_100093786 | 177 |
| 172 | 3300013297 | Ga0157378_10108685 | Ga0157378_101086852 | 177 |
| 173 | 3300013306 | Ga0163162_10000024 | Ga0163162_1000002499 | 177 |
| 174 | 3300013306 | Ga0163162_10018481 | Ga0163162_100184813 | 177 |
| 175 | 3300013306 | Ga0163162_10332409 | Ga0163162_103324091 | 177 |
| 176 | 3300013307 | Ga0157372_10024509 | Ga0157372_100245091 | 177 |
| 177 | 3300013307 | Ga0157372_10057431 | Ga0157372_100574312 | 177 |
| 178 | 3300013307 | Ga0157372_11348759 | Ga0157372_113487591 | 177 |
| 179 | 3300013308 | Ga0157375_10092242 | Ga0157375_100922423 | 177 |
| 180 | 3300013308 | Ga0157375_10390867 | Ga0157375_103908671 | 177 |
| 181 | 3300013308 | Ga0157375_10643280 | Ga0157375_106432801 | 177 |
| 182 | 3300014325 | Ga0163163_11909974 | Ga0163163_119099741 | 177 |
| 183 | 3300014745 | Ga0157377_10007183 | Ga0157377_100071837 | 177 |
| 184 | 3300014969 | Ga0157376_10671448 | Ga0157376_106714481 | 177 |
| 185 | 3300015262 | Ga0182007_10067087 | Ga0182007_100670872 | 177 |
| 186 | 3300020075 | Ga0206349_1127433 | Ga0206349_11274331 | 177 |
| 187 | 3300020078 | Ga0206352_10960216 | Ga0206352_109602162 | 177 |
| 188 | 3300020078 | Ga0206352_10960216 | Ga0206352_109602163 | 177 |
| 189 | 3300020080 | Ga0206350_10608541 | Ga0206350_106085411 | 177 |
| 190 | 3300020081 | Ga0206354_10540776 | Ga0206354_105407761 | 177 |
| 191 | 3300020082 | Ga0206353_10901459 | Ga0206353_109014591 | 177 |
| 192 | 3300020610 | Ga0154015_1679143 | Ga0154015_16791431 | 177 |
| 193 | 3300022467 | Ga0224712_10165741 | Ga0224712_101657411 | 177 |
| 194 | 3300022467 | Ga0224712_10334625 | Ga0224712_103346251 | 177 |
| 195 | 3300025233 | Ga0209437_100024 | Ga0209437_10002462 | 177 |
| 196 | 3300025250 | Ga0209026_1000834 | Ga0209026_10008344 | 177 |
| 197 | 3300025261 | Ga0209233_1034049 | Ga0209233_10340492 | 177 |
| 198 | 3300025292 | Ga0209676_1001085 | Ga0209676_10010853 | 177 |
| 199 | 3300025904 | Ga0207647_10000051 | Ga0207647_100000512 | 177 |
| 200 | 3300025904 | Ga0207647_10038954 | Ga0207647_100389543 | 177 |
| 201 | 3300025907 | Ga0207645_10000758 | Ga0207645_1000075818 | 177 |
| 202 | 3300025909 | Ga0207705_10000132 | Ga0207705_1000013261 | 177 |
| 203 | 3300025909 | Ga0207705_10017607 | Ga0207705_100176074 | 177 |
| 204 | 3300025909 | Ga0207705_10214060 | Ga0207705_102140602 | 177 |
| 205 | 3300025911 | Ga0207654_10028434 | Ga0207654_100284342 | 177 |
| 206 | 3300025911 | Ga0207654_10041386 | Ga0207654_100413862 | 177 |
| 207 | 3300025912 | Ga0207707_10248427 | Ga0207707_102484272 | 177 |
| 208 | 3300025913 | Ga0207695_10014993 | Ga0207695_100149937 | 177 |
| 209 | 3300025913 | Ga0207695_10047616 | Ga0207695_100476162 | 177 |
| 210 | 3300025913 | Ga0207695_10099555 | Ga0207695_100995552 | 177 |
| 211 | 3300025914 | Ga0207671_10010063 | Ga0207671_100100633 | 177 |
| 212 | 3300025914 | Ga0207671_10010874 | Ga0207671_100108747 | 177 |
| 213 | 3300025914 | Ga0207671_10074859 | Ga0207671_100748596 | 177 |
| 214 | 3300025917 | Ga0207660_10130748 | Ga0207660_101307483 | 177 |
| 215 | 3300025919 | Ga0207657_10197038 | Ga0207657_101970381 | 177 |
| 216 | 3300025921 | Ga0207652_10016686 | Ga0207652_100166864 | 177 |
| 217 | 3300025924 | Ga0207694_10474198 | Ga0207694_104741982 | 177 |
| 218 | 3300025933 | Ga0207706_10000122 | Ga0207706_1000012279 | 177 |
| 219 | 3300025934 | Ga0207686_10115401 | Ga0207686_101154013 | 177 |
| 220 | 3300025938 | Ga0207704_10000041 | Ga0207704_1000004166 | 177 |
| 221 | 3300025949 | Ga0207667_10000009 | Ga0207667_10000009279 | 177 |
| 222 | 3300025949 | Ga0207667_10009241 | Ga0207667_100092412 | 177 |
| 223 | 3300025949 | Ga0207667_10068263 | Ga0207667_100682634 | 177 |
| 224 | 3300025949 | Ga0207667_10102086 | Ga0207667_101020862 | 177 |
| 225 | 3300025949 | Ga0207667_10614533 | Ga0207667_106145331 | 177 |
| 226 | 3300025961 | Ga0207712_10167378 | Ga0207712_101673782 | 177 |
| 227 | 3300025981 | Ga0207640_10184735 | Ga0207640_101847352 | 177 |
| 228 | 3300026023 | Ga0207677_10004296 | Ga0207677_100042969 | 177 |
| 229 | 3300026023 | Ga0207677_10448133 | Ga0207677_104481332 | 177 |
| 230 | 3300026035 | Ga0207703_10501290 | Ga0207703_105012901 | 177 |
| 231 | 3300026041 | Ga0207639_10014118 | Ga0207639_100141186 | 177 |
| 232 | 3300026041 | Ga0207639_10120706 | Ga0207639_101207062 | 177 |
| 233 | 3300026078 | Ga0207702_10000463 | Ga0207702_1000046330 | 177 |
| 234 | 3300026078 | Ga0207702_10320875 | Ga0207702_103208751 | 177 |
| 235 | 3300026078 | Ga0207702_11271937 | Ga0207702_112719371 | 177 |
| 236 | 3300026089 | Ga0207648_10005037 | Ga0207648_100050373 | 177 |
| 237 | 3300026121 | Ga0207683_10020990 | Ga0207683_100209905 | 177 |
| 238 | 3300026142 | Ga0207698_10043256 | Ga0207698_100432566 | 177 |
| 239 | 3300026142 | Ga0207698_10478570 | Ga0207698_104785703 | 177 |
| 240 | 3300028379 | Ga0268266_10000137 | Ga0268266_10000137124 | 177 |
| 241 | 3300028786 | Ga0307517_10002409 | Ga0307517_100024094 | 177 |
| 242 | 3300028794 | Ga0307515_10001136 | Ga0307515_1000113653 | 177 |
| 243 | 3300028794 | Ga0307515_10001915 | Ga0307515_1000191525 | 177 |
| 244 | 3300028800 | Ga0265338_10021246 | Ga0265338_100212466 | 177 |
| 245 | 3300028800 | Ga0265338_10128406 | Ga0265338_101284062 | 177 |
| 246 | 3300031548 | Ga0307408_100260066 | Ga0307408_1002600662 | 177 |
| 247 | 3300031731 | Ga0307405_10084439 | Ga0307405_100844392 | 177 |
| 248 | 3300031911 | Ga0307412_10082815 | Ga0307412_100828152 | 177 |
| 249 | 3300032004 | Ga0307414_10017890 | Ga0307414_100178902 | 177 |
| 250 | 3300033179 | Ga0307507_10000036 | Ga0307507_1000003687 | 177 |
| 251 | 3300033180 | Ga0307510_10008820 | Ga0307510_100088203 | 177 |
| 252 | 3300037312 | Ga0395899_0000033 | Ga0395899_0000033_223064_223606 | 177 |
| 253 | 3300037312 | Ga0395899_0000559 | Ga0395899_0000559_29163_29705 | 177 |
| 254 | 3300037418 | Ga0395900_0000014 | Ga0395900_0000014_289161_289703 | 177 |
| 255 | 3300037466 | Ga0395898_0055085 | Ga0395898_0055085_1189_1731 | 177 |
| 256 | 3300037471 | Ga0395905_0000241 | Ga0395905_0000241_27470_28012 | 177 |
| 257 | 3300038443 | Ga0395901_0000582 | Ga0395901_0000582_25850_26392 | 177 |
| 258 | 3300041443 | Ga0451789_0989257 | Ga0451789_0989257_12_545 | 177 |
| 259 | 3300041509 | Ga0451843_0956451 | Ga0451843_0956451_56_598 | 177 |
| 260 | 3300042005 | Ga0439448_0033131 | Ga0439448_0033131_358_900 | 177 |
| 261 | 3300046462 | Ga0495651_0052852 | Ga0495651_0052852_389_931 | 177 |
| 262 | 3300046471 | Ga0495650_0000036 | Ga0495650_0000036_362258_362800 | 177 |
| 263 | 3300046475 | Ga0495639_0100834 | Ga0495639_0100834_18_560 | 177 |
| 264 | 3300046492 | Ga0495585_0000638 | Ga0495585_0000638_27110_27652 | 177 |
| 265 | 3300046492 | Ga0495585_0000831 | Ga0495585_0000831_17456_17998 | 177 |
| 266 | 3300046501 | Ga0495607_0246064 | Ga0495607_0246064_172_714 | 177 |
| 267 | 3300046507 | Ga0495606_0000008 | Ga0495606_0000008_17992_18534 | 177 |
| 268 | 3300046507 | Ga0495606_0011907 | Ga0495606_0011907_1275_1811 | 177 |
| 269 | 3300046507 | Ga0495606_0119535 | Ga0495606_0119535_1002_1544 | 177 |
| 270 | 3300046512 | Ga0495610_0000757 | Ga0495610_0000757_3447_3989 | 177 |
| 271 | 3300046513 | Ga0495616_0018093 | Ga0495616_0018093_798_1340 | 177 |
| 272 | 3300046513 | Ga0495616_0019504 | Ga0495616_0019504_317_859 | 177 |
| 273 | 3300046518 | Ga0495631_0025183 | Ga0495631_0025183_901_1443 | 177 |
| 274 | 3300046518 | Ga0495631_0112463 | Ga0495631_0112463_246_788 | 177 |
| 275 | 3300046520 | Ga0495637_0112421 | Ga0495637_0112421_115_657 | 177 |
| 276 | 3300046524 | Ga0495648_0026895 | Ga0495648_0026895_2997_3539 | 177 |
| 277 | 3300046528 | Ga0495642_0436329 | Ga0495642_0436329_11_553 | 177 |
| 278 | 3300046538 | Ga0495609_0040270 | Ga0495609_0040270_1311_1853 | 177 |
| 279 | 3300046558 | Ga0495633_0000015 | Ga0495633_0000015_186594_187136 | 177 |
| 280 | 3300046558 | Ga0495633_0008678 | Ga0495633_0008678_727_1269 | 177 |
| 281 | 3300046616 | Ga0495668_0000010 | Ga0495668_0000010_357372_357914 | 177 |
| 282 | 3300046660 | Ga0495625_0000379 | Ga0495625_0000379_56031_56573 | 177 |
| 283 | 3300046660 | Ga0495625_0000668 | Ga0495625_0000668_48297_48839 | 177 |
| 284 | 3300046660 | Ga0495625_0002805 | Ga0495625_0002805_9418_9960 | 177 |
| 285 | 3300046660 | Ga0495625_0013569 | Ga0495625_0013569_1934_2476 | 177 |
| 286 | 3300046660 | Ga0495625_0141636 | Ga0495625_0141636_542_1084 | 177 |
| 287 | 3300046665 | Ga0495661_0001087 | Ga0495661_0001087_7361_7903 | 177 |
| 288 | 3300046665 | Ga0495661_0018152 | Ga0495661_0018152_3198_3740 | 177 |
| 289 | 3300046665 | Ga0495661_0327880 | Ga0495661_0327880_45_587 | 177 |
| 290 | 3300046683 | Ga0495658_0027360 | Ga0495658_0027360_1162_1704 | 177 |
| 291 | 3300046692 | Ga0495671_0403710 | Ga0495671_0403710_77_619 | 177 |
| 292 | 3300046694 | Ga0495649_0000010 | Ga0495649_0000010_418746_419288 | 177 |
| 293 | 3300046794 | Ga0495589_0206093 | Ga0495589_0206093_168_710 | 177 |
| 294 | 3300046810 | Ga0495660_0026516 | Ga0495660_0026516_944_1486 | 177 |
| 295 | 3300047323 | Ga0495683_0126958 | Ga0495683_0126958_372_914 | 177 |
| 296 | 3300047323 | Ga0495683_0270974 | Ga0495683_0270974_86_628 | 177 |
| 297 | 3300047443 | Ga0495687_000736 | Ga0495687_000736_166_708 | 177 |
| 298 | 3300047443 | Ga0495687_002474 | Ga0495687_002474_7286_7885 | 177 |
| 299 | 3300047445 | Ga0495677_0039820 | Ga0495677_0039820_328_870 | 177 |
| 300 | 3300047445 | Ga0495677_0121624 | Ga0495677_0121624_438_980 | 177 |
| 301 | 3300047446 | Ga0495679_096402 | Ga0495679_096402_112_654 | 177 |
| 302 | 3300047469 | Ga0495673_0061505 | Ga0495673_0061505_117_659 | 177 |
| 303 | 3300047472 | Ga0495686_0196696 | Ga0495686_0196696_356_898 | 177 |
| 304 | 3300048089 | Ga0495614_0071458 | Ga0495614_0071458_747_1289 | 177 |
| 305 | 3300049161 | Ga0501305_082575 | Ga0501305_082575_11_544 | 177 |
| 306 | 3300049459 | Ga0495678_050717 | Ga0495678_050717_683_1225 | 177 |
| 307 | 3300049705 | Ga0501225_0018500 | Ga0501225_0018500_1015_1548 | 177 |
| 308 | 3300049776 | Ga0501280_035884 | Ga0501280_035884_53_592 | 177 |
| 309 | 3300050493 | nmdc:mga0k408_276_c1 | nmdc:mga0k408_276_c1_21184_21726 | 177 |
| 310 | 3300050493 | nmdc:mga0k408_37489_c1 | nmdc:mga0k408_37489_c1_91_633 | 177 |
| 311 | 3300050496 | nmdc:mga07m45_286464_c1 | nmdc:mga07m45_286464_c1_401_934 | 177 |
| 312 | 3300053080 | Ga0500635_0002489 | Ga0500635_0002489_3821_4357 | 177 |
| 313 | 3300053122 | Ga0500608_021605 | Ga0500608_021605_1589_2131 | 177 |
| 314 | 3300053125 | Ga0500618_000163 | Ga0500618_000163_20220_20762 | 177 |
| 315 | 3300053125 | Ga0500618_001717 | Ga0500618_001717_5740_6285 | 177 |
| 316 | 3300053125 | Ga0500618_071996 | Ga0500618_071996_35_577 | 177 |
| 317 | 3300053133 | Ga0500655_090223 | Ga0500655_090223_64_606 | 177 |
| 318 | 3300053156 | Ga0500622_0115083 | Ga0500622_0115083_13_555 | 177 |
| 319 | 3300053157 | Ga0500624_000278 | Ga0500624_000278_12503_13045 | 177 |
| 320 | 3300059490 | Ga0587066_107249 | Ga0587066_107249_61_621 | 177 |
| 321 | 3300059491 | Ga0587070_097497 | Ga0587070_097497_79_621 | 177 |
| 322 | 3300059491 | Ga0587070_145365 | Ga0587070_145365_26_574 | 177 |
| 323 | 3300059492 | Ga0587073_0120824 | Ga0587073_0120824_85_627 | 177 |
| 324 | 3300059510 | Ga0587090_018786 | Ga0587090_018786_166_708 | 177 |
| 325 | 3300059643 | Ga0587072_131906 | Ga0587072_131906_17_565 | 177 |
| 326 | 3300059645 | Ga0587076_075991 | Ga0587076_075991_85_627 | 177 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1y0g-assembly2.cif.gz_D | crystal structure of the escherichia coli ycei protein, structural genomics | 0.9047 | 5 | 177 |
| 7bwl-assembly1.cif.gz_A | structure of antibiotic sequester from pseudomonas aerurinosa | 0.9 | 5 | 176 |
| 5ixh-assembly1.cif.gz_A | crystal structure of burkholderia cenocepacia bcna | 0.8954 | 8 | 172 |
| 1y0g-assembly2.cif.gz_D | crystal structure of the escherichia coli ycei protein, structural genomics | 0.8945 | 5 | 177 |
| 7bwl-assembly1.cif.gz_A | structure of antibiotic sequester from pseudomonas aerurinosa | 0.8898 | 5 | 176 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FUS9_3_167_2.40.128.110 | Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like | 0.8976 | 8 | 172 | 2.40.128.110 |
| 5w2dA01 | Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like | 0.8924 | 24 | 177 | 2.40.128.110 |
| af_P0A8X2_23_191_2.40.128.110 | Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like | 0.8896 | 2 | 177 | 2.40.128.110 |
| 5w2dA01 | Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like | 0.8868 | 24 | 177 | 2.40.128.110 |
| af_P0A8X2_23_191_2.40.128.110 | Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like | 0.8846 | 2 | 177 | 2.40.128.110 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A519PIA1-F1-model_v4 | deleted | 0.9775 | 1 | 135 |
|
| AF-A0A7V3UVE4-F1-model_v4 | Polyisoprenoid-binding protein | 0.976 | 3 | 141 |
|
| AF-A0A2Z4GHW6-F1-model_v4 | Polyisoprenoid-binding protein | 0.9574 | 2 | 176 |
|
| AF-A0A519PIA1-F1-model_v4 | deleted | 0.9566 | 1 | 135 |
|
| AF-A0A2D2AXC0-F1-model_v4 | Polyisoprenoid-binding protein | 0.953 | 5 | 177 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar