F408494

General Info

Members Datasets Scaffolds Average Seq Length
326 198 315 179

Family's Representative Sequence

Representative Sequence 3300047443|Ga0495687_002474|Ga0495687_002474_7286_7885
Length 199
Sequence MFKHLFLYYLCINKKEIKIMATETATKWVIDPMHSEVQFKVKHLVISTVSGFFKSFNGELLTDNDDFDNAEIDFALDINSIDTNQTQRDEHLKSAEFFDAEKYPQITFKSTSFTKTDDEEYELKGNLTIKDQTKPVTLDVEFGGSAADFYGNTKAGFEISGKINRKDFGLTWDGVTEAGSIVVGEDIKLLINIQFTKQA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
3 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
4 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
5 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
6 2884933994 Mucilaginibacter sp. 14171R-50 Isolate Rhizosphere
7 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
8 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
9 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
10 2929239360 Chitinophaga sp. R-73072 Hybrid assembly Isolate Unclassified
11 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
12 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
13 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
14 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
15 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
16 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
17 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
18 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
19 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
20 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
21 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
22 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
23 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
24 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
25 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
26 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
27 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
28 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
29 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
30 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
31 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
32 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
33 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
36 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
69 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
70 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
71 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
72 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
73 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
78 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
79 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
85 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
88 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
89 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
90 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
91 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
122 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
123 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
124 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
125 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
126 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
127 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
128 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
129 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
130 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
133 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
135 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
136 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
139 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
140 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
141 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
142 3300041446 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaT Metatranscriptome Rhizoplane
143 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
144 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
145 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
146 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
147 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
148 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
149 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
150 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
151 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
152 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
153 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
154 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
155 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
156 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
157 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
158 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
159 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
160 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
161 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
162 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
163 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
164 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
165 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
166 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
167 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
168 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
169 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
170 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
171 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
172 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
173 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
174 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
175 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
176 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
177 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
178 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
179 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
180 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
181 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
184 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
185 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
186 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
187 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
188 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
189 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
190 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
191 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
192 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
193 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 88.34
Metatranscriptomes 8.59
Isolates 3.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.59
Nodule 0
Rhizoplane 1.84
Rhizosphere 82.82
Stem 0
Stem Tuber 0
Unclassified 6.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_445390 2162886007 Bacteria 1020
2 JGI24736J21556_1002031 3300001904 Bacteria 3599
3 JGI24736J21556_1003568 3300001904 Bacteria 2691
4 JGI24740J21852_10034402 3300001979 Bacteria 1596
5 JGI24737J22298_10002429 3300001990 Bacteria 6642
6 JGI24737J22298_10009574 3300001990 Bacteria 3215
7 JGI24737J22298_10071228 3300001990 Bacteria 1038
8 JGI24735J21928_10000028 3300002067 Bacteria 83192
9 JGI24735J21928_10122562 3300002067 Bacteria 749
10 JGI24744J21845_10006132 3300002077 Bacteria 2492
11 JGI25162J39368_1000779 3300002737 Bacteria 21435
12 JGI25164J39214_1002113 3300002772 Bacteria 3370
13 JGI25165J46597_1000978 3300003214 Bacteria 19157
14 rootH1_10015994 3300003316 Bacteria 7435
15 rootH2_10008988 3300003320 Bacteria 1557
16 rootH2_10195773 3300003320 Bacteria 3047
17 rootL2_10091311 3300003322 Bacteria 3634
18 rootH1_10050118 3300003323 Bacteria 18955
19 rootH1_10126289 3300003323 Bacteria 2508
20 rootH1_10138304 3300003323 Bacteria 3869
21 rootH1_10210384 3300003323 Bacteria 4153
22 Ga0055536_1012340 3300003781 Bacteria 3180
23 Ga0058863_11967364 3300004799 Bacteria 1548
24 Ga0058861_10098132 3300004800 Bacteria 1333
25 Ga0065165_1000131 3300005262 Bacteria 128880
26 Ga0065714_10021210 3300005288 Bacteria 1382
27 Ga0065714_10119652 3300005288 Bacteria 1364
28 Ga0065704_10146652 3300005289 Bacteria 1465
29 Ga0070658_10000091 3300005327 Bacteria 81263
30 Ga0070658_10024684 3300005327 Bacteria 4820
31 Ga0070658_10284030 3300005327 Bacteria 1409
32 Ga0070658_10447751 3300005327 Bacteria 1112
33 Ga0070658_10745663 3300005327 Bacteria 850
34 Ga0070658_10880815 3300005327 Bacteria 778
35 Ga0070676_10000187 3300005328 Bacteria 25771
36 Ga0070683_100643439 3300005329 Bacteria 1015
37 Ga0070680_100029221 3300005336 Bacteria 4428
38 Ga0068868_100122281 3300005338 Bacteria 2124
39 Ga0068868_100263994 3300005338 Bacteria 1453
40 Ga0070660_100019852 3300005339 Bacteria 4930
41 Ga0070688_100197846 3300005365 Bacteria 1404
42 Ga0070659_100011576 3300005366 Bacteria 6529
43 Ga0070678_100023731 3300005456 Bacteria 4093
44 Ga0070662_100000011 3300005457 Bacteria 133652
45 Ga0070681_10349807 3300005458 Bacteria 1388
46 Ga0070679_100024113 3300005530 Bacteria 5961
47 Ga0068853_100136936 3300005539 Bacteria 2196
48 Ga0068853_100145671 3300005539 Bacteria 2128
49 Ga0068853_100500451 3300005539 Bacteria 1147
50 Ga0070665_100000003 3300005548 Bacteria 811857
51 Ga0068855_100000887 3300005563 Bacteria 37113
52 Ga0068855_100024100 3300005563 Bacteria 7284
53 Ga0068855_100154630 3300005563 Bacteria 2607
54 Ga0068855_100252207 3300005563 Bacteria 1968
55 Ga0068855_101040023 3300005563 Bacteria 859
56 Ga0068857_100061929 3300005577 Bacteria 3325
57 Ga0068857_101191198 3300005577 Bacteria 737
58 Ga0068856_100233850 3300005614 Bacteria 1853
59 Ga0068856_100294747 3300005614 Bacteria 1639
60 Ga0068856_100415087 3300005614 Bacteria 1366
61 Ga0068852_100012163 3300005616 Bacteria 6519
62 Ga0068852_100505188 3300005616 Bacteria 1204
63 Ga0068859_101884533 3300005617 Bacteria 660
64 Ga0068866_10539108 3300005718 Unclassified 778
65 Ga0068851_10322368 3300005834 Bacteria 893
66 Ga0068858_100499383 3300005842 Bacteria 1175
67 Ga0068858_100575771 3300005842 Bacteria 1091
68 Ga0075366_10000333 3300006195 Bacteria 21671
69 Ga0075366_10000475 3300006195 Bacteria 18607
70 Ga0097621_100000485 3300006237 Bacteria 27776
71 Ga0068871_100001864 3300006358 Bacteria 14258
72 Ga0068865_100000547 3300006881 Bacteria 20866
73 Ga0097620_101884544 3300006931 Bacteria 660
74 Ga0105240_10000722 3300009093 Bacteria 60400
75 Ga0105240_10002918 3300009093 Bacteria 26976
76 Ga0105240_10062177 3300009093 Bacteria 4649
77 Ga0105240_10100481 3300009093 Bacteria 3520
78 Ga0105240_10558934 3300009093 Bacteria 1265
79 Ga0105243_10262324 3300009148 Bacteria 1547
80 Ga0105241_10007064 3300009174 Bacteria 8267
81 Ga0105241_10011716 3300009174 Bacteria 6438
82 Ga0105241_10048381 3300009174 Bacteria 3236
83 Ga0105241_10078508 3300009174 Bacteria 2579
84 Ga0105242_10111699 3300009176 Bacteria 2331
85 Ga0105237_10001361 3300009545 Bacteria 32387
86 Ga0105237_10021690 3300009545 Bacteria 6601
87 Ga0105237_10027123 3300009545 Bacteria 5851
88 Ga0105237_10163323 3300009545 Bacteria 2226
89 Ga0105237_10238354 3300009545 Bacteria 1820
90 Ga0105237_10831658 3300009545 Bacteria 930
91 Ga0105238_10041692 3300009551 Bacteria 4649
92 Ga0105238_10989180 3300009551 Bacteria 862
93 Ga0105249_10086560 3300009553 Bacteria 2922
94 Ga0105239_10000002 3300010375 Bacteria 610298
95 Ga0105239_10000055 3300010375 Bacteria 158211
96 Ga0105239_10007036 3300010375 Bacteria 12946
97 Ga0105239_10016428 3300010375 Bacteria 8184
98 Ga0105239_10053411 3300010375 Bacteria 4433
99 Ga0105239_10071694 3300010375 Bacteria 3806
100 Ga0105239_10516688 3300010375 Bacteria 1358
101 Ga0105246_10054856 3300011119 Bacteria 2748
102 Ga0157373_10000273 3300013100 Bacteria 41492
103 Ga0157373_10010268 3300013100 Bacteria 6898
104 Ga0157373_10070779 3300013100 Bacteria 2465
105 Ga0157373_10276416 3300013100 Bacteria 1190
106 Ga0157371_10000216 3300013102 Bacteria 83975
107 Ga0157371_10058176 3300013102 Bacteria 2742
108 Ga0157371_10135474 3300013102 Bacteria 1753
109 Ga0157370_10040951 3300013104 Bacteria 4471
110 Ga0157370_10062792 3300013104 Bacteria 3522
111 Ga0157370_10317828 3300013104 Unclassified 1436
112 Ga0157369_10139434 3300013105 Bacteria 2566
113 Ga0157369_10332728 3300013105 Bacteria 1578
114 Ga0157374_10009378 3300013296 Bacteria 8398
115 Ga0157378_10108685 3300013297 Bacteria 2540
116 Ga0163162_10000024 3300013306 Bacteria 188515
117 Ga0163162_10018481 3300013306 Bacteria 6831
118 Ga0163162_10332409 3300013306 Bacteria 1652
119 Ga0157372_10000196 3300013307 Bacteria 66430
120 Ga0157372_10000428 3300013307 Bacteria 46270
121 Ga0157372_10024509 3300013307 Bacteria 6555
122 Ga0157372_10057431 3300013307 Bacteria 4350
123 Ga0157372_11348759 3300013307 Bacteria 823
124 Ga0157375_10092242 3300013308 Bacteria 3092
125 Ga0157375_10390867 3300013308 Bacteria 1558
126 Ga0157375_10643280 3300013308 Bacteria 1217
127 Ga0163163_11909974 3300014325 Bacteria 654
128 Ga0157377_10007183 3300014745 Bacteria 5362
129 Ga0157377_10371974 3300014745 Bacteria 965
130 Ga0157376_10671448 3300014969 Bacteria 1039
131 Ga0182007_10067087 3300015262 Bacteria 1175
132 Ga0206349_1127433 3300020075 Bacteria 636
133 Ga0206349_1969753 3300020075 Bacteria 665
134 Ga0206352_10504457 3300020078 Bacteria 660
135 Ga0206352_10960216 3300020078 Bacteria 1878
136 Ga0206352_11233509 3300020078 Bacteria 619
137 Ga0206350_10608541 3300020080 Bacteria 729
138 Ga0206354_10540776 3300020081 Bacteria 706
139 Ga0206353_10901459 3300020082 Bacteria 807
140 Ga0154015_1679143 3300020610 Bacteria 794
141 Ga0224712_10165741 3300022467 Bacteria 988
142 Ga0224712_10334625 3300022467 Bacteria 713
143 Ga0209563_107933 3300025230 Bacteria 1706
144 Ga0207427_100580 3300025231 Bacteria 18471
145 Ga0209437_100024 3300025233 Bacteria 592878
146 Ga0209437_100101 3300025233 Bacteria 226668
147 Ga0209026_1000834 3300025250 Bacteria 16276
148 Ga0209233_1000124 3300025261 Bacteria 226743
149 Ga0209233_1000396 3300025261 Bacteria 36455
150 Ga0209233_1034049 3300025261 Bacteria 1163
151 Ga0209455_1010888 3300025272 Bacteria 2278
152 Ga0209676_1001085 3300025292 Bacteria 30593
153 Ga0207647_10000051 3300025904 Bacteria 87826
154 Ga0207647_10000149 3300025904 Bacteria 55611
155 Ga0207647_10038954 3300025904 Bacteria 3002
156 Ga0207645_10000758 3300025907 Bacteria 26866
157 Ga0207705_10000132 3300025909 Bacteria 81270
158 Ga0207705_10017607 3300025909 Bacteria 5114
159 Ga0207705_10214060 3300025909 Bacteria 1462
160 Ga0207654_10028434 3300025911 Bacteria 3047
161 Ga0207654_10041386 3300025911 Bacteria 2601
162 Ga0207707_10248427 3300025912 Bacteria 1546
163 Ga0207695_10000013 3300025913 Bacteria 821265
164 Ga0207695_10014993 3300025913 Bacteria 9144
165 Ga0207695_10047616 3300025913 Bacteria 4535
166 Ga0207695_10099555 3300025913 Bacteria 2904
167 Ga0207695_10210737 3300025913 Bacteria 1854
168 Ga0207671_10002500 3300025914 Bacteria 19619
169 Ga0207671_10010063 3300025914 Bacteria 7841
170 Ga0207671_10010874 3300025914 Bacteria 7464
171 Ga0207671_10074859 3300025914 Bacteria 2531
172 Ga0207660_10130748 3300025917 Bacteria 1911
173 Ga0207657_10197038 3300025919 Bacteria 1622
174 Ga0207652_10016686 3300025921 Bacteria 6001
175 Ga0207694_10269078 3300025924 Bacteria 1397
176 Ga0207694_10474198 3300025924 Bacteria 1046
177 Ga0207690_10007381 3300025932 Bacteria 6526
178 Ga0207706_10000122 3300025933 Bacteria 83838
179 Ga0207686_10115401 3300025934 Bacteria 1818
180 Ga0207704_10000041 3300025938 Bacteria 89976
181 Ga0207661_10343735 3300025944 Bacteria 1345
182 Ga0207667_10000009 3300025949 Bacteria 603135
183 Ga0207667_10009241 3300025949 Bacteria 11638
184 Ga0207667_10068263 3300025949 Bacteria 3702
185 Ga0207667_10102086 3300025949 Bacteria 2958
186 Ga0207667_10614533 3300025949 Bacteria 1095
187 Ga0207712_10167378 3300025961 Bacteria 1714
188 Ga0207640_10184735 3300025981 Bacteria 1566
189 Ga0207677_10004296 3300026023 Bacteria 7629
190 Ga0207677_10448133 3300026023 Bacteria 1105
191 Ga0207703_10501290 3300026035 Bacteria 1140
192 Ga0207639_10014118 3300026041 Bacteria 5609
193 Ga0207639_10120706 3300026041 Bacteria 2153
194 Ga0207702_10000463 3300026078 Bacteria 45983
195 Ga0207702_10320875 3300026078 Bacteria 1475
196 Ga0207702_11271937 3300026078 Bacteria 730
197 Ga0207648_10005037 3300026089 Bacteria 13403
198 Ga0207674_10207377 3300026116 Bacteria 1909
199 Ga0207683_10020990 3300026121 Bacteria 5590
200 Ga0207698_10043256 3300026142 Bacteria 3373
201 Ga0207698_10478570 3300026142 Bacteria 1207
202 Ga0268266_10000137 3300028379 Bacteria 140685
203 Ga0307517_10002409 3300028786 Bacteria 29976
204 Ga0307515_10001136 3300028794 Bacteria 61007
205 Ga0307515_10001915 3300028794 Bacteria 46153
206 Ga0307515_10105586 3300028794 Bacteria 3351
207 Ga0265338_10021246 3300028800 Bacteria 6780
208 Ga0265338_10128406 3300028800 Bacteria 2007
209 Ga0316177_1153433 3300030731 Bacteria 4028
210 Ga0316176_1047921 3300030732 Bacteria 7939
211 Ga0316183_1151961 3300030742 Bacteria 8748
212 Ga0316181_1221153 3300030744 Bacteria 21505
213 Ga0316182_1007477 3300030745 Bacteria 1508
214 Ga0307408_100260066 3300031548 Bacteria 1436
215 Ga0307405_10084439 3300031731 Bacteria 2084
216 Ga0307412_10082815 3300031911 Bacteria 2222
217 Ga0307414_10017890 3300032004 Bacteria 4348
218 Ga0307414_10032297 3300032004 Bacteria 3445
219 Ga0307414_10335608 3300032004 Bacteria 1292
220 Ga0316593_10055307 3300032168 Unclassified 1348
221 Ga0316593_10067633 3300032168 Bacteria 1231
222 Ga0307507_10000036 3300033179 Bacteria 187512
223 Ga0307510_10008820 3300033180 Bacteria 12018
224 Ga0395899_0000033 3300037312 Bacteria 306589
225 Ga0395899_0000559 3300037312 Bacteria 39854
226 Ga0395899_0301463 3300037312 Bacteria 1084
227 Ga0395900_0000014 3300037418 Bacteria 386513
228 Ga0395900_0041697 3300037418 Bacteria 4731
229 Ga0395900_0711873 3300037418 Bacteria 937
230 Ga0395898_0055085 3300037466 Bacteria 3879
231 Ga0395905_0000241 3300037471 Bacteria 82847
232 Ga0395901_0000582 3300038443 Bacteria 42425
233 Ga0395901_0203291 3300038443 Bacteria 2076
234 Ga0451789_0989257 3300041443 Bacteria 572
235 Ga0451794_21441 3300041446 Bacteria 535
236 Ga0451794_32275 3300041446 Bacteria 587
237 Ga0451793_1272196 3300041452 Bacteria 3350
238 Ga0451807_2076529 3300041486 Bacteria 791
239 Ga0451843_0956451 3300041509 Bacteria 687
240 Ga0439448_0033131 3300042005 Bacteria 1647
241 Ga0453684_0874720 3300044712 Unclassified 964
242 Ga0495651_0052852 3300046462 Bacteria 3128
243 Ga0495650_0000036 3300046471 Bacteria 400633
244 Ga0495639_0100834 3300046475 Bacteria 1363
245 Ga0495585_0000638 3300046492 Bacteria 32286
246 Ga0495585_0000831 3300046492 Bacteria 26632
247 Ga0495607_0246064 3300046501 Bacteria 863
248 Ga0495606_0000008 3300046507 Bacteria 321373
249 Ga0495606_0011907 3300046507 Bacteria 7036
250 Ga0495606_0119535 3300046507 Bacteria 1578
251 Ga0495610_0000757 3300046512 Bacteria 30503
252 Ga0495616_0018093 3300046513 Bacteria 3877
253 Ga0495616_0019504 3300046513 Bacteria 3700
254 Ga0495631_0025183 3300046518 Bacteria 2742
255 Ga0495631_0112463 3300046518 Bacteria 1171
256 Ga0495637_0112421 3300046520 Bacteria 1054
257 Ga0495648_0026895 3300046524 Bacteria 3862
258 Ga0495642_0436329 3300046528 Unclassified 578
259 Ga0495609_0040270 3300046538 Bacteria 2103
260 Ga0495633_0000015 3300046558 Bacteria 254484
261 Ga0495633_0008678 3300046558 Bacteria 5704
262 Ga0495668_0000010 3300046616 Bacteria 487308
263 Ga0495625_0000379 3300046660 Bacteria 67828
264 Ga0495625_0000668 3300046660 Bacteria 48864
265 Ga0495625_0002805 3300046660 Bacteria 18362
266 Ga0495625_0013569 3300046660 Bacteria 6537
267 Ga0495625_0141636 3300046660 Bacteria 1621
268 Ga0495625_0607081 3300046660 Bacteria 656
269 Ga0495661_0001087 3300046665 Bacteria 23875
270 Ga0495661_0018152 3300046665 Bacteria 4632
271 Ga0495661_0327880 3300046665 Unclassified 759
272 Ga0495658_0027360 3300046683 Bacteria 3068
273 Ga0495671_0403710 3300046692 Bacteria 654
274 Ga0495649_0000010 3300046694 Bacteria 430552
275 Ga0495589_0206093 3300046794 Bacteria 927
276 Ga0495660_0026516 3300046810 Bacteria 3285
277 Ga0495683_0126958 3300047323 Bacteria 1206
278 Ga0495683_0270974 3300047323 Bacteria 738
279 Ga0495687_000736 3300047443 Bacteria 35743
280 Ga0495687_002474 3300047443 Bacteria 14740
281 Ga0495677_0039820 3300047445 Bacteria 1718
282 Ga0495677_0121624 3300047445 Bacteria 996
283 Ga0495679_096402 3300047446 Bacteria 825
284 Ga0495673_0061505 3300047469 Bacteria 1607
285 Ga0495686_0041105 3300047472 Bacteria 2945
286 Ga0495686_0152593 3300047472 Bacteria 1355
287 Ga0495686_0196696 3300047472 Bacteria 1159
288 Ga0495614_0071458 3300048089 Bacteria 1496
289 Ga0496125_0000031 3300048928 Bacteria 365156
290 Ga0496126_0001893 3300048929 Bacteria 30186
291 Ga0501305_082575 3300049161 Bacteria 579
292 Ga0495678_050717 3300049459 Bacteria 1607
293 Ga0501316_059596 3300049532 Bacteria 563
294 Ga0501320_027636 3300049536 Bacteria 691
295 Ga0501225_0018500 3300049705 Bacteria 1931
296 Ga0501280_035884 3300049776 Bacteria 789
297 nmdc:mga0k408_105_c1 3300050493 Bacteria 39936
298 nmdc:mga0k408_276_c1 3300050493 Bacteria 27939
299 nmdc:mga0k408_37489_c1 3300050493 Bacteria 2783
300 nmdc:mga07m45_286464_c1 3300050496 Bacteria 958
301 Ga0500635_0002489 3300053080 Bacteria 4570
302 Ga0500608_021605 3300053122 Bacteria 2975
303 Ga0500618_000163 3300053125 Bacteria 55548
304 Ga0500618_001717 3300053125 Bacteria 9331
305 Ga0500618_071996 3300053125 Bacteria 775
306 Ga0500655_090223 3300053133 Bacteria 636
307 Ga0500622_0115083 3300053156 Bacteria 1310
308 Ga0500624_000278 3300053157 Bacteria 17649
309 Ga0587066_107249 3300059490 Bacteria 643
310 Ga0587070_097497 3300059491 Bacteria 671
311 Ga0587070_145365 3300059491 Bacteria 590
312 Ga0587073_0120824 3300059492 Bacteria 707
313 Ga0587090_018786 3300059510 Bacteria 1060
314 Ga0587072_131906 3300059643 Bacteria 589
315 Ga0587076_075991 3300059645 Bacteria 707

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2842903701 2842908076 150
2 3300047472 Ga0495686_0152593 Ga0495686_0152593_64_582 160
3 3300038443 Ga0395901_0203291 Ga0395901_0203291_30_518 162
4 3300041446 Ga0451794_21441 Ga0451794_21441_18_521 167
5 3300046660 Ga0495625_0607081 Ga0495625_0607081_126_629 167
6 3300049532 Ga0501316_059596 Ga0501316_059596_11_535 167
7 iso_pu_bacteria 2929239360 2929242229 167
8 3300003323 rootH1_10050118 rootH1_100501183 169
9 3300032168 Ga0316593_10067633 Ga0316593_100676332 171
10 3300001904 JGI24736J21556_1003568 JGI24736J21556_10035682 172
11 3300001979 JGI24740J21852_10034402 JGI24740J21852_100344022 172
12 3300001990 JGI24737J22298_10071228 JGI24737J22298_100712282 172
13 3300002067 JGI24735J21928_10122562 JGI24735J21928_101225621 172
14 3300002737 JGI25162J39368_1000779 JGI25162J39368_100077910 172
15 3300002772 JGI25164J39214_1002113 JGI25164J39214_10021134 172
16 3300003214 JGI25165J46597_1000978 JGI25165J46597_100097813 172
17 3300005327 Ga0070658_10880815 Ga0070658_108808152 172
18 3300005329 Ga0070683_100643439 Ga0070683_1006434392 172
19 3300005366 Ga0070659_100011576 Ga0070659_1000115761 172
20 3300005577 Ga0068857_100061929 Ga0068857_1000619295 172
21 3300009093 Ga0105240_10100481 Ga0105240_101004812 172
22 3300009093 Ga0105240_10558934 Ga0105240_105589342 172
23 3300010375 Ga0105239_10000002 Ga0105239_10000002364 172
24 3300013100 Ga0157373_10000273 Ga0157373_100002732 172
25 3300013100 Ga0157373_10010268 Ga0157373_100102688 172
26 3300013102 Ga0157371_10000216 Ga0157371_1000021669 172
27 3300013104 Ga0157370_10040951 Ga0157370_100409511 172
28 3300013105 Ga0157369_10139434 Ga0157369_101394342 172
29 3300013307 Ga0157372_10000196 Ga0157372_1000019627 172
30 3300013307 Ga0157372_10000428 Ga0157372_1000042821 172
31 3300014745 Ga0157377_10371974 Ga0157377_103719742 172
32 3300020075 Ga0206349_1969753 Ga0206349_19697531 172
33 3300020078 Ga0206352_10504457 Ga0206352_105044572 172
34 3300020078 Ga0206352_11233509 Ga0206352_112335091 172
35 3300025230 Ga0209563_107933 Ga0209563_1079331 172
36 3300025231 Ga0207427_100580 Ga0207427_1005808 172
37 3300025233 Ga0209437_100101 Ga0209437_10010115 172
38 3300025261 Ga0209233_1000124 Ga0209233_1000124221 172
39 3300025261 Ga0209233_1000396 Ga0209233_100039617 172
40 3300025904 Ga0207647_10000149 Ga0207647_1000014944 172
41 3300025913 Ga0207695_10210737 Ga0207695_102107372 172
42 3300025932 Ga0207690_10007381 Ga0207690_100073818 172
43 3300025944 Ga0207661_10343735 Ga0207661_103437352 172
44 3300026116 Ga0207674_10207377 Ga0207674_102073771 172
45 3300032168 Ga0316593_10055307 Ga0316593_100553072 172
46 3300037418 Ga0395900_0711873 Ga0395900_0711873_358_876 172
47 3300047472 Ga0495686_0041105 Ga0495686_0041105_229_756 172
48 iso_pu_bacteria 2852623160 2852623864 172
49 iso_pu_bacteria 2884933994 2884937232 172
50 3300030731 Ga0316177_1153433 Ga0316177_11534333 173
51 3300030732 Ga0316176_1047921 Ga0316176_10479214 173
52 3300030742 Ga0316183_1151961 Ga0316183_11519613 173
53 3300030744 Ga0316181_1221153 Ga0316181_12211536 173
54 3300030745 Ga0316182_1007477 Ga0316182_10074772 173
55 iso_pu_bacteria 2522125168 2522549483 173
56 3300032004 Ga0307414_10335608 Ga0307414_103356082 174
57 iso_pu_bacteria 2599185184 2599480985 174
58 iso_pu_bacteria 2919437846 2919438489 174
59 iso_pu_bacteria 2928078545 2928080898 174
60 iso_pu_bacteria 2928147474 2928150196 174
61 iso_pu_bacteria 2932082852 2932088236 174
62 3300009093 Ga0105240_10000722 Ga0105240_1000072261 175
63 3300009174 Ga0105241_10007064 Ga0105241_100070644 175
64 3300009545 Ga0105237_10021690 Ga0105237_100216906 175
65 3300009551 Ga0105238_10989180 Ga0105238_109891801 175
66 3300010375 Ga0105239_10053411 Ga0105239_100534114 175
67 3300025913 Ga0207695_10000013 Ga0207695_10000013103 175
68 3300025914 Ga0207671_10002500 Ga0207671_1000250011 175
69 3300025924 Ga0207694_10269078 Ga0207694_102690781 175
70 3300003320 rootH2_10195773 rootH2_101957733 176
71 3300005288 Ga0065714_10021210 Ga0065714_100212102 176
72 3300006195 Ga0075366_10000333 Ga0075366_1000033313 176
73 3300025272 Ga0209455_1010888 Ga0209455_10108882 176
74 3300028794 Ga0307515_10105586 Ga0307515_101055862 176
75 3300032004 Ga0307414_10032297 Ga0307414_100322973 176
76 3300037312 Ga0395899_0301463 Ga0395899_0301463_21_575 176
77 3300037418 Ga0395900_0041697 Ga0395900_0041697_523_1077 176
78 3300041446 Ga0451794_32275 Ga0451794_32275_32_565 176
79 3300041452 Ga0451793_1272196 Ga0451793_1272196_1824_2357 176
80 3300041486 Ga0451807_2076529 Ga0451807_2076529_164_694 176
81 3300044712 Ga0453684_0874720 Ga0453684_0874720_107_646 176
82 3300048928 Ga0496125_0000031 Ga0496125_0000031_253750_254280 176
83 3300048929 Ga0496126_0001893 Ga0496126_0001893_11989_12519 176
84 3300049536 Ga0501320_027636 Ga0501320_027636_145_675 176
85 3300050493 nmdc:mga0k408_105_c1 nmdc:mga0k408_105_c1_6032_6565 176
86 2162886007 SwRhRL2b_contig_445390 SwRhRL2b_0900.00002230 177
87 3300001904 JGI24736J21556_1002031 JGI24736J21556_10020314 177
88 3300001990 JGI24737J22298_10002429 JGI24737J22298_100024294 177
89 3300001990 JGI24737J22298_10009574 JGI24737J22298_100095742 177
90 3300002067 JGI24735J21928_10000028 JGI24735J21928_1000002860 177
91 3300002077 JGI24744J21845_10006132 JGI24744J21845_100061322 177
92 3300003316 rootH1_10015994 rootH1_100159942 177
93 3300003320 rootH2_10008988 rootH2_100089883 177
94 3300003322 rootL2_10091311 rootL2_100913112 177
95 3300003323 rootH1_10126289 rootH1_101262891 177
96 3300003323 rootH1_10138304 rootH1_101383045 177
97 3300003323 rootH1_10210384 rootH1_102103842 177
98 3300003781 Ga0055536_1012340 Ga0055536_10123403 177
99 3300004799 Ga0058863_11967364 Ga0058863_119673643 177
100 3300004800 Ga0058861_10098132 Ga0058861_100981321 177
101 3300005262 Ga0065165_1000131 Ga0065165_1000131109 177
102 3300005288 Ga0065714_10119652 Ga0065714_101196521 177
103 3300005289 Ga0065704_10146652 Ga0065704_101466521 177
104 3300005327 Ga0070658_10000091 Ga0070658_1000009161 177
105 3300005327 Ga0070658_10024684 Ga0070658_100246842 177
106 3300005327 Ga0070658_10284030 Ga0070658_102840302 177
107 3300005327 Ga0070658_10447751 Ga0070658_104477512 177
108 3300005327 Ga0070658_10745663 Ga0070658_107456631 177
109 3300005328 Ga0070676_10000187 Ga0070676_100001873 177
110 3300005336 Ga0070680_100029221 Ga0070680_1000292212 177
111 3300005338 Ga0068868_100122281 Ga0068868_1001222812 177
112 3300005338 Ga0068868_100263994 Ga0068868_1002639942 177
113 3300005339 Ga0070660_100019852 Ga0070660_1000198521 177
114 3300005365 Ga0070688_100197846 Ga0070688_1001978462 177
115 3300005456 Ga0070678_100023731 Ga0070678_1000237314 177
116 3300005457 Ga0070662_100000011 Ga0070662_10000001160 177
117 3300005458 Ga0070681_10349807 Ga0070681_103498072 177
118 3300005530 Ga0070679_100024113 Ga0070679_1000241134 177
119 3300005539 Ga0068853_100136936 Ga0068853_1001369363 177
120 3300005539 Ga0068853_100145671 Ga0068853_1001456712 177
121 3300005539 Ga0068853_100500451 Ga0068853_1005004511 177
122 3300005548 Ga0070665_100000003 Ga0070665_100000003128 177
123 3300005563 Ga0068855_100000887 Ga0068855_10000088721 177
124 3300005563 Ga0068855_100024100 Ga0068855_1000241003 177
125 3300005563 Ga0068855_100154630 Ga0068855_1001546301 177
126 3300005563 Ga0068855_100252207 Ga0068855_1002522072 177
127 3300005563 Ga0068855_101040023 Ga0068855_1010400232 177
128 3300005577 Ga0068857_101191198 Ga0068857_1011911982 177
129 3300005614 Ga0068856_100233850 Ga0068856_1002338502 177
130 3300005614 Ga0068856_100294747 Ga0068856_1002947471 177
131 3300005614 Ga0068856_100415087 Ga0068856_1004150871 177
132 3300005616 Ga0068852_100012163 Ga0068852_1000121638 177
133 3300005616 Ga0068852_100505188 Ga0068852_1005051882 177
134 3300005617 Ga0068859_101884533 Ga0068859_1018845331 177
135 3300005718 Ga0068866_10539108 Ga0068866_105391081 177
136 3300005834 Ga0068851_10322368 Ga0068851_103223682 177
137 3300005842 Ga0068858_100499383 Ga0068858_1004993832 177
138 3300005842 Ga0068858_100575771 Ga0068858_1005757711 177
139 3300006195 Ga0075366_10000475 Ga0075366_100004757 177
140 3300006237 Ga0097621_100000485 Ga0097621_10000048519 177
141 3300006358 Ga0068871_100001864 Ga0068871_1000018641 177
142 3300006881 Ga0068865_100000547 Ga0068865_10000054723 177
143 3300006931 Ga0097620_101884544 Ga0097620_1018845441 177
144 3300009093 Ga0105240_10002918 Ga0105240_1000291822 177
145 3300009093 Ga0105240_10062177 Ga0105240_100621776 177
146 3300009148 Ga0105243_10262324 Ga0105243_102623242 177
147 3300009174 Ga0105241_10011716 Ga0105241_100117166 177
148 3300009174 Ga0105241_10048381 Ga0105241_100483815 177
149 3300009174 Ga0105241_10078508 Ga0105241_100785082 177
150 3300009176 Ga0105242_10111699 Ga0105242_101116993 177
151 3300009545 Ga0105237_10001361 Ga0105237_100013612 177
152 3300009545 Ga0105237_10027123 Ga0105237_100271233 177
153 3300009545 Ga0105237_10163323 Ga0105237_101633231 177
154 3300009545 Ga0105237_10238354 Ga0105237_102383541 177
155 3300009545 Ga0105237_10831658 Ga0105237_108316581 177
156 3300009551 Ga0105238_10041692 Ga0105238_100416923 177
157 3300009553 Ga0105249_10086560 Ga0105249_100865602 177
158 3300010375 Ga0105239_10000055 Ga0105239_100000556 177
159 3300010375 Ga0105239_10007036 Ga0105239_1000703616 177
160 3300010375 Ga0105239_10016428 Ga0105239_100164282 177
161 3300010375 Ga0105239_10071694 Ga0105239_100716942 177
162 3300010375 Ga0105239_10516688 Ga0105239_105166882 177
163 3300011119 Ga0105246_10054856 Ga0105246_100548562 177
164 3300013100 Ga0157373_10070779 Ga0157373_100707792 177
165 3300013100 Ga0157373_10276416 Ga0157373_102764161 177
166 3300013102 Ga0157371_10058176 Ga0157371_100581762 177
167 3300013102 Ga0157371_10135474 Ga0157371_101354742 177
168 3300013104 Ga0157370_10062792 Ga0157370_100627922 177
169 3300013104 Ga0157370_10317828 Ga0157370_103178282 177
170 3300013105 Ga0157369_10332728 Ga0157369_103327281 177
171 3300013296 Ga0157374_10009378 Ga0157374_100093786 177
172 3300013297 Ga0157378_10108685 Ga0157378_101086852 177
173 3300013306 Ga0163162_10000024 Ga0163162_1000002499 177
174 3300013306 Ga0163162_10018481 Ga0163162_100184813 177
175 3300013306 Ga0163162_10332409 Ga0163162_103324091 177
176 3300013307 Ga0157372_10024509 Ga0157372_100245091 177
177 3300013307 Ga0157372_10057431 Ga0157372_100574312 177
178 3300013307 Ga0157372_11348759 Ga0157372_113487591 177
179 3300013308 Ga0157375_10092242 Ga0157375_100922423 177
180 3300013308 Ga0157375_10390867 Ga0157375_103908671 177
181 3300013308 Ga0157375_10643280 Ga0157375_106432801 177
182 3300014325 Ga0163163_11909974 Ga0163163_119099741 177
183 3300014745 Ga0157377_10007183 Ga0157377_100071837 177
184 3300014969 Ga0157376_10671448 Ga0157376_106714481 177
185 3300015262 Ga0182007_10067087 Ga0182007_100670872 177
186 3300020075 Ga0206349_1127433 Ga0206349_11274331 177
187 3300020078 Ga0206352_10960216 Ga0206352_109602162 177
188 3300020078 Ga0206352_10960216 Ga0206352_109602163 177
189 3300020080 Ga0206350_10608541 Ga0206350_106085411 177
190 3300020081 Ga0206354_10540776 Ga0206354_105407761 177
191 3300020082 Ga0206353_10901459 Ga0206353_109014591 177
192 3300020610 Ga0154015_1679143 Ga0154015_16791431 177
193 3300022467 Ga0224712_10165741 Ga0224712_101657411 177
194 3300022467 Ga0224712_10334625 Ga0224712_103346251 177
195 3300025233 Ga0209437_100024 Ga0209437_10002462 177
196 3300025250 Ga0209026_1000834 Ga0209026_10008344 177
197 3300025261 Ga0209233_1034049 Ga0209233_10340492 177
198 3300025292 Ga0209676_1001085 Ga0209676_10010853 177
199 3300025904 Ga0207647_10000051 Ga0207647_100000512 177
200 3300025904 Ga0207647_10038954 Ga0207647_100389543 177
201 3300025907 Ga0207645_10000758 Ga0207645_1000075818 177
202 3300025909 Ga0207705_10000132 Ga0207705_1000013261 177
203 3300025909 Ga0207705_10017607 Ga0207705_100176074 177
204 3300025909 Ga0207705_10214060 Ga0207705_102140602 177
205 3300025911 Ga0207654_10028434 Ga0207654_100284342 177
206 3300025911 Ga0207654_10041386 Ga0207654_100413862 177
207 3300025912 Ga0207707_10248427 Ga0207707_102484272 177
208 3300025913 Ga0207695_10014993 Ga0207695_100149937 177
209 3300025913 Ga0207695_10047616 Ga0207695_100476162 177
210 3300025913 Ga0207695_10099555 Ga0207695_100995552 177
211 3300025914 Ga0207671_10010063 Ga0207671_100100633 177
212 3300025914 Ga0207671_10010874 Ga0207671_100108747 177
213 3300025914 Ga0207671_10074859 Ga0207671_100748596 177
214 3300025917 Ga0207660_10130748 Ga0207660_101307483 177
215 3300025919 Ga0207657_10197038 Ga0207657_101970381 177
216 3300025921 Ga0207652_10016686 Ga0207652_100166864 177
217 3300025924 Ga0207694_10474198 Ga0207694_104741982 177
218 3300025933 Ga0207706_10000122 Ga0207706_1000012279 177
219 3300025934 Ga0207686_10115401 Ga0207686_101154013 177
220 3300025938 Ga0207704_10000041 Ga0207704_1000004166 177
221 3300025949 Ga0207667_10000009 Ga0207667_10000009279 177
222 3300025949 Ga0207667_10009241 Ga0207667_100092412 177
223 3300025949 Ga0207667_10068263 Ga0207667_100682634 177
224 3300025949 Ga0207667_10102086 Ga0207667_101020862 177
225 3300025949 Ga0207667_10614533 Ga0207667_106145331 177
226 3300025961 Ga0207712_10167378 Ga0207712_101673782 177
227 3300025981 Ga0207640_10184735 Ga0207640_101847352 177
228 3300026023 Ga0207677_10004296 Ga0207677_100042969 177
229 3300026023 Ga0207677_10448133 Ga0207677_104481332 177
230 3300026035 Ga0207703_10501290 Ga0207703_105012901 177
231 3300026041 Ga0207639_10014118 Ga0207639_100141186 177
232 3300026041 Ga0207639_10120706 Ga0207639_101207062 177
233 3300026078 Ga0207702_10000463 Ga0207702_1000046330 177
234 3300026078 Ga0207702_10320875 Ga0207702_103208751 177
235 3300026078 Ga0207702_11271937 Ga0207702_112719371 177
236 3300026089 Ga0207648_10005037 Ga0207648_100050373 177
237 3300026121 Ga0207683_10020990 Ga0207683_100209905 177
238 3300026142 Ga0207698_10043256 Ga0207698_100432566 177
239 3300026142 Ga0207698_10478570 Ga0207698_104785703 177
240 3300028379 Ga0268266_10000137 Ga0268266_10000137124 177
241 3300028786 Ga0307517_10002409 Ga0307517_100024094 177
242 3300028794 Ga0307515_10001136 Ga0307515_1000113653 177
243 3300028794 Ga0307515_10001915 Ga0307515_1000191525 177
244 3300028800 Ga0265338_10021246 Ga0265338_100212466 177
245 3300028800 Ga0265338_10128406 Ga0265338_101284062 177
246 3300031548 Ga0307408_100260066 Ga0307408_1002600662 177
247 3300031731 Ga0307405_10084439 Ga0307405_100844392 177
248 3300031911 Ga0307412_10082815 Ga0307412_100828152 177
249 3300032004 Ga0307414_10017890 Ga0307414_100178902 177
250 3300033179 Ga0307507_10000036 Ga0307507_1000003687 177
251 3300033180 Ga0307510_10008820 Ga0307510_100088203 177
252 3300037312 Ga0395899_0000033 Ga0395899_0000033_223064_223606 177
253 3300037312 Ga0395899_0000559 Ga0395899_0000559_29163_29705 177
254 3300037418 Ga0395900_0000014 Ga0395900_0000014_289161_289703 177
255 3300037466 Ga0395898_0055085 Ga0395898_0055085_1189_1731 177
256 3300037471 Ga0395905_0000241 Ga0395905_0000241_27470_28012 177
257 3300038443 Ga0395901_0000582 Ga0395901_0000582_25850_26392 177
258 3300041443 Ga0451789_0989257 Ga0451789_0989257_12_545 177
259 3300041509 Ga0451843_0956451 Ga0451843_0956451_56_598 177
260 3300042005 Ga0439448_0033131 Ga0439448_0033131_358_900 177
261 3300046462 Ga0495651_0052852 Ga0495651_0052852_389_931 177
262 3300046471 Ga0495650_0000036 Ga0495650_0000036_362258_362800 177
263 3300046475 Ga0495639_0100834 Ga0495639_0100834_18_560 177
264 3300046492 Ga0495585_0000638 Ga0495585_0000638_27110_27652 177
265 3300046492 Ga0495585_0000831 Ga0495585_0000831_17456_17998 177
266 3300046501 Ga0495607_0246064 Ga0495607_0246064_172_714 177
267 3300046507 Ga0495606_0000008 Ga0495606_0000008_17992_18534 177
268 3300046507 Ga0495606_0011907 Ga0495606_0011907_1275_1811 177
269 3300046507 Ga0495606_0119535 Ga0495606_0119535_1002_1544 177
270 3300046512 Ga0495610_0000757 Ga0495610_0000757_3447_3989 177
271 3300046513 Ga0495616_0018093 Ga0495616_0018093_798_1340 177
272 3300046513 Ga0495616_0019504 Ga0495616_0019504_317_859 177
273 3300046518 Ga0495631_0025183 Ga0495631_0025183_901_1443 177
274 3300046518 Ga0495631_0112463 Ga0495631_0112463_246_788 177
275 3300046520 Ga0495637_0112421 Ga0495637_0112421_115_657 177
276 3300046524 Ga0495648_0026895 Ga0495648_0026895_2997_3539 177
277 3300046528 Ga0495642_0436329 Ga0495642_0436329_11_553 177
278 3300046538 Ga0495609_0040270 Ga0495609_0040270_1311_1853 177
279 3300046558 Ga0495633_0000015 Ga0495633_0000015_186594_187136 177
280 3300046558 Ga0495633_0008678 Ga0495633_0008678_727_1269 177
281 3300046616 Ga0495668_0000010 Ga0495668_0000010_357372_357914 177
282 3300046660 Ga0495625_0000379 Ga0495625_0000379_56031_56573 177
283 3300046660 Ga0495625_0000668 Ga0495625_0000668_48297_48839 177
284 3300046660 Ga0495625_0002805 Ga0495625_0002805_9418_9960 177
285 3300046660 Ga0495625_0013569 Ga0495625_0013569_1934_2476 177
286 3300046660 Ga0495625_0141636 Ga0495625_0141636_542_1084 177
287 3300046665 Ga0495661_0001087 Ga0495661_0001087_7361_7903 177
288 3300046665 Ga0495661_0018152 Ga0495661_0018152_3198_3740 177
289 3300046665 Ga0495661_0327880 Ga0495661_0327880_45_587 177
290 3300046683 Ga0495658_0027360 Ga0495658_0027360_1162_1704 177
291 3300046692 Ga0495671_0403710 Ga0495671_0403710_77_619 177
292 3300046694 Ga0495649_0000010 Ga0495649_0000010_418746_419288 177
293 3300046794 Ga0495589_0206093 Ga0495589_0206093_168_710 177
294 3300046810 Ga0495660_0026516 Ga0495660_0026516_944_1486 177
295 3300047323 Ga0495683_0126958 Ga0495683_0126958_372_914 177
296 3300047323 Ga0495683_0270974 Ga0495683_0270974_86_628 177
297 3300047443 Ga0495687_000736 Ga0495687_000736_166_708 177
298 3300047443 Ga0495687_002474 Ga0495687_002474_7286_7885 177
299 3300047445 Ga0495677_0039820 Ga0495677_0039820_328_870 177
300 3300047445 Ga0495677_0121624 Ga0495677_0121624_438_980 177
301 3300047446 Ga0495679_096402 Ga0495679_096402_112_654 177
302 3300047469 Ga0495673_0061505 Ga0495673_0061505_117_659 177
303 3300047472 Ga0495686_0196696 Ga0495686_0196696_356_898 177
304 3300048089 Ga0495614_0071458 Ga0495614_0071458_747_1289 177
305 3300049161 Ga0501305_082575 Ga0501305_082575_11_544 177
306 3300049459 Ga0495678_050717 Ga0495678_050717_683_1225 177
307 3300049705 Ga0501225_0018500 Ga0501225_0018500_1015_1548 177
308 3300049776 Ga0501280_035884 Ga0501280_035884_53_592 177
309 3300050493 nmdc:mga0k408_276_c1 nmdc:mga0k408_276_c1_21184_21726 177
310 3300050493 nmdc:mga0k408_37489_c1 nmdc:mga0k408_37489_c1_91_633 177
311 3300050496 nmdc:mga07m45_286464_c1 nmdc:mga07m45_286464_c1_401_934 177
312 3300053080 Ga0500635_0002489 Ga0500635_0002489_3821_4357 177
313 3300053122 Ga0500608_021605 Ga0500608_021605_1589_2131 177
314 3300053125 Ga0500618_000163 Ga0500618_000163_20220_20762 177
315 3300053125 Ga0500618_001717 Ga0500618_001717_5740_6285 177
316 3300053125 Ga0500618_071996 Ga0500618_071996_35_577 177
317 3300053133 Ga0500655_090223 Ga0500655_090223_64_606 177
318 3300053156 Ga0500622_0115083 Ga0500622_0115083_13_555 177
319 3300053157 Ga0500624_000278 Ga0500624_000278_12503_13045 177
320 3300059490 Ga0587066_107249 Ga0587066_107249_61_621 177
321 3300059491 Ga0587070_097497 Ga0587070_097497_79_621 177
322 3300059491 Ga0587070_145365 Ga0587070_145365_26_574 177
323 3300059492 Ga0587073_0120824 Ga0587073_0120824_85_627 177
324 3300059510 Ga0587090_018786 Ga0587090_018786_166_708 177
325 3300059643 Ga0587072_131906 Ga0587072_131906_17_565 177
326 3300059645 Ga0587076_075991 Ga0587076_075991_85_627 177

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04264

YceI

YceI-like domain

28

195

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1y0g-assembly2.cif.gz_D crystal structure of the escherichia coli ycei protein, structural genomics 0.9047 5 177
7bwl-assembly1.cif.gz_A structure of antibiotic sequester from pseudomonas aerurinosa 0.9 5 176
5ixh-assembly1.cif.gz_A crystal structure of burkholderia cenocepacia bcna 0.8954 8 172
1y0g-assembly2.cif.gz_D crystal structure of the escherichia coli ycei protein, structural genomics 0.8945 5 177
7bwl-assembly1.cif.gz_A structure of antibiotic sequester from pseudomonas aerurinosa 0.8898 5 176
ID Description Score Start End Superfamily
af_Q2FUS9_3_167_2.40.128.110 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.8976 8 172 2.40.128.110
5w2dA01 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.8924 24 177 2.40.128.110
af_P0A8X2_23_191_2.40.128.110 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.8896 2 177 2.40.128.110
5w2dA01 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.8868 24 177 2.40.128.110
af_P0A8X2_23_191_2.40.128.110 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.8846 2 177 2.40.128.110
ID Description Score Start End GO Terms
AF-A0A519PIA1-F1-model_v4 deleted 0.9775 1 135
AF-A0A7V3UVE4-F1-model_v4 Polyisoprenoid-binding protein 0.976 3 141
AF-A0A2Z4GHW6-F1-model_v4 Polyisoprenoid-binding protein 0.9574 2 176
AF-A0A519PIA1-F1-model_v4 deleted 0.9566 1 135
AF-A0A2D2AXC0-F1-model_v4 Polyisoprenoid-binding protein 0.953 5 177

Feature Viewer

pLDDT pTM Quality
90.87 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map