F408317

General Info

Members Datasets Scaffolds Average Seq Length
326 248 200 438

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_10008032|Ga0163163_100080327
Length 499
Sequence LRVEEIHCSLYVRGCPQRLNRLKRFDIDTVEKQGSAQGQGGVDKLRLSGEVSMVAATTRGMSTTPAARPTTRKPWYRVLYIQVLTAIVLGAIIGWLFPDFAKNDWIKAMGDGFVKLIKMVIAPIIFCTVVSGIAHISEVRKVGRVAVKALVYFEIVSTFALLLGLIVGNVLHPGAGFSGKADAGAVSTYAKQASEMRSVDFVLHIIPDSVVGAFAQGEILQVLLFSVLFGFALMALGDKGAPVRTFVDDVAHAMFGVIALIVKAAPIGAFGAMAYTIGRYGPQALGNLAGLIATFYFTAGAFVFLVLGTIAWFAGFSIFKYLRYIKDELLIVLGTSSSESALPQLMEKLERLGCSKPVVGLVVPTGYSFNLDGTNIYMTLATLFIAQALGVSLSFGEQMTILIVAMLTSKGASGVTGAGFITLAGTLAAVRPELVPGMAIVLGIDKFMSECRALTNICGNGVAAIVVSAWEGELDREKLAAGLNQEIDPSDVQEAVATG

Samples

Sample ID Description Type Environment
1 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
2 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
3 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
4 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
5 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
6 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
7 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
8 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
9 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
10 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
11 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
12 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
13 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
14 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
15 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
16 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
17 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
18 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
19 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
20 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
21 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
22 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
23 2773857925 Microvirga vignae BR3299 Isolate Unclassified
24 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
25 2791355199
26 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
27 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
28 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
29 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
30 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
31 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
32 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
33 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
34 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
35 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
36 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
37 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
38 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
39 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
40 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
41 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
42 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
43 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
44 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
45 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
46 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
47 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
48 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
49 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
50 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
51 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
52 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
53 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
54 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
55 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
56 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
57 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
58 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
59 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
60 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
61 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
62 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
63 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
64 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
65 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
66 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
67 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
68 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
69 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
70 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
71 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
72 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
73 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
74 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
75 2904699407
76 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
77 2906610324
78 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
79 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
80 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
81 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
82 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
83 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
84 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
85 2922368715
86 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
87 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
88 2922425934
89 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
90 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
91 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
92 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
93 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
94 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
95 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
96 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
97 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
98 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
99 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
100 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
101 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
102 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
103 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
104 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
105 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
106 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
107 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
108 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
109 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
110 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
111 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
112 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
113 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
114 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
115 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
116 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
117 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
118 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
119 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
120 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
121 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
122 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
123 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
124 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
125 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
126 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
127 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
128 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
129 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
130 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
131 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
132 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
133 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
134 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
135 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
136 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
137 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
138 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
139 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
142 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
158 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
159 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
160 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
164 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
165 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
166 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
167 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
168 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
169 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
170 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
171 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
172 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
173 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
174 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
175 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
176 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
177 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
178 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
179 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
181 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
182 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
183 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
184 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
185 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
186 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
187 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
188 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
189 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
190 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
191 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
192 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
193 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
194 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
195 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
196 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
197 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
198 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
199 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
200 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
201 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
202 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
203 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
204 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
205 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
206 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
207 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
208 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
209 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
210 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
219 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
220 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
221 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
222 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
223 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
225 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
226 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
227 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
228 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
229 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
230 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
231 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
232 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
233 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
234 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
235 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
236 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
237 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
238 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
239 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
240 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
241 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
242 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
243 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
244 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
245 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
246 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
247 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
248 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 62.5
Metatranscriptomes 0
Isolates 37.5

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.75
Nodule 26.99
Rhizoplane 7.98
Rhizosphere 31.9
Stem 0
Stem Tuber 0
Unclassified 26.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055539_1002911 3300003752 Bacteria 2490
2 Ga0070659_100069458 3300005366 Bacteria 2796
3 Ga0070709_10000495 3300005434 Bacteria 23229
4 Ga0070714_100093232 3300005435 Bacteria 2640
5 Ga0070714_100250299 3300005435 Bacteria 1638
6 Ga0070713_100016952 3300005436 Bacteria 5493
7 Ga0070710_10000593 3300005437 Bacteria 17230
8 Ga0070711_100113853 3300005439 Bacteria 1990
9 Ga0070708_100020578 3300005445 Bacteria 5567
10 Ga0070663_100016569 3300005455 Bacteria 4792
11 Ga0070663_100039488 3300005455 Bacteria 3298
12 Ga0070662_100093680 3300005457 Bacteria 2260
13 Ga0070707_100191418 3300005468 Bacteria 1994
14 Ga0070698_100004809 3300005471 Bacteria 14825
15 Ga0070698_100090975 3300005471 Bacteria 3034
16 Ga0070679_100171479 3300005530 Bacteria 2142
17 Ga0070665_100000268 3300005548 Bacteria 85516
18 Ga0068855_100138867 3300005563 Bacteria 2772
19 Ga0068857_100284324 3300005577 Bacteria 1522
20 Ga0068856_100003581 3300005614 Bacteria 15629
21 Ga0068860_100000258 3300005843 Bacteria 77761
22 Ga0081455_10058326 3300005937 Bacteria 3266
23 Ga0081540_1012392 3300005983 Bacteria 5622
24 Ga0070717_10024733 3300006028 Bacteria 4772
25 Ga0070717_10031803 3300006028 Bacteria 4248
26 Ga0070717_10094524 3300006028 Bacteria 2529
27 Ga0070712_100003717 3300006175 Bacteria 9394
28 Ga0070712_100066833 3300006175 Bacteria 2557
29 Ga0070712_100111717 3300006175 Bacteria 2040
30 Ga0075362_10033504 3300006177 Bacteria 2234
31 Ga0075369_10036941 3300006186 Bacteria 2079
32 Ga0099825_1027754 3300006941 Bacteria 2842
33 Ga0099824_1010874 3300006942 Bacteria 10520
34 Ga0099824_1012209 3300006942 Bacteria 9455
35 Ga0099822_1000046 3300006943 Bacteria 58661
36 Ga0099823_1033013 3300006944 Bacteria 4179
37 Ga0105240_10210784 3300009093 Bacteria 2270
38 Ga0105241_10037373 3300009174 Bacteria 3657
39 Ga0105237_10004913 3300009545 Bacteria 15297
40 Ga0105237_10015274 3300009545 Bacteria 7998
41 Ga0105237_10133473 3300009545 Bacteria 2477
42 Ga0105238_10026078 3300009551 Bacteria 5956
43 Ga0105239_10014223 3300010375 Bacteria 8832
44 Ga0105239_10032781 3300010375 Bacteria 5708
45 Ga0105239_10055557 3300010375 Bacteria 4343
46 Ga0105239_10061802 3300010375 Bacteria 4111
47 Ga0157370_10157976 3300013104 Bacteria 2109
48 Ga0163163_10008032 3300014325 Bacteria 9344
49 Ga0214544_1000005 3300021320 Bacteria 387675
50 Ga0214542_1000004 3300021321 Bacteria 415597
51 Ga0214545_1000005 3300021324 Bacteria 415590
52 Ga0214543_1000030 3300021327 Bacteria 210137
53 Ga0213876_10001647 3300021384 Bacteria 13628
54 Ga0213876_10005436 3300021384 Bacteria 7006
55 Ga0213876_10011418 3300021384 Bacteria 4743
56 Ga0213871_10000196 3300021441 Bacteria 6926
57 Ga0209677_100639 3300025253 Bacteria 18592
58 Ga0209455_1012264 3300025272 Bacteria 2062
59 Ga0209758_1002838 3300025297 Bacteria 16843
60 Ga0207692_10000477 3300025898 Bacteria 14129
61 Ga0207699_10000658 3300025906 Bacteria 16632
62 Ga0207654_10033777 3300025911 Bacteria 2838
63 Ga0207695_10000008 3300025913 Bacteria 1058268
64 Ga0207695_10105028 3300025913 Bacteria 2812
65 Ga0207671_10003046 3300025914 Bacteria 17160
66 Ga0207671_10035115 3300025914 Bacteria 3723
67 Ga0207671_10072924 3300025914 Bacteria 2563
68 Ga0207693_10006794 3300025915 Bacteria 9448
69 Ga0207657_10000784 3300025919 Bacteria 33773
70 Ga0207694_10003293 3300025924 Bacteria 12853
71 Ga0207700_10005326 3300025928 Bacteria 7673
72 Ga0207664_10040450 3300025929 Bacteria 3626
73 Ga0207667_10120812 3300025949 Bacteria 2700
74 Ga0207667_10149263 3300025949 Bacteria 2406
75 Ga0207678_10044604 3300026067 Bacteria 3835
76 Ga0207702_10000442 3300026078 Bacteria 47074
77 Ga0207702_10166082 3300026078 Bacteria 2019
78 Ga0207674_10250106 3300026116 Bacteria 1720
79 Ga0207698_10025275 3300026142 Bacteria 4181
80 Ga0209389_1000048 3300027296 Bacteria 115074
81 Ga0209389_1006361 3300027296 Bacteria 10245
82 Ga0209589_1000109 3300027357 Bacteria 83533
83 Ga0209589_1010139 3300027357 Bacteria 13843
84 Ga0209489_100324 3300027361 Bacteria 83533
85 Ga0209489_108475 3300027361 Bacteria 13953
86 Ga0209489_109937 3300027361 Bacteria 11268
87 Ga0209700_100020 3300027363 Bacteria 235733
88 Ga0209700_100355 3300027363 Bacteria 83533
89 Ga0268266_10000127 3300028379 Bacteria 149198
90 Ga0268264_10000245 3300028381 Bacteria 102529
91 Ga0265334_10014941 3300028573 Bacteria 3231
92 Ga0265336_10000625 3300028666 Bacteria 19464
93 Ga0265338_10000667 3300028800 Bacteria 59318
94 Ga0265330_10029563 3300031235 Bacteria 2464
95 Ga0265320_10001967 3300031240 Bacteria 14517
96 Ga0265331_10019037 3300031250 Bacteria 3549
97 Ga0307509_10068821 3300031507 Bacteria 3702
98 Ga0307508_10000020 3300031616 Bacteria 188730
99 Ga0307508_10052393 3300031616 Bacteria 3625
100 Ga0265314_10004433 3300031711 Bacteria 13026
101 Ga0307516_10011741 3300031730 Bacteria 9503
102 Ga0307507_10024290 3300033179 Bacteria 6613
103 Ga0307510_10132604 3300033180 Bacteria 2159
104 Ga0315911_1000055 3300033442 Bacteria 26174
105 Ga0373927_0036245 3300035695 Bacteria 3208
106 Ga0373933_0000205 3300035724 Bacteria 39388
107 Ga0373947_0028361 3300035725 Bacteria 3282
108 Ga0373925_0181002 3300037068 Bacteria 1668
109 Ga0395899_0100029 3300037312 Bacteria 2094
110 Ga0395905_0003253 3300037471 Bacteria 17468
111 Ga0436364_0816439 3300037853 Bacteria 2531
112 Ga0395901_0210014 3300038443 Bacteria 2038
113 Ga0395901_0217537 3300038443 Bacteria 1997
114 Ga0436365_0030456 3300039437 Bacteria 55461
115 Ga0436365_0045646 3300039437 Bacteria 5397
116 Ga0436365_1587357 3300039437 Bacteria 14121
117 Ga0436360_0413319 3300039438 Bacteria 2245
118 Ga0436360_0588773 3300039438 Bacteria 5671
119 Ga0436363_1388351 3300039450 Bacteria 4185
120 Ga0439455_0023552 3300042012 Bacteria 1483
121 Ga0466959_0017721 3300045049 Bacteria 5224
122 Ga0466958_0057819 3300045836 Bacteria 2357
123 Ga0495639_0055295 3300046475 Bacteria 1810
124 Ga0495643_0043532 3300046522 Bacteria 2443
125 Ga0495581_0059410 3300047315 Bacteria 2210
126 Ga0496100_0052264 3300048903 Bacteria 2656
127 Ga0496104_0001420 3300048907 Bacteria 20751
128 Ga0496104_0070875 3300048907 Bacteria 3314
129 Ga0496104_0140466 3300048907 Bacteria 2320
130 Ga0496105_0011986 3300048908 Bacteria 6865
131 Ga0496105_0072568 3300048908 Bacteria 2845
132 Ga0496105_0191030 3300048908 Bacteria 1674
133 Ga0496106_0002373 3300048909 Bacteria 14021
134 Ga0496106_0003131 3300048909 Bacteria 12346
135 Ga0496107_0006960 3300048910 Bacteria 7794
136 Ga0496107_0009731 3300048910 Bacteria 6667
137 Ga0496108_0001361 3300048911 Bacteria 19211
138 Ga0496108_0023914 3300048911 Bacteria 5029
139 Ga0496109_0000909 3300048912 Bacteria 24642
140 Ga0496109_0015662 3300048912 Bacteria 6614
141 Ga0496110_0036594 3300048913 Bacteria 4262
142 Ga0496110_0066394 3300048913 Bacteria 3191
143 Ga0496111_0010182 3300048914 Bacteria 6296
144 Ga0496111_0063954 3300048914 Bacteria 2668
145 Ga0496111_0204836 3300048914 Bacteria 1466
146 Ga0496112_0002743 3300048915 Bacteria 14271
147 Ga0496112_0006987 3300048915 Bacteria 9964
148 Ga0496112_0081225 3300048915 Bacteria 3206
149 Ga0496112_0101388 3300048915 Bacteria 2848
150 Ga0496114_0130611 3300048917 Bacteria 2169
151 Ga0496114_0304043 3300048917 Bacteria 1408
152 Ga0496118_0004955 3300048921 Bacteria 15421
153 Ga0496119_0002073 3300048922 Bacteria 22665
154 Ga0496121_0000757 3300048924 Bacteria 59348
155 Ga0496121_0001403 3300048924 Bacteria 40795
156 Ga0496121_0025479 3300048924 Bacteria 5609
157 Ga0496121_0063795 3300048924 Bacteria 3007
158 Ga0496121_0078995 3300048924 Bacteria 2613
159 Ga0496121_0104454 3300048924 Bacteria 2177
160 Ga0496124_0007035 3300048927 Bacteria 12051
161 Ga0496124_0038923 3300048927 Bacteria 4125
162 Ga0496125_0102912 3300048928 Bacteria 2097
163 Ga0496126_0003787 3300048929 Bacteria 18774
164 Ga0496126_0024015 3300048929 Bacteria 5892
165 Ga0496126_0064152 3300048929 Bacteria 3291
166 Ga0496126_0073719 3300048929 Bacteria 3034
167 Ga0501031_0007197 3300049568 Bacteria 7260
168 Ga0501032_0064356 3300049569 Bacteria 2454
169 Ga0501034_0164295 3300049571 Bacteria 2189
170 Ga0501037_0016401 3300049573 Bacteria 5451
171 Ga0501039_0045828 3300049575 Bacteria 3378
172 Ga0501043_0038462 3300049579 Bacteria 3761
173 Ga0501046_0009661 3300049580 Bacteria 8318
174 Ga0501047_0196252 3300049581 Bacteria 1880
175 Ga0501067_0011017 3300049583 Bacteria 5006
176 Ga0501069_0069710 3300049585 Bacteria 1969
177 Ga0501074_0064686 3300049590 Bacteria 2633
178 Ga0501080_0014062 3300049742 Bacteria 7366
179 Ga0501083_0036433 3300049744 Bacteria 3356
180 Ga0501035_0050678 3300049822 Bacteria 3719
181 Ga0501045_0149943 3300049824 Bacteria 1734
182 Ga0495601_0000722 3300053077 Bacteria 17751
183 Ga0495601_0044343 3300053077 Bacteria 2795
184 Ga0495595_0014888 3300053084 Bacteria 3307
185 Ga0500647_0016079 3300053091 Bacteria 3432
186 Ga0500566_0000028 3300053094 Bacteria 75589
187 Ga0500566_0041236 3300053094 Bacteria 2667
188 Ga0500556_0000637 3300053104 Bacteria 22030
189 Ga0500572_000197 3300053111 Bacteria 21327
190 Ga0500595_013657 3300053119 Bacteria 3106
191 Ga0500595_014039 3300053119 Bacteria 3051
192 Ga0500559_0000154 3300053136 Bacteria 54106
193 Ga0500559_0006433 3300053136 Bacteria 5305
194 Ga0500630_002522 3300053159 Bacteria 8836
195 Ga0500638_055636 3300053162 Bacteria 1907
196 Ga0500639_000001 3300053163 Bacteria 244795
197 Ga0500636_0097833 3300053177 Bacteria 1672
198 Ga0500637_0010617 3300053178 Bacteria 4726
199 Ga0500596_000480 3300053735 Bacteria 7469
200 Ga0500596_005457 3300053735 Bacteria 2236

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005457 Ga0070662_100093680 Ga0070662_1000936802 400
2 3300031250 Ga0265331_10019037 Ga0265331_100190373 400
3 iso_pu_bacteria 2824609381 2824613276 404
4 3300010375 Ga0105239_10014223 Ga0105239_100142236 405
5 iso_pu_bacteria 2922425934 2922426754 405
6 3300037853 Ga0436364_0816439 Ga0436364_0816439_398_1741 408
7 3300053178 Ga0500637_0010617 Ga0500637_0010617_2448_3707 409
8 3300005548 Ga0070665_100000268 Ga0070665_10000026814 410
9 3300005563 Ga0068855_100138867 Ga0068855_1001388672 410
10 3300009545 Ga0105237_10133473 Ga0105237_101334732 410
11 3300009551 Ga0105238_10026078 Ga0105238_100260784 410
12 3300010375 Ga0105239_10061802 Ga0105239_100618024 410
13 3300025924 Ga0207694_10003293 Ga0207694_100032932 410
14 3300025949 Ga0207667_10120812 Ga0207667_101208122 410
15 3300028379 Ga0268266_10000127 Ga0268266_10000127152 410
16 3300031240 Ga0265320_10001967 Ga0265320_100019679 410
17 3300037312 Ga0395899_0100029 Ga0395899_0100029_36_1355 410
18 3300053119 Ga0500595_013657 Ga0500595_013657_468_1862 411
19 3300048927 Ga0496124_0038923 Ga0496124_0038923_323_1636 413
20 3300005439 Ga0070711_100113853 Ga0070711_1001138531 414
21 3300006175 Ga0070712_100003717 Ga0070712_1000037172 414
22 3300025915 Ga0207693_10006794 Ga0207693_100067949 414
23 3300005435 Ga0070714_100250299 Ga0070714_1002502991 415
24 3300048915 Ga0496112_0081225 Ga0496112_0081225_215_1522 416
25 3300005434 Ga0070709_10000495 Ga0070709_1000049514 417
26 3300005435 Ga0070714_100093232 Ga0070714_1000932322 417
27 3300005437 Ga0070710_10000593 Ga0070710_100005932 417
28 3300025898 Ga0207692_10000477 Ga0207692_100004774 417
29 3300025906 Ga0207699_10000658 Ga0207699_100006582 417
30 3300025928 Ga0207700_10005326 Ga0207700_100053264 417
31 3300025929 Ga0207664_10040450 Ga0207664_100404502 417
32 3300039438 Ga0436360_0413319 Ga0436360_0413319_814_2175 417
33 3300048924 Ga0496121_0104454 Ga0496121_0104454_806_2125 418
34 3300006175 Ga0070712_100111717 Ga0070712_1001117173 420
35 3300049744 Ga0501083_0036433 Ga0501083_0036433_1614_2930 420
36 iso_pu_bacteria 2903748898 2903757960 420
37 iso_pu_bacteria 2906660503 2906663482 420
38 iso_pu_bacteria 2908739725 2908745474 420
39 3300045049 Ga0466959_0017721 Ga0466959_0017721_3633_4955 421
40 iso_pu_bacteria 2847930680 2847932726 421
41 iso_pu_bacteria 2879083081 2879090920 421
42 iso_pu_bacteria 2513237092 2513622066 422
43 iso_pu_bacteria 2617270735 2617348528 422
44 iso_pu_bacteria 2824626560 2824629025 422
45 iso_pu_bacteria 2824704595 2824704862 422
46 iso_pu_bacteria 2824753945 2824754130 422
47 iso_pu_bacteria 2824763712 2824765690 422
48 iso_pu_bacteria 2824773399 2824777583 422
49 iso_pu_bacteria 2841949485 2841955787 422
50 iso_pu_bacteria 2841957949 2841961475 422
51 iso_pu_bacteria 2841966195 2841970156 422
52 iso_pu_bacteria 2841974524 2841977194 422
53 iso_pu_bacteria 2841983080 2841985674 422
54 iso_pu_bacteria 2874612657 2874613894 422
55 iso_pu_bacteria 2881665667 2881667034 422
56 iso_pu_bacteria 2885366525 2885373567 422
57 iso_pu_bacteria 2904711408 2904718908 422
58 iso_pu_bacteria 3005483717 3005484168 422
59 3300005983 Ga0081540_1012392 Ga0081540_10123923 423
60 3300009093 Ga0105240_10210784 Ga0105240_102107842 423
61 3300025913 Ga0207695_10105028 Ga0207695_101050283 423
62 3300031235 Ga0265330_10029563 Ga0265330_100295632 423
63 3300031711 Ga0265314_10004433 Ga0265314_1000443313 423
64 3300035724 Ga0373933_0000205 Ga0373933_0000205_14118_15443 423
65 iso_pu_bacteria 2728368998 2728749787 423
66 iso_pu_bacteria 2885374607 2885374624 423
67 iso_pu_bacteria 2906643746 2906644335 423
68 iso_pu_bacteria 2513237095 2513653480 424
69 iso_pu_bacteria 2513237102 2513706897 424
70 iso_pu_bacteria 2513237137 2513864067 424
71 iso_pu_bacteria 2513237139 2513880316 424
72 iso_pu_bacteria 2517093001 2517108799 424
73 iso_pu_bacteria 2517572143 2517890262 424
74 iso_pu_bacteria 2528768022 2528858808 424
75 iso_pu_bacteria 2791355197 2793067766 424
76 iso_pu_bacteria 2816332527 2818244187 424
77 iso_pu_bacteria 2841941048 2841948300 424
78 iso_pu_bacteria 2847939898 2847940900 424
79 iso_pu_bacteria 2904690495 2904692853 424
80 iso_pu_bacteria 2908756301 2908758265 424
81 iso_pu_bacteria 2929615660 2929624446 424
82 iso_pu_bacteria 2929624759 2929633721 424
83 iso_pu_bacteria 2933577622 2933586340 424
84 iso_pu_bacteria 3005474847 3005482701 424
85 iso_pu_bacteria 8055742211 8055743832 424
86 3300006028 Ga0070717_10024733 Ga0070717_100247332 425
87 3300021384 Ga0213876_10011418 Ga0213876_100114183 425
88 3300039437 Ga0436365_0045646 Ga0436365_0045646_2334_3659 425
89 3300048915 Ga0496112_0101388 Ga0496112_0101388_147_1514 425
90 iso_pu_bacteria 2874604998 2874611847 425
91 3300006942 Ga0099824_1012209 Ga0099824_10122093 426
92 3300027296 Ga0209389_1006361 Ga0209389_10063619 426
93 3300027357 Ga0209589_1010139 Ga0209589_10101398 426
94 3300027361 Ga0209489_108475 Ga0209489_1084758 426
95 3300048922 Ga0496119_0002073 Ga0496119_0002073_28_1419 426
96 iso_pu_bacteria 2508501128 2509150428 426
97 iso_pu_bacteria 2508501128 2509153381 426
98 iso_pu_bacteria 2513237094 2513641625 426
99 iso_pu_bacteria 2513237096 2513661756 426
100 iso_pu_bacteria 2513237098 2513679833 426
101 iso_pu_bacteria 2513237101 2513698733 426
102 iso_pu_bacteria 2513237145 2513923402 426
103 iso_pu_bacteria 2513237161 2514015456 426
104 iso_pu_bacteria 2524023228 2524541574 426
105 iso_pu_bacteria 2617270741 2617379310 426
106 iso_pu_bacteria 2721755755 2723844175 426
107 iso_pu_bacteria 2791355199 2793081999 426
108 iso_pu_bacteria 2802429603 2805921733 426
109 iso_pu_bacteria 2824600985 2824601433 426
110 iso_pu_bacteria 2824653114 2824656681 426
111 iso_pu_bacteria 2824661429 2824661707 426
112 iso_pu_bacteria 2824671348 2824672349 426
113 iso_pu_bacteria 2824679649 2824680655 426
114 iso_pu_bacteria 2824687955 2824689211 426
115 iso_pu_bacteria 2824696289 2824697249 426
116 iso_pu_bacteria 2824732956 2824733116 426
117 iso_pu_bacteria 2824746037 2824747140 426
118 iso_pu_bacteria 2838122688 2838124927 426
119 iso_pu_bacteria 2874620515 2874625702 426
120 iso_pu_bacteria 2876808645 2876816204 426
121 iso_pu_bacteria 2879110137 2879116379 426
122 iso_pu_bacteria 2881364244 2881368991 426
123 iso_pu_bacteria 2885383462 2885391870 426
124 iso_pu_bacteria 2888378607 2888380508 426
125 iso_pu_bacteria 2889033259 2889041607 426
126 iso_pu_bacteria 2903768456 2903777221 426
127 iso_pu_bacteria 2904666416 2904673485 426
128 iso_pu_bacteria 2904699407 2904706628 426
129 iso_pu_bacteria 2906610324 2906614936 426
130 iso_pu_bacteria 2906635258 2906635677 426
131 iso_pu_bacteria 2908775508 2908777568 426
132 iso_pu_bacteria 2922361189 2922366524 426
133 iso_pu_bacteria 2922368715 2922378020 426
134 iso_pu_bacteria 2922386360 2922386392 426
135 iso_pu_bacteria 2922393267 2922394168 426
136 iso_pu_bacteria 2941507105 2941514367 426
137 iso_pu_bacteria 2941515067 2941522797 426
138 iso_pu_bacteria 2941523033 2941530757 426
139 iso_pu_bacteria 3005587118 3005589942 426
140 iso_pu_bacteria 8006933436 8006938032 426
141 iso_pu_bacteria 8006964411 8006972907 426
142 iso_pu_bacteria 8006973647 8006978134 426
143 iso_pu_bacteria 8006984368 8006985513 426
144 iso_pu_bacteria 8006994254 8007000639 426
145 iso_pu_bacteria 8019555841 8019560435 426
146 iso_pu_bacteria 8019565922 8019570532 426
147 iso_pu_bacteria 8056673599 8056680232 426
148 iso_pu_bacteria 8056681323 8056686463 426
149 3300006028 Ga0070717_10094524 Ga0070717_100945241 427
150 3300006175 Ga0070712_100066833 Ga0070712_1000668333 427
151 3300006177 Ga0075362_10033504 Ga0075362_100335042 427
152 3300006186 Ga0075369_10036941 Ga0075369_100369412 427
153 3300006944 Ga0099823_1033013 Ga0099823_10330132 427
154 3300025297 Ga0209758_1002838 Ga0209758_100283810 427
155 3300027296 Ga0209389_1000048 Ga0209389_100004885 427
156 3300027361 Ga0209489_109937 Ga0209489_1099378 427
157 3300027363 Ga0209700_100020 Ga0209700_100020197 427
158 3300037471 Ga0395905_0003253 Ga0395905_0003253_5337_6650 427
159 3300038443 Ga0395901_0210014 Ga0395901_0210014_452_1765 427
160 3300048909 Ga0496106_0002373 Ga0496106_0002373_268_1599 427
161 3300048910 Ga0496107_0009731 Ga0496107_0009731_3675_5006 427
162 3300048911 Ga0496108_0001361 Ga0496108_0001361_13877_15208 427
163 3300048912 Ga0496109_0000909 Ga0496109_0000909_7669_9000 427
164 3300048913 Ga0496110_0066394 Ga0496110_0066394_722_2053 427
165 3300048915 Ga0496112_0006987 Ga0496112_0006987_6457_7788 427
166 3300048917 Ga0496114_0304043 Ga0496114_0304043_32_1363 427
167 3300005471 Ga0070698_100090975 Ga0070698_1000909753 428
168 3300005843 Ga0068860_100000258 Ga0068860_10000025811 428
169 3300021384 Ga0213876_10005436 Ga0213876_100054365 428
170 3300025914 Ga0207671_10035115 Ga0207671_100351152 428
171 3300025914 Ga0207671_10072924 Ga0207671_100729242 428
172 3300028381 Ga0268264_10000245 Ga0268264_1000024524 428
173 3300031507 Ga0307509_10068821 Ga0307509_100688212 428
174 3300031616 Ga0307508_10000020 Ga0307508_1000002065 428
175 3300031616 Ga0307508_10052393 Ga0307508_100523933 428
176 3300031730 Ga0307516_10011741 Ga0307516_100117415 428
177 3300033179 Ga0307507_10024290 Ga0307507_100242904 428
178 3300033442 Ga0315911_1000055 Ga0315911_10000556 428
179 3300035695 Ga0373927_0036245 Ga0373927_0036245_651_1967 428
180 3300037068 Ga0373925_0181002 Ga0373925_0181002_133_1449 428
181 3300042012 Ga0439455_0023552 Ga0439455_0023552_35_1351 428
182 3300048909 Ga0496106_0003131 Ga0496106_0003131_10276_11592 428
183 3300048921 Ga0496118_0004955 Ga0496118_0004955_11276_12592 428
184 3300048924 Ga0496121_0000757 Ga0496121_0000757_6859_8175 428
185 3300048927 Ga0496124_0007035 Ga0496124_0007035_7043_8359 428
186 3300048928 Ga0496125_0102912 Ga0496125_0102912_573_1889 428
187 3300053077 Ga0495601_0044343 Ga0495601_0044343_1466_2782 428
188 3300053094 Ga0500566_0041236 Ga0500566_0041236_1327_2643 428
189 3300053119 Ga0500595_014039 Ga0500595_014039_14_1330 428
190 3300053136 Ga0500559_0006433 Ga0500559_0006433_3081_4397 428
191 3300053735 Ga0500596_005457 Ga0500596_005457_408_1724 428
192 iso_pu_bacteria 2508501114 2509075556 428
193 iso_pu_bacteria 2513237098 2513673885 428
194 iso_pu_bacteria 2524023210 2524469603 428
195 iso_pu_bacteria 2824617872 2824619590 428
196 iso_pu_bacteria 2824635225 2824635692 428
197 iso_pu_bacteria 2824644064 2824644677 428
198 iso_pu_bacteria 2824714736 2824715108 428
199 iso_pu_bacteria 2824723954 2824724361 428
200 iso_pu_bacteria 8056681323 8056686621 428
201 3300009545 Ga0105237_10015274 Ga0105237_100152747 429
202 3300025949 Ga0207667_10149263 Ga0207667_101492632 429
203 3300026078 Ga0207702_10166082 Ga0207702_101660822 429
204 3300026142 Ga0207698_10025275 Ga0207698_100252753 429
205 3300039437 Ga0436365_0030456 Ga0436365_0030456_16224_17543 429
206 3300048908 Ga0496105_0072568 Ga0496105_0072568_10_1329 429
207 3300048914 Ga0496111_0204836 Ga0496111_0204836_114_1433 429
208 iso_pu_bacteria 2885383462 2885390897 429
209 3300005455 Ga0070663_100039488 Ga0070663_1000394882 430
210 3300006941 Ga0099825_1027754 Ga0099825_10277542 430
211 3300006942 Ga0099824_1010874 Ga0099824_10108743 430
212 3300006943 Ga0099822_1000046 Ga0099822_100004659 430
213 3300021320 Ga0214544_1000005 Ga0214544_1000005232 430
214 3300021321 Ga0214542_1000004 Ga0214542_1000004236 430
215 3300021324 Ga0214545_1000005 Ga0214545_1000005159 430
216 3300021327 Ga0214543_1000030 Ga0214543_100003026 430
217 3300021384 Ga0213876_10001647 Ga0213876_100016477 430
218 3300021441 Ga0213871_10000196 Ga0213871_100001963 430
219 3300027357 Ga0209589_1000109 Ga0209589_100010914 430
220 3300027361 Ga0209489_100324 Ga0209489_10032414 430
221 3300027363 Ga0209700_100355 Ga0209700_10035514 430
222 3300039437 Ga0436365_1587357 Ga0436365_1587357_5914_7236 430
223 3300039438 Ga0436360_0588773 Ga0436360_0588773_3124_4446 430
224 3300039450 Ga0436363_1388351 Ga0436363_1388351_1033_2355 430
225 3300053104 Ga0500556_0000637 Ga0500556_0000637_4857_6335 430
226 iso_pu_bacteria 2513237095 2513645333 430
227 iso_pu_bacteria 2513237102 2513702821 430
228 iso_pu_bacteria 2513237139 2513873254 430
229 iso_pu_bacteria 2773857925 2774871607 430
230 iso_pu_bacteria 2802429603 2805914758 430
231 iso_pu_bacteria 2816332527 2818239571 430
232 iso_pu_bacteria 2824679649 2824681082 430
233 iso_pu_bacteria 2824696289 2824700336 430
234 iso_pu_bacteria 2847939898 2847947156 430
235 iso_pu_bacteria 2874612657 2874617483 430
236 iso_pu_bacteria 2885409591 2885411120 430
237 iso_pu_bacteria 2888378607 2888384588 430
238 iso_pu_bacteria 2904690495 2904695477 430
239 iso_pu_bacteria 2904699407 2904706972 430
240 iso_pu_bacteria 2908756301 2908757477 430
241 iso_pu_bacteria 8006933436 8006934758 430
242 iso_pu_bacteria 8006973647 8006974726 430
243 3300005366 Ga0070659_100069458 Ga0070659_1000694582 431
244 3300005436 Ga0070713_100016952 Ga0070713_1000169522 431
245 3300005445 Ga0070708_100020578 Ga0070708_1000205782 431
246 3300005455 Ga0070663_100016569 Ga0070663_1000165693 431
247 3300005468 Ga0070707_100191418 Ga0070707_1001914182 431
248 3300005471 Ga0070698_100004809 Ga0070698_10000480912 431
249 3300005530 Ga0070679_100171479 Ga0070679_1001714791 431
250 3300005577 Ga0068857_100284324 Ga0068857_1002843241 431
251 3300005614 Ga0068856_100003581 Ga0068856_1000035815 431
252 3300006028 Ga0070717_10031803 Ga0070717_100318034 431
253 3300013104 Ga0157370_10157976 Ga0157370_101579761 431
254 3300014325 Ga0163163_10008032 Ga0163163_100080327 431
255 3300025919 Ga0207657_10000784 Ga0207657_1000078423 431
256 3300026067 Ga0207678_10044604 Ga0207678_100446042 431
257 3300026078 Ga0207702_10000442 Ga0207702_100004429 431
258 3300026116 Ga0207674_10250106 Ga0207674_102501062 431
259 3300028573 Ga0265334_10014941 Ga0265334_100149411 431
260 3300035725 Ga0373947_0028361 Ga0373947_0028361_422_1774 431
261 3300038443 Ga0395901_0217537 Ga0395901_0217537_277_1602 431
262 3300045836 Ga0466958_0057819 Ga0466958_0057819_742_2076 431
263 3300046475 Ga0495639_0055295 Ga0495639_0055295_349_1701 431
264 3300047315 Ga0495581_0059410 Ga0495581_0059410_141_1493 431
265 3300048903 Ga0496100_0052264 Ga0496100_0052264_565_1908 431
266 3300048907 Ga0496104_0001420 Ga0496104_0001420_6019_7362 431
267 3300048907 Ga0496104_0070875 Ga0496104_0070875_1551_2903 431
268 3300048907 Ga0496104_0140466 Ga0496104_0140466_785_2128 431
269 3300048908 Ga0496105_0011986 Ga0496105_0011986_5462_6808 431
270 3300048908 Ga0496105_0191030 Ga0496105_0191030_189_1532 431
271 3300048910 Ga0496107_0006960 Ga0496107_0006960_315_1640 431
272 3300048911 Ga0496108_0023914 Ga0496108_0023914_1321_2664 431
273 3300048912 Ga0496109_0015662 Ga0496109_0015662_1322_2665 431
274 3300048913 Ga0496110_0036594 Ga0496110_0036594_566_1909 431
275 3300048914 Ga0496111_0010182 Ga0496111_0010182_857_2200 431
276 3300048914 Ga0496111_0063954 Ga0496111_0063954_444_1886 431
277 3300048915 Ga0496112_0002743 Ga0496112_0002743_7066_8409 431
278 3300048917 Ga0496114_0130611 Ga0496114_0130611_789_2132 431
279 3300048924 Ga0496121_0001403 Ga0496121_0001403_27857_29182 431
280 3300048924 Ga0496121_0063795 Ga0496121_0063795_94_1485 431
281 3300048929 Ga0496126_0024015 Ga0496126_0024015_2822_4147 431
282 3300048929 Ga0496126_0064152 Ga0496126_0064152_595_1920 431
283 3300049568 Ga0501031_0007197 Ga0501031_0007197_1453_2778 431
284 3300049569 Ga0501032_0064356 Ga0501032_0064356_1101_2426 431
285 3300049571 Ga0501034_0164295 Ga0501034_0164295_732_2057 431
286 3300049573 Ga0501037_0016401 Ga0501037_0016401_121_1446 431
287 3300049575 Ga0501039_0045828 Ga0501039_0045828_1323_2648 431
288 3300049579 Ga0501043_0038462 Ga0501043_0038462_1293_2618 431
289 3300049580 Ga0501046_0009661 Ga0501046_0009661_697_2022 431
290 3300049581 Ga0501047_0196252 Ga0501047_0196252_29_1354 431
291 3300049583 Ga0501067_0011017 Ga0501067_0011017_2633_3958 431
292 3300049585 Ga0501069_0069710 Ga0501069_0069710_329_1654 431
293 3300049590 Ga0501074_0064686 Ga0501074_0064686_457_1782 431
294 3300049742 Ga0501080_0014062 Ga0501080_0014062_4900_6225 431
295 3300049822 Ga0501035_0050678 Ga0501035_0050678_2262_3587 431
296 3300049824 Ga0501045_0149943 Ga0501045_0149943_182_1507 431
297 3300053091 Ga0500647_0016079 Ga0500647_0016079_198_1523 431
298 3300053094 Ga0500566_0000028 Ga0500566_0000028_39985_41310 431
299 3300053159 Ga0500630_002522 Ga0500630_002522_1380_2705 431
300 3300053162 Ga0500638_055636 Ga0500638_055636_402_1727 431
301 3300053163 Ga0500639_000001 Ga0500639_000001_124364_125689 431
302 3300005937 Ga0081455_10058326 Ga0081455_100583261 432
303 3300009174 Ga0105241_10037373 Ga0105241_100373732 432
304 3300009545 Ga0105237_10004913 Ga0105237_100049138 432
305 3300010375 Ga0105239_10032781 Ga0105239_100327813 432
306 3300010375 Ga0105239_10055557 Ga0105239_100555572 432
307 3300025911 Ga0207654_10033777 Ga0207654_100337772 432
308 3300025913 Ga0207695_10000008 Ga0207695_10000008433 432
309 3300025914 Ga0207671_10003046 Ga0207671_100030467 432
310 3300046522 Ga0495643_0043532 Ga0495643_0043532_879_2222 432
311 3300048929 Ga0496126_0003787 Ga0496126_0003787_2894_4222 432
312 3300048929 Ga0496126_0073719 Ga0496126_0073719_1200_2534 432
313 3300053177 Ga0500636_0097833 Ga0500636_0097833_16_1353 432
314 3300033180 Ga0307510_10132604 Ga0307510_101326041 433
315 3300053077 Ga0495601_0000722 Ga0495601_0000722_8369_9709 433
316 3300053084 Ga0495595_0014888 Ga0495595_0014888_1100_2440 433
317 3300048924 Ga0496121_0078995 Ga0496121_0078995_594_1931 434
318 3300003752 Ga0055539_1002911 Ga0055539_10029112 435
319 3300025253 Ga0209677_100639 Ga0209677_1006395 435
320 3300025272 Ga0209455_1012264 Ga0209455_10122642 435
321 3300028666 Ga0265336_10000625 Ga0265336_100006252 435
322 3300028800 Ga0265338_10000667 Ga0265338_1000066738 435
323 3300048924 Ga0496121_0025479 Ga0496121_0025479_4031_5368 435
324 3300053111 Ga0500572_000197 Ga0500572_000197_596_1933 435
325 3300053136 Ga0500559_0000154 Ga0500559_0000154_39840_41177 435
326 3300053735 Ga0500596_000480 Ga0500596_000480_1059_2396 435

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00375

SDF

Sodium:dicarboxylate symporter family

79

470

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6uwl-assembly1.cif.gz_A gltph in complex with l-aspartate and sodium ions in intermediate outward-facing state 0.8594 22 406
7ngh-assembly1.cif.gz_C structure of glutamate transporter homologue in complex with sybody 0.8458 22 414
3v8g-assembly2.cif.gz_F crystal structure of an asymmetric trimer of a glutamate transporter homologue (gltph) 0.8397 22 406
3v8g-assembly1.cif.gz_C crystal structure of an asymmetric trimer of a glutamate transporter homologue (gltph) 0.8299 22 406
6uwf-assembly1.cif.gz_A gltph in complex with l-aspartate and sodium ions in outward-facing state 0.8291 22 406
ID Description Score Start End Superfamily
af_P21345_1_417_1.10.3860.10 Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter 0.9057 35 412 1.10.3860.10
af_P71906_20_424_1.10.3860.10 Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter 0.8946 22 411 1.10.3860.10
af_P0A830_1_408_1.10.3860.10 Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter 0.881 18 411 1.10.3860.10
af_P71906_20_424_1.10.3860.10 Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter 0.8618 22 411 1.10.3860.10
af_P0A830_1_408_1.10.3860.10 Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter 0.8506 18 411 1.10.3860.10
ID Description Score Start End GO Terms
AF-A0A7S2IYF1-F1-model_v4 Amino acid transporter 0.9686 277 419 GO:0005886
GO:0015138
GO:0015141
GO:0015366
GO:0070778
AF-A0A358XU19-F1-model_v4 C4-dicarboxylate transporter DctA 0.9591 255 419 GO:0005886
GO:0015138
GO:0015141
GO:0015366
GO:0070778
AF-A0A5E6W9B0-F1-model_v4 C4-dicarboxylate transport protein 2 0.9523 282 419 GO:0005886
GO:0015138
GO:0015141
GO:0015366
GO:0070778
AF-A0A4U3BL86-F1-model_v4 deleted 0.9505 231 419
AF-A0A7Y8KL94-F1-model_v4 Cation:dicarboxylase symporter family transporter 0.9505 255 419 GO:0005886
GO:0015138
GO:0015141
GO:0015366
GO:0070778

Feature Viewer

pLDDT pTM Quality
75.2 0.76 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map