F408317
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 326 | 248 | 200 | 438 |
Family's Representative Sequence
| Representative Sequence | 3300014325|Ga0163163_10008032|Ga0163163_100080327 |
| Length | 499 |
| Sequence | LRVEEIHCSLYVRGCPQRLNRLKRFDIDTVEKQGSAQGQGGVDKLRLSGEVSMVAATTRGMSTTPAARPTTRKPWYRVLYIQVLTAIVLGAIIGWLFPDFAKNDWIKAMGDGFVKLIKMVIAPIIFCTVVSGIAHISEVRKVGRVAVKALVYFEIVSTFALLLGLIVGNVLHPGAGFSGKADAGAVSTYAKQASEMRSVDFVLHIIPDSVVGAFAQGEILQVLLFSVLFGFALMALGDKGAPVRTFVDDVAHAMFGVIALIVKAAPIGAFGAMAYTIGRYGPQALGNLAGLIATFYFTAGAFVFLVLGTIAWFAGFSIFKYLRYIKDELLIVLGTSSSESALPQLMEKLERLGCSKPVVGLVVPTGYSFNLDGTNIYMTLATLFIAQALGVSLSFGEQMTILIVAMLTSKGASGVTGAGFITLAGTLAAVRPELVPGMAIVLGIDKFMSECRALTNICGNGVAAIVVSAWEGELDREKLAAGLNQEIDPSDVQEAVATG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 2 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 3 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 4 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 5 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 6 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 7 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 8 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 9 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 10 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 11 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 12 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 13 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 14 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 15 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 16 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 17 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 18 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 19 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 20 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 21 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 22 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 23 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 24 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 25 | 2791355199 | |||
| 26 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 27 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 28 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 29 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 30 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 31 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 32 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 33 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 34 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 35 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 36 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 37 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 38 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 39 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 40 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 41 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 42 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 43 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 44 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 45 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 46 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 47 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 48 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 49 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 50 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 51 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 52 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 53 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 54 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 55 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 56 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 57 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 58 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 59 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 60 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 61 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 62 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 63 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 64 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 65 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 66 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 67 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 68 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 69 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 70 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 71 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 72 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 73 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 74 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 75 | 2904699407 | |||
| 76 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 77 | 2906610324 | |||
| 78 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 79 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 80 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 81 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 82 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 83 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 84 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 85 | 2922368715 | |||
| 86 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 87 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 88 | 2922425934 | |||
| 89 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 90 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 91 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 92 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 93 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 94 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 95 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 96 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 97 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 98 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 99 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 101 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 103 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 104 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 109 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 110 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 111 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 113 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 114 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 115 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 116 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 117 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 118 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 120 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 121 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 122 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 123 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 124 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 125 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 126 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 134 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 135 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 136 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 137 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 138 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 139 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 158 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 159 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 160 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 161 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 164 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 165 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 166 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 167 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 168 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 169 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 170 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 171 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 172 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 173 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 174 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 175 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 176 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 177 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 178 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 179 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 180 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 181 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 182 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 183 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 184 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 185 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 186 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 187 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 188 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 189 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 190 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 194 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 195 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 196 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 197 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 198 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 199 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 200 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 201 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 202 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 203 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 204 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 205 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 206 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 207 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 208 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 209 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 210 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 215 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 228 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 229 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 230 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 231 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 232 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 233 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 234 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 235 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 236 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 237 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 238 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 239 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 240 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 241 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 242 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 243 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 244 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 245 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 246 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 247 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 248 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 62.5 |
| Metatranscriptomes | 0 |
| Isolates | 37.5 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.75 |
| Nodule | 26.99 |
| Rhizoplane | 7.98 |
| Rhizosphere | 31.9 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 26.38 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055539_1002911 | 3300003752 | Bacteria | 2490 |
| 2 | Ga0070659_100069458 | 3300005366 | Bacteria | 2796 |
| 3 | Ga0070709_10000495 | 3300005434 | Bacteria | 23229 |
| 4 | Ga0070714_100093232 | 3300005435 | Bacteria | 2640 |
| 5 | Ga0070714_100250299 | 3300005435 | Bacteria | 1638 |
| 6 | Ga0070713_100016952 | 3300005436 | Bacteria | 5493 |
| 7 | Ga0070710_10000593 | 3300005437 | Bacteria | 17230 |
| 8 | Ga0070711_100113853 | 3300005439 | Bacteria | 1990 |
| 9 | Ga0070708_100020578 | 3300005445 | Bacteria | 5567 |
| 10 | Ga0070663_100016569 | 3300005455 | Bacteria | 4792 |
| 11 | Ga0070663_100039488 | 3300005455 | Bacteria | 3298 |
| 12 | Ga0070662_100093680 | 3300005457 | Bacteria | 2260 |
| 13 | Ga0070707_100191418 | 3300005468 | Bacteria | 1994 |
| 14 | Ga0070698_100004809 | 3300005471 | Bacteria | 14825 |
| 15 | Ga0070698_100090975 | 3300005471 | Bacteria | 3034 |
| 16 | Ga0070679_100171479 | 3300005530 | Bacteria | 2142 |
| 17 | Ga0070665_100000268 | 3300005548 | Bacteria | 85516 |
| 18 | Ga0068855_100138867 | 3300005563 | Bacteria | 2772 |
| 19 | Ga0068857_100284324 | 3300005577 | Bacteria | 1522 |
| 20 | Ga0068856_100003581 | 3300005614 | Bacteria | 15629 |
| 21 | Ga0068860_100000258 | 3300005843 | Bacteria | 77761 |
| 22 | Ga0081455_10058326 | 3300005937 | Bacteria | 3266 |
| 23 | Ga0081540_1012392 | 3300005983 | Bacteria | 5622 |
| 24 | Ga0070717_10024733 | 3300006028 | Bacteria | 4772 |
| 25 | Ga0070717_10031803 | 3300006028 | Bacteria | 4248 |
| 26 | Ga0070717_10094524 | 3300006028 | Bacteria | 2529 |
| 27 | Ga0070712_100003717 | 3300006175 | Bacteria | 9394 |
| 28 | Ga0070712_100066833 | 3300006175 | Bacteria | 2557 |
| 29 | Ga0070712_100111717 | 3300006175 | Bacteria | 2040 |
| 30 | Ga0075362_10033504 | 3300006177 | Bacteria | 2234 |
| 31 | Ga0075369_10036941 | 3300006186 | Bacteria | 2079 |
| 32 | Ga0099825_1027754 | 3300006941 | Bacteria | 2842 |
| 33 | Ga0099824_1010874 | 3300006942 | Bacteria | 10520 |
| 34 | Ga0099824_1012209 | 3300006942 | Bacteria | 9455 |
| 35 | Ga0099822_1000046 | 3300006943 | Bacteria | 58661 |
| 36 | Ga0099823_1033013 | 3300006944 | Bacteria | 4179 |
| 37 | Ga0105240_10210784 | 3300009093 | Bacteria | 2270 |
| 38 | Ga0105241_10037373 | 3300009174 | Bacteria | 3657 |
| 39 | Ga0105237_10004913 | 3300009545 | Bacteria | 15297 |
| 40 | Ga0105237_10015274 | 3300009545 | Bacteria | 7998 |
| 41 | Ga0105237_10133473 | 3300009545 | Bacteria | 2477 |
| 42 | Ga0105238_10026078 | 3300009551 | Bacteria | 5956 |
| 43 | Ga0105239_10014223 | 3300010375 | Bacteria | 8832 |
| 44 | Ga0105239_10032781 | 3300010375 | Bacteria | 5708 |
| 45 | Ga0105239_10055557 | 3300010375 | Bacteria | 4343 |
| 46 | Ga0105239_10061802 | 3300010375 | Bacteria | 4111 |
| 47 | Ga0157370_10157976 | 3300013104 | Bacteria | 2109 |
| 48 | Ga0163163_10008032 | 3300014325 | Bacteria | 9344 |
| 49 | Ga0214544_1000005 | 3300021320 | Bacteria | 387675 |
| 50 | Ga0214542_1000004 | 3300021321 | Bacteria | 415597 |
| 51 | Ga0214545_1000005 | 3300021324 | Bacteria | 415590 |
| 52 | Ga0214543_1000030 | 3300021327 | Bacteria | 210137 |
| 53 | Ga0213876_10001647 | 3300021384 | Bacteria | 13628 |
| 54 | Ga0213876_10005436 | 3300021384 | Bacteria | 7006 |
| 55 | Ga0213876_10011418 | 3300021384 | Bacteria | 4743 |
| 56 | Ga0213871_10000196 | 3300021441 | Bacteria | 6926 |
| 57 | Ga0209677_100639 | 3300025253 | Bacteria | 18592 |
| 58 | Ga0209455_1012264 | 3300025272 | Bacteria | 2062 |
| 59 | Ga0209758_1002838 | 3300025297 | Bacteria | 16843 |
| 60 | Ga0207692_10000477 | 3300025898 | Bacteria | 14129 |
| 61 | Ga0207699_10000658 | 3300025906 | Bacteria | 16632 |
| 62 | Ga0207654_10033777 | 3300025911 | Bacteria | 2838 |
| 63 | Ga0207695_10000008 | 3300025913 | Bacteria | 1058268 |
| 64 | Ga0207695_10105028 | 3300025913 | Bacteria | 2812 |
| 65 | Ga0207671_10003046 | 3300025914 | Bacteria | 17160 |
| 66 | Ga0207671_10035115 | 3300025914 | Bacteria | 3723 |
| 67 | Ga0207671_10072924 | 3300025914 | Bacteria | 2563 |
| 68 | Ga0207693_10006794 | 3300025915 | Bacteria | 9448 |
| 69 | Ga0207657_10000784 | 3300025919 | Bacteria | 33773 |
| 70 | Ga0207694_10003293 | 3300025924 | Bacteria | 12853 |
| 71 | Ga0207700_10005326 | 3300025928 | Bacteria | 7673 |
| 72 | Ga0207664_10040450 | 3300025929 | Bacteria | 3626 |
| 73 | Ga0207667_10120812 | 3300025949 | Bacteria | 2700 |
| 74 | Ga0207667_10149263 | 3300025949 | Bacteria | 2406 |
| 75 | Ga0207678_10044604 | 3300026067 | Bacteria | 3835 |
| 76 | Ga0207702_10000442 | 3300026078 | Bacteria | 47074 |
| 77 | Ga0207702_10166082 | 3300026078 | Bacteria | 2019 |
| 78 | Ga0207674_10250106 | 3300026116 | Bacteria | 1720 |
| 79 | Ga0207698_10025275 | 3300026142 | Bacteria | 4181 |
| 80 | Ga0209389_1000048 | 3300027296 | Bacteria | 115074 |
| 81 | Ga0209389_1006361 | 3300027296 | Bacteria | 10245 |
| 82 | Ga0209589_1000109 | 3300027357 | Bacteria | 83533 |
| 83 | Ga0209589_1010139 | 3300027357 | Bacteria | 13843 |
| 84 | Ga0209489_100324 | 3300027361 | Bacteria | 83533 |
| 85 | Ga0209489_108475 | 3300027361 | Bacteria | 13953 |
| 86 | Ga0209489_109937 | 3300027361 | Bacteria | 11268 |
| 87 | Ga0209700_100020 | 3300027363 | Bacteria | 235733 |
| 88 | Ga0209700_100355 | 3300027363 | Bacteria | 83533 |
| 89 | Ga0268266_10000127 | 3300028379 | Bacteria | 149198 |
| 90 | Ga0268264_10000245 | 3300028381 | Bacteria | 102529 |
| 91 | Ga0265334_10014941 | 3300028573 | Bacteria | 3231 |
| 92 | Ga0265336_10000625 | 3300028666 | Bacteria | 19464 |
| 93 | Ga0265338_10000667 | 3300028800 | Bacteria | 59318 |
| 94 | Ga0265330_10029563 | 3300031235 | Bacteria | 2464 |
| 95 | Ga0265320_10001967 | 3300031240 | Bacteria | 14517 |
| 96 | Ga0265331_10019037 | 3300031250 | Bacteria | 3549 |
| 97 | Ga0307509_10068821 | 3300031507 | Bacteria | 3702 |
| 98 | Ga0307508_10000020 | 3300031616 | Bacteria | 188730 |
| 99 | Ga0307508_10052393 | 3300031616 | Bacteria | 3625 |
| 100 | Ga0265314_10004433 | 3300031711 | Bacteria | 13026 |
| 101 | Ga0307516_10011741 | 3300031730 | Bacteria | 9503 |
| 102 | Ga0307507_10024290 | 3300033179 | Bacteria | 6613 |
| 103 | Ga0307510_10132604 | 3300033180 | Bacteria | 2159 |
| 104 | Ga0315911_1000055 | 3300033442 | Bacteria | 26174 |
| 105 | Ga0373927_0036245 | 3300035695 | Bacteria | 3208 |
| 106 | Ga0373933_0000205 | 3300035724 | Bacteria | 39388 |
| 107 | Ga0373947_0028361 | 3300035725 | Bacteria | 3282 |
| 108 | Ga0373925_0181002 | 3300037068 | Bacteria | 1668 |
| 109 | Ga0395899_0100029 | 3300037312 | Bacteria | 2094 |
| 110 | Ga0395905_0003253 | 3300037471 | Bacteria | 17468 |
| 111 | Ga0436364_0816439 | 3300037853 | Bacteria | 2531 |
| 112 | Ga0395901_0210014 | 3300038443 | Bacteria | 2038 |
| 113 | Ga0395901_0217537 | 3300038443 | Bacteria | 1997 |
| 114 | Ga0436365_0030456 | 3300039437 | Bacteria | 55461 |
| 115 | Ga0436365_0045646 | 3300039437 | Bacteria | 5397 |
| 116 | Ga0436365_1587357 | 3300039437 | Bacteria | 14121 |
| 117 | Ga0436360_0413319 | 3300039438 | Bacteria | 2245 |
| 118 | Ga0436360_0588773 | 3300039438 | Bacteria | 5671 |
| 119 | Ga0436363_1388351 | 3300039450 | Bacteria | 4185 |
| 120 | Ga0439455_0023552 | 3300042012 | Bacteria | 1483 |
| 121 | Ga0466959_0017721 | 3300045049 | Bacteria | 5224 |
| 122 | Ga0466958_0057819 | 3300045836 | Bacteria | 2357 |
| 123 | Ga0495639_0055295 | 3300046475 | Bacteria | 1810 |
| 124 | Ga0495643_0043532 | 3300046522 | Bacteria | 2443 |
| 125 | Ga0495581_0059410 | 3300047315 | Bacteria | 2210 |
| 126 | Ga0496100_0052264 | 3300048903 | Bacteria | 2656 |
| 127 | Ga0496104_0001420 | 3300048907 | Bacteria | 20751 |
| 128 | Ga0496104_0070875 | 3300048907 | Bacteria | 3314 |
| 129 | Ga0496104_0140466 | 3300048907 | Bacteria | 2320 |
| 130 | Ga0496105_0011986 | 3300048908 | Bacteria | 6865 |
| 131 | Ga0496105_0072568 | 3300048908 | Bacteria | 2845 |
| 132 | Ga0496105_0191030 | 3300048908 | Bacteria | 1674 |
| 133 | Ga0496106_0002373 | 3300048909 | Bacteria | 14021 |
| 134 | Ga0496106_0003131 | 3300048909 | Bacteria | 12346 |
| 135 | Ga0496107_0006960 | 3300048910 | Bacteria | 7794 |
| 136 | Ga0496107_0009731 | 3300048910 | Bacteria | 6667 |
| 137 | Ga0496108_0001361 | 3300048911 | Bacteria | 19211 |
| 138 | Ga0496108_0023914 | 3300048911 | Bacteria | 5029 |
| 139 | Ga0496109_0000909 | 3300048912 | Bacteria | 24642 |
| 140 | Ga0496109_0015662 | 3300048912 | Bacteria | 6614 |
| 141 | Ga0496110_0036594 | 3300048913 | Bacteria | 4262 |
| 142 | Ga0496110_0066394 | 3300048913 | Bacteria | 3191 |
| 143 | Ga0496111_0010182 | 3300048914 | Bacteria | 6296 |
| 144 | Ga0496111_0063954 | 3300048914 | Bacteria | 2668 |
| 145 | Ga0496111_0204836 | 3300048914 | Bacteria | 1466 |
| 146 | Ga0496112_0002743 | 3300048915 | Bacteria | 14271 |
| 147 | Ga0496112_0006987 | 3300048915 | Bacteria | 9964 |
| 148 | Ga0496112_0081225 | 3300048915 | Bacteria | 3206 |
| 149 | Ga0496112_0101388 | 3300048915 | Bacteria | 2848 |
| 150 | Ga0496114_0130611 | 3300048917 | Bacteria | 2169 |
| 151 | Ga0496114_0304043 | 3300048917 | Bacteria | 1408 |
| 152 | Ga0496118_0004955 | 3300048921 | Bacteria | 15421 |
| 153 | Ga0496119_0002073 | 3300048922 | Bacteria | 22665 |
| 154 | Ga0496121_0000757 | 3300048924 | Bacteria | 59348 |
| 155 | Ga0496121_0001403 | 3300048924 | Bacteria | 40795 |
| 156 | Ga0496121_0025479 | 3300048924 | Bacteria | 5609 |
| 157 | Ga0496121_0063795 | 3300048924 | Bacteria | 3007 |
| 158 | Ga0496121_0078995 | 3300048924 | Bacteria | 2613 |
| 159 | Ga0496121_0104454 | 3300048924 | Bacteria | 2177 |
| 160 | Ga0496124_0007035 | 3300048927 | Bacteria | 12051 |
| 161 | Ga0496124_0038923 | 3300048927 | Bacteria | 4125 |
| 162 | Ga0496125_0102912 | 3300048928 | Bacteria | 2097 |
| 163 | Ga0496126_0003787 | 3300048929 | Bacteria | 18774 |
| 164 | Ga0496126_0024015 | 3300048929 | Bacteria | 5892 |
| 165 | Ga0496126_0064152 | 3300048929 | Bacteria | 3291 |
| 166 | Ga0496126_0073719 | 3300048929 | Bacteria | 3034 |
| 167 | Ga0501031_0007197 | 3300049568 | Bacteria | 7260 |
| 168 | Ga0501032_0064356 | 3300049569 | Bacteria | 2454 |
| 169 | Ga0501034_0164295 | 3300049571 | Bacteria | 2189 |
| 170 | Ga0501037_0016401 | 3300049573 | Bacteria | 5451 |
| 171 | Ga0501039_0045828 | 3300049575 | Bacteria | 3378 |
| 172 | Ga0501043_0038462 | 3300049579 | Bacteria | 3761 |
| 173 | Ga0501046_0009661 | 3300049580 | Bacteria | 8318 |
| 174 | Ga0501047_0196252 | 3300049581 | Bacteria | 1880 |
| 175 | Ga0501067_0011017 | 3300049583 | Bacteria | 5006 |
| 176 | Ga0501069_0069710 | 3300049585 | Bacteria | 1969 |
| 177 | Ga0501074_0064686 | 3300049590 | Bacteria | 2633 |
| 178 | Ga0501080_0014062 | 3300049742 | Bacteria | 7366 |
| 179 | Ga0501083_0036433 | 3300049744 | Bacteria | 3356 |
| 180 | Ga0501035_0050678 | 3300049822 | Bacteria | 3719 |
| 181 | Ga0501045_0149943 | 3300049824 | Bacteria | 1734 |
| 182 | Ga0495601_0000722 | 3300053077 | Bacteria | 17751 |
| 183 | Ga0495601_0044343 | 3300053077 | Bacteria | 2795 |
| 184 | Ga0495595_0014888 | 3300053084 | Bacteria | 3307 |
| 185 | Ga0500647_0016079 | 3300053091 | Bacteria | 3432 |
| 186 | Ga0500566_0000028 | 3300053094 | Bacteria | 75589 |
| 187 | Ga0500566_0041236 | 3300053094 | Bacteria | 2667 |
| 188 | Ga0500556_0000637 | 3300053104 | Bacteria | 22030 |
| 189 | Ga0500572_000197 | 3300053111 | Bacteria | 21327 |
| 190 | Ga0500595_013657 | 3300053119 | Bacteria | 3106 |
| 191 | Ga0500595_014039 | 3300053119 | Bacteria | 3051 |
| 192 | Ga0500559_0000154 | 3300053136 | Bacteria | 54106 |
| 193 | Ga0500559_0006433 | 3300053136 | Bacteria | 5305 |
| 194 | Ga0500630_002522 | 3300053159 | Bacteria | 8836 |
| 195 | Ga0500638_055636 | 3300053162 | Bacteria | 1907 |
| 196 | Ga0500639_000001 | 3300053163 | Bacteria | 244795 |
| 197 | Ga0500636_0097833 | 3300053177 | Bacteria | 1672 |
| 198 | Ga0500637_0010617 | 3300053178 | Bacteria | 4726 |
| 199 | Ga0500596_000480 | 3300053735 | Bacteria | 7469 |
| 200 | Ga0500596_005457 | 3300053735 | Bacteria | 2236 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005457 | Ga0070662_100093680 | Ga0070662_1000936802 | 400 |
| 2 | 3300031250 | Ga0265331_10019037 | Ga0265331_100190373 | 400 |
| 3 | iso_pu_bacteria | 2824609381 | 2824613276 | 404 |
| 4 | 3300010375 | Ga0105239_10014223 | Ga0105239_100142236 | 405 |
| 5 | iso_pu_bacteria | 2922425934 | 2922426754 | 405 |
| 6 | 3300037853 | Ga0436364_0816439 | Ga0436364_0816439_398_1741 | 408 |
| 7 | 3300053178 | Ga0500637_0010617 | Ga0500637_0010617_2448_3707 | 409 |
| 8 | 3300005548 | Ga0070665_100000268 | Ga0070665_10000026814 | 410 |
| 9 | 3300005563 | Ga0068855_100138867 | Ga0068855_1001388672 | 410 |
| 10 | 3300009545 | Ga0105237_10133473 | Ga0105237_101334732 | 410 |
| 11 | 3300009551 | Ga0105238_10026078 | Ga0105238_100260784 | 410 |
| 12 | 3300010375 | Ga0105239_10061802 | Ga0105239_100618024 | 410 |
| 13 | 3300025924 | Ga0207694_10003293 | Ga0207694_100032932 | 410 |
| 14 | 3300025949 | Ga0207667_10120812 | Ga0207667_101208122 | 410 |
| 15 | 3300028379 | Ga0268266_10000127 | Ga0268266_10000127152 | 410 |
| 16 | 3300031240 | Ga0265320_10001967 | Ga0265320_100019679 | 410 |
| 17 | 3300037312 | Ga0395899_0100029 | Ga0395899_0100029_36_1355 | 410 |
| 18 | 3300053119 | Ga0500595_013657 | Ga0500595_013657_468_1862 | 411 |
| 19 | 3300048927 | Ga0496124_0038923 | Ga0496124_0038923_323_1636 | 413 |
| 20 | 3300005439 | Ga0070711_100113853 | Ga0070711_1001138531 | 414 |
| 21 | 3300006175 | Ga0070712_100003717 | Ga0070712_1000037172 | 414 |
| 22 | 3300025915 | Ga0207693_10006794 | Ga0207693_100067949 | 414 |
| 23 | 3300005435 | Ga0070714_100250299 | Ga0070714_1002502991 | 415 |
| 24 | 3300048915 | Ga0496112_0081225 | Ga0496112_0081225_215_1522 | 416 |
| 25 | 3300005434 | Ga0070709_10000495 | Ga0070709_1000049514 | 417 |
| 26 | 3300005435 | Ga0070714_100093232 | Ga0070714_1000932322 | 417 |
| 27 | 3300005437 | Ga0070710_10000593 | Ga0070710_100005932 | 417 |
| 28 | 3300025898 | Ga0207692_10000477 | Ga0207692_100004774 | 417 |
| 29 | 3300025906 | Ga0207699_10000658 | Ga0207699_100006582 | 417 |
| 30 | 3300025928 | Ga0207700_10005326 | Ga0207700_100053264 | 417 |
| 31 | 3300025929 | Ga0207664_10040450 | Ga0207664_100404502 | 417 |
| 32 | 3300039438 | Ga0436360_0413319 | Ga0436360_0413319_814_2175 | 417 |
| 33 | 3300048924 | Ga0496121_0104454 | Ga0496121_0104454_806_2125 | 418 |
| 34 | 3300006175 | Ga0070712_100111717 | Ga0070712_1001117173 | 420 |
| 35 | 3300049744 | Ga0501083_0036433 | Ga0501083_0036433_1614_2930 | 420 |
| 36 | iso_pu_bacteria | 2903748898 | 2903757960 | 420 |
| 37 | iso_pu_bacteria | 2906660503 | 2906663482 | 420 |
| 38 | iso_pu_bacteria | 2908739725 | 2908745474 | 420 |
| 39 | 3300045049 | Ga0466959_0017721 | Ga0466959_0017721_3633_4955 | 421 |
| 40 | iso_pu_bacteria | 2847930680 | 2847932726 | 421 |
| 41 | iso_pu_bacteria | 2879083081 | 2879090920 | 421 |
| 42 | iso_pu_bacteria | 2513237092 | 2513622066 | 422 |
| 43 | iso_pu_bacteria | 2617270735 | 2617348528 | 422 |
| 44 | iso_pu_bacteria | 2824626560 | 2824629025 | 422 |
| 45 | iso_pu_bacteria | 2824704595 | 2824704862 | 422 |
| 46 | iso_pu_bacteria | 2824753945 | 2824754130 | 422 |
| 47 | iso_pu_bacteria | 2824763712 | 2824765690 | 422 |
| 48 | iso_pu_bacteria | 2824773399 | 2824777583 | 422 |
| 49 | iso_pu_bacteria | 2841949485 | 2841955787 | 422 |
| 50 | iso_pu_bacteria | 2841957949 | 2841961475 | 422 |
| 51 | iso_pu_bacteria | 2841966195 | 2841970156 | 422 |
| 52 | iso_pu_bacteria | 2841974524 | 2841977194 | 422 |
| 53 | iso_pu_bacteria | 2841983080 | 2841985674 | 422 |
| 54 | iso_pu_bacteria | 2874612657 | 2874613894 | 422 |
| 55 | iso_pu_bacteria | 2881665667 | 2881667034 | 422 |
| 56 | iso_pu_bacteria | 2885366525 | 2885373567 | 422 |
| 57 | iso_pu_bacteria | 2904711408 | 2904718908 | 422 |
| 58 | iso_pu_bacteria | 3005483717 | 3005484168 | 422 |
| 59 | 3300005983 | Ga0081540_1012392 | Ga0081540_10123923 | 423 |
| 60 | 3300009093 | Ga0105240_10210784 | Ga0105240_102107842 | 423 |
| 61 | 3300025913 | Ga0207695_10105028 | Ga0207695_101050283 | 423 |
| 62 | 3300031235 | Ga0265330_10029563 | Ga0265330_100295632 | 423 |
| 63 | 3300031711 | Ga0265314_10004433 | Ga0265314_1000443313 | 423 |
| 64 | 3300035724 | Ga0373933_0000205 | Ga0373933_0000205_14118_15443 | 423 |
| 65 | iso_pu_bacteria | 2728368998 | 2728749787 | 423 |
| 66 | iso_pu_bacteria | 2885374607 | 2885374624 | 423 |
| 67 | iso_pu_bacteria | 2906643746 | 2906644335 | 423 |
| 68 | iso_pu_bacteria | 2513237095 | 2513653480 | 424 |
| 69 | iso_pu_bacteria | 2513237102 | 2513706897 | 424 |
| 70 | iso_pu_bacteria | 2513237137 | 2513864067 | 424 |
| 71 | iso_pu_bacteria | 2513237139 | 2513880316 | 424 |
| 72 | iso_pu_bacteria | 2517093001 | 2517108799 | 424 |
| 73 | iso_pu_bacteria | 2517572143 | 2517890262 | 424 |
| 74 | iso_pu_bacteria | 2528768022 | 2528858808 | 424 |
| 75 | iso_pu_bacteria | 2791355197 | 2793067766 | 424 |
| 76 | iso_pu_bacteria | 2816332527 | 2818244187 | 424 |
| 77 | iso_pu_bacteria | 2841941048 | 2841948300 | 424 |
| 78 | iso_pu_bacteria | 2847939898 | 2847940900 | 424 |
| 79 | iso_pu_bacteria | 2904690495 | 2904692853 | 424 |
| 80 | iso_pu_bacteria | 2908756301 | 2908758265 | 424 |
| 81 | iso_pu_bacteria | 2929615660 | 2929624446 | 424 |
| 82 | iso_pu_bacteria | 2929624759 | 2929633721 | 424 |
| 83 | iso_pu_bacteria | 2933577622 | 2933586340 | 424 |
| 84 | iso_pu_bacteria | 3005474847 | 3005482701 | 424 |
| 85 | iso_pu_bacteria | 8055742211 | 8055743832 | 424 |
| 86 | 3300006028 | Ga0070717_10024733 | Ga0070717_100247332 | 425 |
| 87 | 3300021384 | Ga0213876_10011418 | Ga0213876_100114183 | 425 |
| 88 | 3300039437 | Ga0436365_0045646 | Ga0436365_0045646_2334_3659 | 425 |
| 89 | 3300048915 | Ga0496112_0101388 | Ga0496112_0101388_147_1514 | 425 |
| 90 | iso_pu_bacteria | 2874604998 | 2874611847 | 425 |
| 91 | 3300006942 | Ga0099824_1012209 | Ga0099824_10122093 | 426 |
| 92 | 3300027296 | Ga0209389_1006361 | Ga0209389_10063619 | 426 |
| 93 | 3300027357 | Ga0209589_1010139 | Ga0209589_10101398 | 426 |
| 94 | 3300027361 | Ga0209489_108475 | Ga0209489_1084758 | 426 |
| 95 | 3300048922 | Ga0496119_0002073 | Ga0496119_0002073_28_1419 | 426 |
| 96 | iso_pu_bacteria | 2508501128 | 2509150428 | 426 |
| 97 | iso_pu_bacteria | 2508501128 | 2509153381 | 426 |
| 98 | iso_pu_bacteria | 2513237094 | 2513641625 | 426 |
| 99 | iso_pu_bacteria | 2513237096 | 2513661756 | 426 |
| 100 | iso_pu_bacteria | 2513237098 | 2513679833 | 426 |
| 101 | iso_pu_bacteria | 2513237101 | 2513698733 | 426 |
| 102 | iso_pu_bacteria | 2513237145 | 2513923402 | 426 |
| 103 | iso_pu_bacteria | 2513237161 | 2514015456 | 426 |
| 104 | iso_pu_bacteria | 2524023228 | 2524541574 | 426 |
| 105 | iso_pu_bacteria | 2617270741 | 2617379310 | 426 |
| 106 | iso_pu_bacteria | 2721755755 | 2723844175 | 426 |
| 107 | iso_pu_bacteria | 2791355199 | 2793081999 | 426 |
| 108 | iso_pu_bacteria | 2802429603 | 2805921733 | 426 |
| 109 | iso_pu_bacteria | 2824600985 | 2824601433 | 426 |
| 110 | iso_pu_bacteria | 2824653114 | 2824656681 | 426 |
| 111 | iso_pu_bacteria | 2824661429 | 2824661707 | 426 |
| 112 | iso_pu_bacteria | 2824671348 | 2824672349 | 426 |
| 113 | iso_pu_bacteria | 2824679649 | 2824680655 | 426 |
| 114 | iso_pu_bacteria | 2824687955 | 2824689211 | 426 |
| 115 | iso_pu_bacteria | 2824696289 | 2824697249 | 426 |
| 116 | iso_pu_bacteria | 2824732956 | 2824733116 | 426 |
| 117 | iso_pu_bacteria | 2824746037 | 2824747140 | 426 |
| 118 | iso_pu_bacteria | 2838122688 | 2838124927 | 426 |
| 119 | iso_pu_bacteria | 2874620515 | 2874625702 | 426 |
| 120 | iso_pu_bacteria | 2876808645 | 2876816204 | 426 |
| 121 | iso_pu_bacteria | 2879110137 | 2879116379 | 426 |
| 122 | iso_pu_bacteria | 2881364244 | 2881368991 | 426 |
| 123 | iso_pu_bacteria | 2885383462 | 2885391870 | 426 |
| 124 | iso_pu_bacteria | 2888378607 | 2888380508 | 426 |
| 125 | iso_pu_bacteria | 2889033259 | 2889041607 | 426 |
| 126 | iso_pu_bacteria | 2903768456 | 2903777221 | 426 |
| 127 | iso_pu_bacteria | 2904666416 | 2904673485 | 426 |
| 128 | iso_pu_bacteria | 2904699407 | 2904706628 | 426 |
| 129 | iso_pu_bacteria | 2906610324 | 2906614936 | 426 |
| 130 | iso_pu_bacteria | 2906635258 | 2906635677 | 426 |
| 131 | iso_pu_bacteria | 2908775508 | 2908777568 | 426 |
| 132 | iso_pu_bacteria | 2922361189 | 2922366524 | 426 |
| 133 | iso_pu_bacteria | 2922368715 | 2922378020 | 426 |
| 134 | iso_pu_bacteria | 2922386360 | 2922386392 | 426 |
| 135 | iso_pu_bacteria | 2922393267 | 2922394168 | 426 |
| 136 | iso_pu_bacteria | 2941507105 | 2941514367 | 426 |
| 137 | iso_pu_bacteria | 2941515067 | 2941522797 | 426 |
| 138 | iso_pu_bacteria | 2941523033 | 2941530757 | 426 |
| 139 | iso_pu_bacteria | 3005587118 | 3005589942 | 426 |
| 140 | iso_pu_bacteria | 8006933436 | 8006938032 | 426 |
| 141 | iso_pu_bacteria | 8006964411 | 8006972907 | 426 |
| 142 | iso_pu_bacteria | 8006973647 | 8006978134 | 426 |
| 143 | iso_pu_bacteria | 8006984368 | 8006985513 | 426 |
| 144 | iso_pu_bacteria | 8006994254 | 8007000639 | 426 |
| 145 | iso_pu_bacteria | 8019555841 | 8019560435 | 426 |
| 146 | iso_pu_bacteria | 8019565922 | 8019570532 | 426 |
| 147 | iso_pu_bacteria | 8056673599 | 8056680232 | 426 |
| 148 | iso_pu_bacteria | 8056681323 | 8056686463 | 426 |
| 149 | 3300006028 | Ga0070717_10094524 | Ga0070717_100945241 | 427 |
| 150 | 3300006175 | Ga0070712_100066833 | Ga0070712_1000668333 | 427 |
| 151 | 3300006177 | Ga0075362_10033504 | Ga0075362_100335042 | 427 |
| 152 | 3300006186 | Ga0075369_10036941 | Ga0075369_100369412 | 427 |
| 153 | 3300006944 | Ga0099823_1033013 | Ga0099823_10330132 | 427 |
| 154 | 3300025297 | Ga0209758_1002838 | Ga0209758_100283810 | 427 |
| 155 | 3300027296 | Ga0209389_1000048 | Ga0209389_100004885 | 427 |
| 156 | 3300027361 | Ga0209489_109937 | Ga0209489_1099378 | 427 |
| 157 | 3300027363 | Ga0209700_100020 | Ga0209700_100020197 | 427 |
| 158 | 3300037471 | Ga0395905_0003253 | Ga0395905_0003253_5337_6650 | 427 |
| 159 | 3300038443 | Ga0395901_0210014 | Ga0395901_0210014_452_1765 | 427 |
| 160 | 3300048909 | Ga0496106_0002373 | Ga0496106_0002373_268_1599 | 427 |
| 161 | 3300048910 | Ga0496107_0009731 | Ga0496107_0009731_3675_5006 | 427 |
| 162 | 3300048911 | Ga0496108_0001361 | Ga0496108_0001361_13877_15208 | 427 |
| 163 | 3300048912 | Ga0496109_0000909 | Ga0496109_0000909_7669_9000 | 427 |
| 164 | 3300048913 | Ga0496110_0066394 | Ga0496110_0066394_722_2053 | 427 |
| 165 | 3300048915 | Ga0496112_0006987 | Ga0496112_0006987_6457_7788 | 427 |
| 166 | 3300048917 | Ga0496114_0304043 | Ga0496114_0304043_32_1363 | 427 |
| 167 | 3300005471 | Ga0070698_100090975 | Ga0070698_1000909753 | 428 |
| 168 | 3300005843 | Ga0068860_100000258 | Ga0068860_10000025811 | 428 |
| 169 | 3300021384 | Ga0213876_10005436 | Ga0213876_100054365 | 428 |
| 170 | 3300025914 | Ga0207671_10035115 | Ga0207671_100351152 | 428 |
| 171 | 3300025914 | Ga0207671_10072924 | Ga0207671_100729242 | 428 |
| 172 | 3300028381 | Ga0268264_10000245 | Ga0268264_1000024524 | 428 |
| 173 | 3300031507 | Ga0307509_10068821 | Ga0307509_100688212 | 428 |
| 174 | 3300031616 | Ga0307508_10000020 | Ga0307508_1000002065 | 428 |
| 175 | 3300031616 | Ga0307508_10052393 | Ga0307508_100523933 | 428 |
| 176 | 3300031730 | Ga0307516_10011741 | Ga0307516_100117415 | 428 |
| 177 | 3300033179 | Ga0307507_10024290 | Ga0307507_100242904 | 428 |
| 178 | 3300033442 | Ga0315911_1000055 | Ga0315911_10000556 | 428 |
| 179 | 3300035695 | Ga0373927_0036245 | Ga0373927_0036245_651_1967 | 428 |
| 180 | 3300037068 | Ga0373925_0181002 | Ga0373925_0181002_133_1449 | 428 |
| 181 | 3300042012 | Ga0439455_0023552 | Ga0439455_0023552_35_1351 | 428 |
| 182 | 3300048909 | Ga0496106_0003131 | Ga0496106_0003131_10276_11592 | 428 |
| 183 | 3300048921 | Ga0496118_0004955 | Ga0496118_0004955_11276_12592 | 428 |
| 184 | 3300048924 | Ga0496121_0000757 | Ga0496121_0000757_6859_8175 | 428 |
| 185 | 3300048927 | Ga0496124_0007035 | Ga0496124_0007035_7043_8359 | 428 |
| 186 | 3300048928 | Ga0496125_0102912 | Ga0496125_0102912_573_1889 | 428 |
| 187 | 3300053077 | Ga0495601_0044343 | Ga0495601_0044343_1466_2782 | 428 |
| 188 | 3300053094 | Ga0500566_0041236 | Ga0500566_0041236_1327_2643 | 428 |
| 189 | 3300053119 | Ga0500595_014039 | Ga0500595_014039_14_1330 | 428 |
| 190 | 3300053136 | Ga0500559_0006433 | Ga0500559_0006433_3081_4397 | 428 |
| 191 | 3300053735 | Ga0500596_005457 | Ga0500596_005457_408_1724 | 428 |
| 192 | iso_pu_bacteria | 2508501114 | 2509075556 | 428 |
| 193 | iso_pu_bacteria | 2513237098 | 2513673885 | 428 |
| 194 | iso_pu_bacteria | 2524023210 | 2524469603 | 428 |
| 195 | iso_pu_bacteria | 2824617872 | 2824619590 | 428 |
| 196 | iso_pu_bacteria | 2824635225 | 2824635692 | 428 |
| 197 | iso_pu_bacteria | 2824644064 | 2824644677 | 428 |
| 198 | iso_pu_bacteria | 2824714736 | 2824715108 | 428 |
| 199 | iso_pu_bacteria | 2824723954 | 2824724361 | 428 |
| 200 | iso_pu_bacteria | 8056681323 | 8056686621 | 428 |
| 201 | 3300009545 | Ga0105237_10015274 | Ga0105237_100152747 | 429 |
| 202 | 3300025949 | Ga0207667_10149263 | Ga0207667_101492632 | 429 |
| 203 | 3300026078 | Ga0207702_10166082 | Ga0207702_101660822 | 429 |
| 204 | 3300026142 | Ga0207698_10025275 | Ga0207698_100252753 | 429 |
| 205 | 3300039437 | Ga0436365_0030456 | Ga0436365_0030456_16224_17543 | 429 |
| 206 | 3300048908 | Ga0496105_0072568 | Ga0496105_0072568_10_1329 | 429 |
| 207 | 3300048914 | Ga0496111_0204836 | Ga0496111_0204836_114_1433 | 429 |
| 208 | iso_pu_bacteria | 2885383462 | 2885390897 | 429 |
| 209 | 3300005455 | Ga0070663_100039488 | Ga0070663_1000394882 | 430 |
| 210 | 3300006941 | Ga0099825_1027754 | Ga0099825_10277542 | 430 |
| 211 | 3300006942 | Ga0099824_1010874 | Ga0099824_10108743 | 430 |
| 212 | 3300006943 | Ga0099822_1000046 | Ga0099822_100004659 | 430 |
| 213 | 3300021320 | Ga0214544_1000005 | Ga0214544_1000005232 | 430 |
| 214 | 3300021321 | Ga0214542_1000004 | Ga0214542_1000004236 | 430 |
| 215 | 3300021324 | Ga0214545_1000005 | Ga0214545_1000005159 | 430 |
| 216 | 3300021327 | Ga0214543_1000030 | Ga0214543_100003026 | 430 |
| 217 | 3300021384 | Ga0213876_10001647 | Ga0213876_100016477 | 430 |
| 218 | 3300021441 | Ga0213871_10000196 | Ga0213871_100001963 | 430 |
| 219 | 3300027357 | Ga0209589_1000109 | Ga0209589_100010914 | 430 |
| 220 | 3300027361 | Ga0209489_100324 | Ga0209489_10032414 | 430 |
| 221 | 3300027363 | Ga0209700_100355 | Ga0209700_10035514 | 430 |
| 222 | 3300039437 | Ga0436365_1587357 | Ga0436365_1587357_5914_7236 | 430 |
| 223 | 3300039438 | Ga0436360_0588773 | Ga0436360_0588773_3124_4446 | 430 |
| 224 | 3300039450 | Ga0436363_1388351 | Ga0436363_1388351_1033_2355 | 430 |
| 225 | 3300053104 | Ga0500556_0000637 | Ga0500556_0000637_4857_6335 | 430 |
| 226 | iso_pu_bacteria | 2513237095 | 2513645333 | 430 |
| 227 | iso_pu_bacteria | 2513237102 | 2513702821 | 430 |
| 228 | iso_pu_bacteria | 2513237139 | 2513873254 | 430 |
| 229 | iso_pu_bacteria | 2773857925 | 2774871607 | 430 |
| 230 | iso_pu_bacteria | 2802429603 | 2805914758 | 430 |
| 231 | iso_pu_bacteria | 2816332527 | 2818239571 | 430 |
| 232 | iso_pu_bacteria | 2824679649 | 2824681082 | 430 |
| 233 | iso_pu_bacteria | 2824696289 | 2824700336 | 430 |
| 234 | iso_pu_bacteria | 2847939898 | 2847947156 | 430 |
| 235 | iso_pu_bacteria | 2874612657 | 2874617483 | 430 |
| 236 | iso_pu_bacteria | 2885409591 | 2885411120 | 430 |
| 237 | iso_pu_bacteria | 2888378607 | 2888384588 | 430 |
| 238 | iso_pu_bacteria | 2904690495 | 2904695477 | 430 |
| 239 | iso_pu_bacteria | 2904699407 | 2904706972 | 430 |
| 240 | iso_pu_bacteria | 2908756301 | 2908757477 | 430 |
| 241 | iso_pu_bacteria | 8006933436 | 8006934758 | 430 |
| 242 | iso_pu_bacteria | 8006973647 | 8006974726 | 430 |
| 243 | 3300005366 | Ga0070659_100069458 | Ga0070659_1000694582 | 431 |
| 244 | 3300005436 | Ga0070713_100016952 | Ga0070713_1000169522 | 431 |
| 245 | 3300005445 | Ga0070708_100020578 | Ga0070708_1000205782 | 431 |
| 246 | 3300005455 | Ga0070663_100016569 | Ga0070663_1000165693 | 431 |
| 247 | 3300005468 | Ga0070707_100191418 | Ga0070707_1001914182 | 431 |
| 248 | 3300005471 | Ga0070698_100004809 | Ga0070698_10000480912 | 431 |
| 249 | 3300005530 | Ga0070679_100171479 | Ga0070679_1001714791 | 431 |
| 250 | 3300005577 | Ga0068857_100284324 | Ga0068857_1002843241 | 431 |
| 251 | 3300005614 | Ga0068856_100003581 | Ga0068856_1000035815 | 431 |
| 252 | 3300006028 | Ga0070717_10031803 | Ga0070717_100318034 | 431 |
| 253 | 3300013104 | Ga0157370_10157976 | Ga0157370_101579761 | 431 |
| 254 | 3300014325 | Ga0163163_10008032 | Ga0163163_100080327 | 431 |
| 255 | 3300025919 | Ga0207657_10000784 | Ga0207657_1000078423 | 431 |
| 256 | 3300026067 | Ga0207678_10044604 | Ga0207678_100446042 | 431 |
| 257 | 3300026078 | Ga0207702_10000442 | Ga0207702_100004429 | 431 |
| 258 | 3300026116 | Ga0207674_10250106 | Ga0207674_102501062 | 431 |
| 259 | 3300028573 | Ga0265334_10014941 | Ga0265334_100149411 | 431 |
| 260 | 3300035725 | Ga0373947_0028361 | Ga0373947_0028361_422_1774 | 431 |
| 261 | 3300038443 | Ga0395901_0217537 | Ga0395901_0217537_277_1602 | 431 |
| 262 | 3300045836 | Ga0466958_0057819 | Ga0466958_0057819_742_2076 | 431 |
| 263 | 3300046475 | Ga0495639_0055295 | Ga0495639_0055295_349_1701 | 431 |
| 264 | 3300047315 | Ga0495581_0059410 | Ga0495581_0059410_141_1493 | 431 |
| 265 | 3300048903 | Ga0496100_0052264 | Ga0496100_0052264_565_1908 | 431 |
| 266 | 3300048907 | Ga0496104_0001420 | Ga0496104_0001420_6019_7362 | 431 |
| 267 | 3300048907 | Ga0496104_0070875 | Ga0496104_0070875_1551_2903 | 431 |
| 268 | 3300048907 | Ga0496104_0140466 | Ga0496104_0140466_785_2128 | 431 |
| 269 | 3300048908 | Ga0496105_0011986 | Ga0496105_0011986_5462_6808 | 431 |
| 270 | 3300048908 | Ga0496105_0191030 | Ga0496105_0191030_189_1532 | 431 |
| 271 | 3300048910 | Ga0496107_0006960 | Ga0496107_0006960_315_1640 | 431 |
| 272 | 3300048911 | Ga0496108_0023914 | Ga0496108_0023914_1321_2664 | 431 |
| 273 | 3300048912 | Ga0496109_0015662 | Ga0496109_0015662_1322_2665 | 431 |
| 274 | 3300048913 | Ga0496110_0036594 | Ga0496110_0036594_566_1909 | 431 |
| 275 | 3300048914 | Ga0496111_0010182 | Ga0496111_0010182_857_2200 | 431 |
| 276 | 3300048914 | Ga0496111_0063954 | Ga0496111_0063954_444_1886 | 431 |
| 277 | 3300048915 | Ga0496112_0002743 | Ga0496112_0002743_7066_8409 | 431 |
| 278 | 3300048917 | Ga0496114_0130611 | Ga0496114_0130611_789_2132 | 431 |
| 279 | 3300048924 | Ga0496121_0001403 | Ga0496121_0001403_27857_29182 | 431 |
| 280 | 3300048924 | Ga0496121_0063795 | Ga0496121_0063795_94_1485 | 431 |
| 281 | 3300048929 | Ga0496126_0024015 | Ga0496126_0024015_2822_4147 | 431 |
| 282 | 3300048929 | Ga0496126_0064152 | Ga0496126_0064152_595_1920 | 431 |
| 283 | 3300049568 | Ga0501031_0007197 | Ga0501031_0007197_1453_2778 | 431 |
| 284 | 3300049569 | Ga0501032_0064356 | Ga0501032_0064356_1101_2426 | 431 |
| 285 | 3300049571 | Ga0501034_0164295 | Ga0501034_0164295_732_2057 | 431 |
| 286 | 3300049573 | Ga0501037_0016401 | Ga0501037_0016401_121_1446 | 431 |
| 287 | 3300049575 | Ga0501039_0045828 | Ga0501039_0045828_1323_2648 | 431 |
| 288 | 3300049579 | Ga0501043_0038462 | Ga0501043_0038462_1293_2618 | 431 |
| 289 | 3300049580 | Ga0501046_0009661 | Ga0501046_0009661_697_2022 | 431 |
| 290 | 3300049581 | Ga0501047_0196252 | Ga0501047_0196252_29_1354 | 431 |
| 291 | 3300049583 | Ga0501067_0011017 | Ga0501067_0011017_2633_3958 | 431 |
| 292 | 3300049585 | Ga0501069_0069710 | Ga0501069_0069710_329_1654 | 431 |
| 293 | 3300049590 | Ga0501074_0064686 | Ga0501074_0064686_457_1782 | 431 |
| 294 | 3300049742 | Ga0501080_0014062 | Ga0501080_0014062_4900_6225 | 431 |
| 295 | 3300049822 | Ga0501035_0050678 | Ga0501035_0050678_2262_3587 | 431 |
| 296 | 3300049824 | Ga0501045_0149943 | Ga0501045_0149943_182_1507 | 431 |
| 297 | 3300053091 | Ga0500647_0016079 | Ga0500647_0016079_198_1523 | 431 |
| 298 | 3300053094 | Ga0500566_0000028 | Ga0500566_0000028_39985_41310 | 431 |
| 299 | 3300053159 | Ga0500630_002522 | Ga0500630_002522_1380_2705 | 431 |
| 300 | 3300053162 | Ga0500638_055636 | Ga0500638_055636_402_1727 | 431 |
| 301 | 3300053163 | Ga0500639_000001 | Ga0500639_000001_124364_125689 | 431 |
| 302 | 3300005937 | Ga0081455_10058326 | Ga0081455_100583261 | 432 |
| 303 | 3300009174 | Ga0105241_10037373 | Ga0105241_100373732 | 432 |
| 304 | 3300009545 | Ga0105237_10004913 | Ga0105237_100049138 | 432 |
| 305 | 3300010375 | Ga0105239_10032781 | Ga0105239_100327813 | 432 |
| 306 | 3300010375 | Ga0105239_10055557 | Ga0105239_100555572 | 432 |
| 307 | 3300025911 | Ga0207654_10033777 | Ga0207654_100337772 | 432 |
| 308 | 3300025913 | Ga0207695_10000008 | Ga0207695_10000008433 | 432 |
| 309 | 3300025914 | Ga0207671_10003046 | Ga0207671_100030467 | 432 |
| 310 | 3300046522 | Ga0495643_0043532 | Ga0495643_0043532_879_2222 | 432 |
| 311 | 3300048929 | Ga0496126_0003787 | Ga0496126_0003787_2894_4222 | 432 |
| 312 | 3300048929 | Ga0496126_0073719 | Ga0496126_0073719_1200_2534 | 432 |
| 313 | 3300053177 | Ga0500636_0097833 | Ga0500636_0097833_16_1353 | 432 |
| 314 | 3300033180 | Ga0307510_10132604 | Ga0307510_101326041 | 433 |
| 315 | 3300053077 | Ga0495601_0000722 | Ga0495601_0000722_8369_9709 | 433 |
| 316 | 3300053084 | Ga0495595_0014888 | Ga0495595_0014888_1100_2440 | 433 |
| 317 | 3300048924 | Ga0496121_0078995 | Ga0496121_0078995_594_1931 | 434 |
| 318 | 3300003752 | Ga0055539_1002911 | Ga0055539_10029112 | 435 |
| 319 | 3300025253 | Ga0209677_100639 | Ga0209677_1006395 | 435 |
| 320 | 3300025272 | Ga0209455_1012264 | Ga0209455_10122642 | 435 |
| 321 | 3300028666 | Ga0265336_10000625 | Ga0265336_100006252 | 435 |
| 322 | 3300028800 | Ga0265338_10000667 | Ga0265338_1000066738 | 435 |
| 323 | 3300048924 | Ga0496121_0025479 | Ga0496121_0025479_4031_5368 | 435 |
| 324 | 3300053111 | Ga0500572_000197 | Ga0500572_000197_596_1933 | 435 |
| 325 | 3300053136 | Ga0500559_0000154 | Ga0500559_0000154_39840_41177 | 435 |
| 326 | 3300053735 | Ga0500596_000480 | Ga0500596_000480_1059_2396 | 435 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6uwl-assembly1.cif.gz_A | gltph in complex with l-aspartate and sodium ions in intermediate outward-facing state | 0.8594 | 22 | 406 |
| 7ngh-assembly1.cif.gz_C | structure of glutamate transporter homologue in complex with sybody | 0.8458 | 22 | 414 |
| 3v8g-assembly2.cif.gz_F | crystal structure of an asymmetric trimer of a glutamate transporter homologue (gltph) | 0.8397 | 22 | 406 |
| 3v8g-assembly1.cif.gz_C | crystal structure of an asymmetric trimer of a glutamate transporter homologue (gltph) | 0.8299 | 22 | 406 |
| 6uwf-assembly1.cif.gz_A | gltph in complex with l-aspartate and sodium ions in outward-facing state | 0.8291 | 22 | 406 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P21345_1_417_1.10.3860.10 | Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter | 0.9057 | 35 | 412 | 1.10.3860.10 |
| af_P71906_20_424_1.10.3860.10 | Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter | 0.8946 | 22 | 411 | 1.10.3860.10 |
| af_P0A830_1_408_1.10.3860.10 | Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter | 0.881 | 18 | 411 | 1.10.3860.10 |
| af_P71906_20_424_1.10.3860.10 | Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter | 0.8618 | 22 | 411 | 1.10.3860.10 |
| af_P0A830_1_408_1.10.3860.10 | Mainly Alpha;Orthogonal Bundle;Proton glutamate symport protein;Sodium:dicarboxylate symporter | 0.8506 | 18 | 411 | 1.10.3860.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7S2IYF1-F1-model_v4 | Amino acid transporter | 0.9686 | 277 | 419 |
GO:0005886
GO:0015138 GO:0015141 GO:0015366 GO:0070778 |
| AF-A0A358XU19-F1-model_v4 | C4-dicarboxylate transporter DctA | 0.9591 | 255 | 419 |
GO:0005886
GO:0015138 GO:0015141 GO:0015366 GO:0070778 |
| AF-A0A5E6W9B0-F1-model_v4 | C4-dicarboxylate transport protein 2 | 0.9523 | 282 | 419 |
GO:0005886
GO:0015138 GO:0015141 GO:0015366 GO:0070778 |
| AF-A0A4U3BL86-F1-model_v4 | deleted | 0.9505 | 231 | 419 |
|
| AF-A0A7Y8KL94-F1-model_v4 | Cation:dicarboxylase symporter family transporter | 0.9505 | 255 | 419 |
GO:0005886
GO:0015138 GO:0015141 GO:0015366 GO:0070778 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar