F408277

General Info

Members Datasets Scaffolds Average Seq Length
326 191 652 196

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10142366|Ga0114129_101423662
Length 209
Sequence MASCILNMMAGTDSALLIIDVQKDFCAGGALAVPNGDRVVPPLNRYITDAGKRGWPVYASRDWHPPVTKHFRQYGGLWPPHCVQGTEGATFHRDLQLPSSVIVVSAGDSPDSDGYSAFEGRLPDGTPLLDDLRKRGIRRLYVGGLATDYCVKHSVLDARRSGLEVTVLTDAVAGIDVEAGDSERALNEMRAAGAEIQVTGHKSEDPSHK

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
135 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
136 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
137 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
138 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
139 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
140 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
141 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
142 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
143 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
144 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
145 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
146 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
147 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
148 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
149 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
150 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
151 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
152 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
153 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
154 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
155 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
156 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
157 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
169 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
170 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
171 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
172 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
173 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
174 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
175 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
176 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
177 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
178 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
179 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
180 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
181 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
182 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
183 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
184 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
185 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
186 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
187 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
188 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
189 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
190 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
191 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.23
Rhizosphere 98.77
Stem 0
Stem Tuber 0
Unclassified 11.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10142366 3300009147 Bacteria 3286
2 JGI25405J52794_10002031 3300003911 Unclassified 3434
3 Ga0065704_10019368 3300005289 Bacteria 1596
4 Ga0065712_10001764 3300005290 Bacteria 12242
5 Ga0065712_10069530 3300005290 Bacteria 7108
6 Ga0065715_10003832 3300005293 Bacteria 4191
7 Ga0065715_10030341 3300005293 Bacteria 1863
8 Ga0065707_10005242 3300005295 Unclassified 4891
9 Ga0065707_10020423 3300005295 Bacteria 1458
10 Ga0065707_10056610 3300005295 Bacteria 634
11 Ga0065707_10109391 3300005295 Unclassified 2429
12 Ga0070676_10009068 3300005328 Bacteria 5382
13 Ga0070683_100275064 3300005329 Bacteria 1602
14 Ga0070690_100058870 3300005330 Bacteria 2468
15 Ga0070670_100007719 3300005331 Bacteria 9146
16 Ga0070670_100077667 3300005331 Bacteria 2852
17 Ga0070670_100115737 3300005331 Bacteria 2312
18 Ga0068869_100097462 3300005334 Bacteria 2220
19 Ga0070666_10122839 3300005335 Bacteria 1801
20 Ga0070680_100013209 3300005336 Bacteria 6428
21 Ga0068868_100036039 3300005338 Bacteria 3826
22 Ga0070691_10070195 3300005341 Bacteria 1699
23 Ga0070687_100313528 3300005343 Bacteria 1000
24 Ga0070661_100039475 3300005344 Bacteria 3439
25 Ga0070692_10053832 3300005345 Bacteria 2100
26 Ga0070668_100046953 3300005347 Bacteria 3319
27 Ga0070675_100563130 3300005354 Bacteria 1031
28 Ga0070671_100027934 3300005355 Bacteria 4645
29 Ga0070671_100514604 3300005355 Unclassified 1030
30 Ga0070674_100005438 3300005356 Bacteria 7356
31 Ga0070688_100269155 3300005365 Bacteria 1220
32 Ga0070688_100703226 3300005365 Unclassified 783
33 Ga0070659_100020894 3300005366 Bacteria 4979
34 Ga0070667_100014494 3300005367 Bacteria 6514
35 Ga0070703_10000007 3300005406 Bacteria 98798
36 Ga0070705_100028556 3300005440 Bacteria 3057
37 Ga0070700_100080934 3300005441 Unclassified 2097
38 Ga0070700_100382581 3300005441 Bacteria 1053
39 Ga0070694_100005767 3300005444 Bacteria 7510
40 Ga0070694_100034348 3300005444 Bacteria 3344
41 Ga0070708_100088605 3300005445 Unclassified 2814
42 Ga0070708_100098433 3300005445 Unclassified 2675
43 Ga0070708_100327078 3300005445 Unclassified 1444
44 Ga0070708_101041967 3300005445 Bacteria 767
45 Ga0070663_100098957 3300005455 Bacteria 2173
46 Ga0070678_100046496 3300005456 Bacteria 3112
47 Ga0070662_100029913 3300005457 Bacteria 3806
48 Ga0070681_10001378 3300005458 Bacteria 21303
49 Ga0070706_100042207 3300005467 Unclassified 4213
50 Ga0070706_100581711 3300005467 Unclassified 1041
51 Ga0070707_100120987 3300005468 Bacteria 2542
52 Ga0070707_100131888 3300005468 Bacteria 2430
53 Ga0070707_100287390 3300005468 Bacteria 1598
54 Ga0070698_100002488 3300005471 Bacteria 20301
55 Ga0070699_100321787 3300005518 Unclassified 1390
56 Ga0070679_100044436 3300005530 Bacteria 4426
57 Ga0070697_100047119 3300005536 Unclassified 3496
58 Ga0070697_100137966 3300005536 Bacteria 2049
59 Ga0070686_100006604 3300005544 Bacteria 6456
60 Ga0070686_100232583 3300005544 Unclassified 1338
61 Ga0070695_100078926 3300005545 Bacteria 2171
62 Ga0070695_100922143 3300005545 Unclassified 706
63 Ga0070696_100014605 3300005546 Bacteria 5271
64 Ga0070665_100196984 3300005548 Bacteria 2015
65 Ga0070704_100035202 3300005549 Unclassified 3402
66 Ga0070704_100155778 3300005549 Bacteria 1801
67 Ga0070704_100285922 3300005549 Bacteria 1368
68 Ga0068855_100361186 3300005563 Bacteria 1598
69 Ga0068855_100362149 3300005563 Bacteria 1595
70 Ga0070664_100001735 3300005564 Bacteria 17446
71 Ga0070664_100042792 3300005564 Bacteria 3822
72 Ga0068857_100450085 3300005577 Bacteria 1204
73 Ga0068856_100021581 3300005614 Bacteria 6258
74 Ga0068859_100077837 3300005617 Bacteria 3357
75 Ga0068866_10562485 3300005718 Unclassified 764
76 Ga0068870_10098531 3300005840 Bacteria 1647
77 Ga0068860_100384692 3300005843 Bacteria 1385
78 Ga0068860_100623306 3300005843 Bacteria 1085
79 Ga0068862_100010566 3300005844 Bacteria 7630
80 Ga0068862_100275356 3300005844 Bacteria 1540
81 Ga0081455_10000905 3300005937 Bacteria 38177
82 Ga0075432_10021942 3300006058 Bacteria 2183
83 Ga0070716_100511338 3300006173 Bacteria 888
84 Ga0075428_100016110 3300006844 Bacteria 8264
85 Ga0075428_100074601 3300006844 Bacteria 3705
86 Ga0075428_100266668 3300006844 Bacteria 1843
87 Ga0075430_100003958 3300006846 Bacteria 12493
88 Ga0075430_100090056 3300006846 Bacteria 2567
89 Ga0075430_100338578 3300006846 Unclassified 1243
90 Ga0075431_100044723 3300006847 Bacteria 4565
91 Ga0075433_10001693 3300006852 Bacteria 16434
92 Ga0075433_10015398 3300006852 Bacteria 6271
93 Ga0075433_10049654 3300006852 Bacteria 3650
94 Ga0075433_10051940 3300006852 Bacteria 3571
95 Ga0075433_10089433 3300006852 Unclassified 2722
96 Ga0075433_10271903 3300006852 Bacteria 1502
97 Ga0075434_100005143 3300006871 Bacteria 11877
98 Ga0075434_100012010 3300006871 Bacteria 8194
99 Ga0075434_100022087 3300006871 Bacteria 6196
100 Ga0075434_100064276 3300006871 Bacteria 3653
101 Ga0075434_100296409 3300006871 Bacteria 1637
102 Ga0075434_100303746 3300006871 Bacteria 1616
103 Ga0075429_100075996 3300006880 Bacteria 2925
104 Ga0075436_100002242 3300006914 Bacteria 13346
105 Ga0075436_100026064 3300006914 Bacteria 4025
106 Ga0075436_100188465 3300006914 Bacteria 1459
107 Ga0075436_100192586 3300006914 Bacteria 1443
108 Ga0097620_100077836 3300006931 Bacteria 3357
109 Ga0075435_100013398 3300007076 Bacteria 6098
110 Ga0075435_100013912 3300007076 Bacteria 6002
111 Ga0075435_100035511 3300007076 Bacteria 3956
112 Ga0099795_10252417 3300007788 Unclassified 761
113 Ga0111539_10006597 3300009094 Bacteria 14954
114 Ga0111539_10072028 3300009094 Bacteria 4076
115 Ga0111539_10653264 3300009094 Unclassified 1225
116 Ga0111539_11646901 3300009094 Bacteria 744
117 Ga0105247_10199032 3300009101 Bacteria 1345
118 Ga0114129_10003133 3300009147 Bacteria 23203
119 Ga0114129_10045551 3300009147 Bacteria 6166
120 Ga0114129_10110755 3300009147 Bacteria 3789
121 Ga0114129_10123768 3300009147 Bacteria 3557
122 Ga0114129_10485012 3300009147 Bacteria 1617
123 Ga0105243_10000541 3300009148 Bacteria 38358
124 Ga0105243_10181294 3300009148 Bacteria 1832
125 Ga0105241_10048306 3300009174 Bacteria 3238
126 Ga0105242_10000181 3300009176 Bacteria 48007
127 Ga0105242_10153740 3300009176 Bacteria 2008
128 Ga0105237_10178321 3300009545 Bacteria 2125
129 Ga0105249_10157234 3300009553 Bacteria 2193
130 Ga0105239_10963882 3300010375 Bacteria 980
131 Ga0105246_10121550 3300011119 Bacteria 1936
132 Ga0157373_10107205 3300013100 Bacteria 1964
133 Ga0157374_10029790 3300013296 Bacteria 4949
134 Ga0157378_10039043 3300013297 Bacteria 4210
135 Ga0157378_10228462 3300013297 Bacteria 1772
136 Ga0163162_10032149 3300013306 Bacteria 5210
137 Ga0157377_10075592 3300014745 Bacteria 1956
138 Ga0157377_10162591 3300014745 Bacteria 1390
139 Ga0157379_10134315 3300014968 Bacteria 2229
140 Ga0157376_10053634 3300014969 Bacteria 3358
141 Ga0163161_10074634 3300017792 Bacteria 2487
142 Ga0163161_10379799 3300017792 Unclassified 1129
143 Ga0207697_10024025 3300025315 Bacteria 2496
144 Ga0207653_10000050 3300025885 Bacteria 90383
145 Ga0207682_10178548 3300025893 Bacteria 969
146 Ga0207688_10016314 3300025901 Bacteria 4028
147 Ga0207680_10420716 3300025903 Bacteria 946
148 Ga0207647_10122633 3300025904 Bacteria 1532
149 Ga0207645_10001811 3300025907 Bacteria 17246
150 Ga0207684_10018300 3300025910 Bacteria 5996
151 Ga0207707_10039072 3300025912 Bacteria 4148
152 Ga0207663_10120789 3300025916 Bacteria 1794
153 Ga0207660_10221807 3300025917 Bacteria 1484
154 Ga0207657_10001886 3300025919 Bacteria 22653
155 Ga0207649_10036454 3300025920 Bacteria 2962
156 Ga0207652_10323988 3300025921 Bacteria 1391
157 Ga0207646_10004804 3300025922 Bacteria 14503
158 Ga0207646_10010377 3300025922 Bacteria 9108
159 Ga0207646_10021467 3300025922 Bacteria 5965
160 Ga0207681_10901337 3300025923 Bacteria 740
161 Ga0207650_10001846 3300025925 Bacteria 14929
162 Ga0207659_10338653 3300025926 Bacteria 1245
163 Ga0207690_10669775 3300025932 Bacteria 851
164 Ga0207706_10004222 3300025933 Bacteria 13532
165 Ga0207706_10051213 3300025933 Bacteria 3647
166 Ga0207686_10000078 3300025934 Bacteria 86179
167 Ga0207709_10000175 3300025935 Bacteria 86180
168 Ga0207709_10571784 3300025935 Bacteria 891
169 Ga0207669_10051763 3300025937 Bacteria 2462
170 Ga0207704_10408929 3300025938 Bacteria 1073
171 Ga0207711_10909326 3300025941 Unclassified 818
172 Ga0207689_10073124 3300025942 Bacteria 2816
173 Ga0207679_10378373 3300025945 Bacteria 1241
174 Ga0207679_10523186 3300025945 Bacteria 1061
175 Ga0207667_10113211 3300025949 Bacteria 2798
176 Ga0207712_10056456 3300025961 Bacteria 2766
177 Ga0207712_10101981 3300025961 Bacteria 2135
178 Ga0207668_10784589 3300025972 Bacteria 842
179 Ga0207677_10086117 3300026023 Bacteria 2270
180 Ga0207678_10039006 3300026067 Bacteria 4124
181 Ga0207708_10033177 3300026075 Unclassified 3921
182 Ga0207708_10087433 3300026075 Bacteria 2400
183 Ga0207708_10668041 3300026075 Unclassified 886
184 Ga0207702_10234541 3300026078 Bacteria 1716
185 Ga0207648_10168755 3300026089 Bacteria 1934
186 Ga0207648_11339366 3300026089 Unclassified 673
187 Ga0207676_10075943 3300026095 Bacteria 2713
188 Ga0207674_10400575 3300026116 Bacteria 1326
189 Ga0207683_10007279 3300026121 Bacteria 9484
190 Ga0207428_10004525 3300027907 Bacteria 13187
191 Ga0207428_10414662 3300027907 Bacteria 985
192 Ga0207428_10670235 3300027907 Unclassified 743
193 Ga0268266_10481333 3300028379 Bacteria 1183
194 Ga0268265_11192891 3300028380 Unclassified 758
195 Ga0268264_10085845 3300028381 Bacteria 2703
196 Ga0268264_10319819 3300028381 Bacteria 1467
197 Ga0268264_10784360 3300028381 Unclassified 951
198 Ga0265338_10108231 3300028800 Bacteria 2246
199 Ga0307410_10006477 3300031852 Bacteria 6322
200 Ga0307406_10692418 3300031901 Bacteria 850
201 Ga0307407_10002510 3300031903 Bacteria 7204
202 Ga0307412_10031956 3300031911 Bacteria 3329
203 Ga0307409_100345265 3300031995 Bacteria 1402
204 Ga0307414_10106139 3300032004 Bacteria 2125
205 Ga0307414_10363912 3300032004 Bacteria 1245
206 Ga0307411_10007357 3300032005 Bacteria 5600
207 Ga0307411_10026288 3300032005 Bacteria 3503
208 Ga0307415_100002137 3300032126 Bacteria 9783
209 Ga0373951_0019674 3300035091 Bacteria 1541
210 Ga0373932_0080430 3300035112 Bacteria 1028
211 Ga0373960_0037746 3300035121 Bacteria 1382
212 Ga0373962_0104807 3300035242 Bacteria 886
213 Ga0373931_0001765 3300035691 Bacteria 9393
214 Ga0373931_0018015 3300035691 Bacteria 3504
215 Ga0373937_0025054 3300036401 Bacteria 5386
216 Ga0395900_0082557 3300037418 Bacteria 3302
217 Ga0395901_0005205 3300038443 Bacteria 13128
218 Ga0395901_0345039 3300038443 Unclassified 1538
219 Ga0439455_0017885 3300042012 Bacteria 1657
220 Ga0451577_0004492 3300042876 Bacteria 14705
221 Ga0451577_0175965 3300042876 Bacteria 1929
222 Ga0453683_0000278 3300044673 Bacteria 67377
223 Ga0453684_0002338 3300044712 Bacteria 46372
224 Ga0453684_0047010 3300044712 Bacteria 5730
225 Ga0453684_0193004 3300044712 Bacteria 2381
226 Ga0451576_0017062 3300045051 Bacteria 7990
227 Ga0451576_0428286 3300045051 Bacteria 1388
228 Ga0451576_1326973 3300045051 Bacteria 750
229 Ga0495580_0032211 3300046472 Bacteria 3784
230 Ga0495580_0088900 3300046472 Bacteria 2151
231 Ga0495585_0239062 3300046492 Unclassified 910
232 Ga0495621_0145756 3300046539 Bacteria 929
233 Ga0495659_0143165 3300046664 Bacteria 955
234 Ga0496102_1153020 3300048905 Bacteria 695
235 Ga0496104_0404814 3300048907 Bacteria 1277
236 Ga0496107_0212159 3300048910 Bacteria 1440
237 Ga0496112_0003213 3300048915 Bacteria 13456
238 Ga0501031_0224398 3300049568 Bacteria 1223
239 Ga0501036_0215702 3300049572 Bacteria 1612
240 Ga0501037_0416327 3300049573 Bacteria 920
241 Ga0501038_0073516 3300049574 Bacteria 2895
242 Ga0501039_0093400 3300049575 Bacteria 2345
243 Ga0501039_0290544 3300049575 Bacteria 1285
244 Ga0501040_0009868 3300049576 Bacteria 6235
245 Ga0501040_0030938 3300049576 Bacteria 3617
246 Ga0501041_0034150 3300049577 Bacteria 3079
247 Ga0501043_0172571 3300049579 Bacteria 1687
248 Ga0501043_0384406 3300049579 Bacteria 1062
249 Ga0501043_0495552 3300049579 Bacteria 913
250 Ga0501046_0000013 3300049580 Bacteria 303594
251 Ga0501046_0146966 3300049580 Bacteria 1780
252 Ga0501047_0363387 3300049581 Bacteria 1283
253 Ga0501048_0207867 3300049582 Bacteria 1388
254 Ga0501048_0575657 3300049582 Bacteria 808
255 Ga0501068_0630214 3300049584 Bacteria 699
256 Ga0501070_0455354 3300049586 Bacteria 1031
257 Ga0501071_0039552 3300049587 Bacteria 3374
258 Ga0501071_0070105 3300049587 Bacteria 2553
259 Ga0501071_0079336 3300049587 Bacteria 2400
260 Ga0501072_0068581 3300049588 Bacteria 2799
261 Ga0501072_0094504 3300049588 Bacteria 2375
262 Ga0501072_0139683 3300049588 Bacteria 1931
263 Ga0501072_0858747 3300049588 Bacteria 709
264 Ga0501075_0075462 3300049591 Bacteria 2549
265 Ga0501075_0226764 3300049591 Bacteria 1425
266 Ga0501075_0932603 3300049591 Bacteria 660
267 Ga0501076_0003488 3300049592 Bacteria 11049
268 Ga0501076_0054828 3300049592 Bacteria 3160
269 Ga0501077_0061913 3300049593 Bacteria 2375
270 Ga0501077_0236143 3300049593 Bacteria 1162
271 Ga0501079_0295758 3300049741 Bacteria 1266
272 Ga0501079_0567854 3300049741 Bacteria 892
273 Ga0501080_0207398 3300049742 Bacteria 1797
274 Ga0501080_0350471 3300049742 Bacteria 1333
275 Ga0501081_0000203 3300049743 Bacteria 28999
276 Ga0501081_0160435 3300049743 Bacteria 1620
277 Ga0501083_0151536 3300049744 Bacteria 1518
278 Ga0501083_0327464 3300049744 Bacteria 996
279 Ga0501045_0020214 3300049824 Bacteria 4754
280 Ga0501045_0192473 3300049824 Unclassified 1520
281 Ga0501045_0477277 3300049824 Bacteria 927
282 nmdc:mga05p37_1557_c1 3300050507 Bacteria 26639
283 nmdc:mga05p37_231975_c1 3300050507 Bacteria 2223
284 nmdc:mga05p37_29897_c1 3300050507 Bacteria 6649
285 nmdc:mga05p37_30212_c1 3300050507 Bacteria 6611
286 nmdc:mga05p37_46394_c1 3300050507 Bacteria 5343
287 nmdc:mga09592_20734_c1 3300050508 Bacteria 5409
288 nmdc:mga09592_474093_c1 3300050508 Unclassified 1079
289 nmdc:mga0qj67_51073_c1 3300050509 Bacteria 3269
290 nmdc:mga0qj67_6629_c1 3300050509 Bacteria 8505
291 nmdc:mga06r32_905_c1 3300050510 Bacteria 26433
292 nmdc:mga06r32_93730_c1 3300050510 Bacteria 2938
293 nmdc:mga08y16_1115617_c1 3300050511 Bacteria 763
294 nmdc:mga08y16_435463_c1 3300050511 Unclassified 1339
295 nmdc:mga08y16_58884_c1 3300050511 Bacteria 4014
296 nmdc:mga08y16_83240_c1 3300050511 Bacteria 3334
297 nmdc:mga0n895_1120895_c1 3300050512 Bacteria 763
298 nmdc:mga0n895_11758_c1 3300050512 Bacteria 7824
299 nmdc:mga0n895_2136_c1 3300050512 Bacteria 15275
300 nmdc:mga0n895_282324_c1 3300050512 Bacteria 1684
301 nmdc:mga0n895_41840_c1 3300050512 Bacteria 4456
302 nmdc:mga0n895_539551_c1 3300050512 Bacteria 1173
303 nmdc:mga0n895_6875_c1 3300050512 Bacteria 9716
304 nmdc:mga0rr50_16963_c1 3300050513 Bacteria 4850
305 nmdc:mga0rr50_25829_c1 3300050513 Bacteria 4090
306 nmdc:mga0rr50_398232_c1 3300050513 Bacteria 1163
307 nmdc:mga0rr50_67358_c1 3300050513 Bacteria 2719
308 nmdc:mga08x19_166239_c1 3300050514 Bacteria 1500
309 nmdc:mga08x19_19694_c1 3300050514 Bacteria 4144
310 nmdc:mga08x19_3789_c1 3300050514 Bacteria 8995
311 nmdc:mga0a205_2812_c1 3300050515 Bacteria 15392
312 nmdc:mga0a205_292918_c1 3300050515 Bacteria 1502
313 nmdc:mga0a205_4948_c2 3300050515 Bacteria 6048
314 nmdc:mga0a205_525490_c1 3300050515 Bacteria 1040
315 nmdc:mga0a205_58573_c1 3300050515 Bacteria 3720
316 Ga0501084_0026936 3300054114 Bacteria 4802
317 Ga0501084_0212688 3300054114 Bacteria 1631
318 Ga0501084_0634771 3300054114 Unclassified 902
319 Ga0501082_0023509 3300060353 Bacteria 5317
320 Ga0501082_0037376 3300060353 Unclassified 4185
321 Ga0501082_0083501 3300060353 Bacteria 2756
322 Ga0501082_0094970 3300060353 Bacteria 2577
323 Ga0501082_0342764 3300060353 Bacteria 1302
324 Ga0530510_0307410 3300061734 Bacteria 1187
325 Ga0530510_0613103 3300061734 Bacteria 828
326 Ga0530510_0859930 3300061734 Bacteria 693
327 Ga0114129_10142366
328 JGI25405J52794_10002031
329 Ga0065704_10019368
330 Ga0065712_10001764
331 Ga0065712_10069530
332 Ga0065715_10003832
333 Ga0065715_10030341
334 Ga0065707_10005242
335 Ga0065707_10020423
336 Ga0065707_10056610
337 Ga0065707_10109391
338 Ga0070676_10009068
339 Ga0070683_100275064
340 Ga0070690_100058870
341 Ga0070670_100007719
342 Ga0070670_100077667
343 Ga0070670_100115737
344 Ga0068869_100097462
345 Ga0070666_10122839
346 Ga0070680_100013209
347 Ga0068868_100036039
348 Ga0070691_10070195
349 Ga0070687_100313528
350 Ga0070661_100039475
351 Ga0070692_10053832
352 Ga0070668_100046953
353 Ga0070675_100563130
354 Ga0070671_100027934
355 Ga0070671_100514604
356 Ga0070674_100005438
357 Ga0070688_100269155
358 Ga0070688_100703226
359 Ga0070659_100020894
360 Ga0070667_100014494
361 Ga0070703_10000007
362 Ga0070705_100028556
363 Ga0070700_100080934
364 Ga0070700_100382581
365 Ga0070694_100005767
366 Ga0070694_100034348
367 Ga0070708_100088605
368 Ga0070708_100098433
369 Ga0070708_100327078
370 Ga0070708_101041967
371 Ga0070663_100098957
372 Ga0070678_100046496
373 Ga0070662_100029913
374 Ga0070681_10001378
375 Ga0070706_100042207
376 Ga0070706_100581711
377 Ga0070707_100120987
378 Ga0070707_100131888
379 Ga0070707_100287390
380 Ga0070698_100002488
381 Ga0070699_100321787
382 Ga0070679_100044436
383 Ga0070697_100047119
384 Ga0070697_100137966
385 Ga0070686_100006604
386 Ga0070686_100232583
387 Ga0070695_100078926
388 Ga0070695_100922143
389 Ga0070696_100014605
390 Ga0070665_100196984
391 Ga0070704_100035202
392 Ga0070704_100155778
393 Ga0070704_100285922
394 Ga0068855_100361186
395 Ga0068855_100362149
396 Ga0070664_100001735
397 Ga0070664_100042792
398 Ga0068857_100450085
399 Ga0068856_100021581
400 Ga0068859_100077837
401 Ga0068866_10562485
402 Ga0068870_10098531
403 Ga0068860_100384692
404 Ga0068860_100623306
405 Ga0068862_100010566
406 Ga0068862_100275356
407 Ga0081455_10000905
408 Ga0075432_10021942
409 Ga0070716_100511338
410 Ga0075428_100016110
411 Ga0075428_100074601
412 Ga0075428_100266668
413 Ga0075430_100003958
414 Ga0075430_100090056
415 Ga0075430_100338578
416 Ga0075431_100044723
417 Ga0075433_10001693
418 Ga0075433_10015398
419 Ga0075433_10049654
420 Ga0075433_10051940
421 Ga0075433_10089433
422 Ga0075433_10271903
423 Ga0075434_100005143
424 Ga0075434_100012010
425 Ga0075434_100022087
426 Ga0075434_100064276
427 Ga0075434_100296409
428 Ga0075434_100303746
429 Ga0075429_100075996
430 Ga0075436_100002242
431 Ga0075436_100026064
432 Ga0075436_100188465
433 Ga0075436_100192586
434 Ga0097620_100077836
435 Ga0075435_100013398
436 Ga0075435_100013912
437 Ga0075435_100035511
438 Ga0099795_10252417
439 Ga0111539_10006597
440 Ga0111539_10072028
441 Ga0111539_10653264
442 Ga0111539_11646901
443 Ga0105247_10199032
444 Ga0114129_10003133
445 Ga0114129_10045551
446 Ga0114129_10110755
447 Ga0114129_10123768
448 Ga0114129_10485012
449 Ga0105243_10000541
450 Ga0105243_10181294
451 Ga0105241_10048306
452 Ga0105242_10000181
453 Ga0105242_10153740
454 Ga0105237_10178321
455 Ga0105249_10157234
456 Ga0105239_10963882
457 Ga0105246_10121550
458 Ga0157373_10107205
459 Ga0157374_10029790
460 Ga0157378_10039043
461 Ga0157378_10228462
462 Ga0163162_10032149
463 Ga0157377_10075592
464 Ga0157377_10162591
465 Ga0157379_10134315
466 Ga0157376_10053634
467 Ga0163161_10074634
468 Ga0163161_10379799
469 Ga0207697_10024025
470 Ga0207653_10000050
471 Ga0207682_10178548
472 Ga0207688_10016314
473 Ga0207680_10420716
474 Ga0207647_10122633
475 Ga0207645_10001811
476 Ga0207684_10018300
477 Ga0207707_10039072
478 Ga0207663_10120789
479 Ga0207660_10221807
480 Ga0207657_10001886
481 Ga0207649_10036454
482 Ga0207652_10323988
483 Ga0207646_10004804
484 Ga0207646_10010377
485 Ga0207646_10021467
486 Ga0207681_10901337
487 Ga0207650_10001846
488 Ga0207659_10338653
489 Ga0207690_10669775
490 Ga0207706_10004222
491 Ga0207706_10051213
492 Ga0207686_10000078
493 Ga0207709_10000175
494 Ga0207709_10571784
495 Ga0207669_10051763
496 Ga0207704_10408929
497 Ga0207711_10909326
498 Ga0207689_10073124
499 Ga0207679_10378373
500 Ga0207679_10523186
501 Ga0207667_10113211
502 Ga0207712_10056456
503 Ga0207712_10101981
504 Ga0207668_10784589
505 Ga0207677_10086117
506 Ga0207678_10039006
507 Ga0207708_10033177
508 Ga0207708_10087433
509 Ga0207708_10668041
510 Ga0207702_10234541
511 Ga0207648_10168755
512 Ga0207648_11339366
513 Ga0207676_10075943
514 Ga0207674_10400575
515 Ga0207683_10007279
516 Ga0207428_10004525
517 Ga0207428_10414662
518 Ga0207428_10670235
519 Ga0268266_10481333
520 Ga0268265_11192891
521 Ga0268264_10085845
522 Ga0268264_10319819
523 Ga0268264_10784360
524 Ga0265338_10108231
525 Ga0307410_10006477
526 Ga0307406_10692418
527 Ga0307407_10002510
528 Ga0307412_10031956
529 Ga0307409_100345265
530 Ga0307414_10106139
531 Ga0307414_10363912
532 Ga0307411_10007357
533 Ga0307411_10026288
534 Ga0307415_100002137
535 Ga0373951_0019674
536 Ga0373932_0080430
537 Ga0373960_0037746
538 Ga0373962_0104807
539 Ga0373931_0001765
540 Ga0373931_0018015
541 Ga0373937_0025054
542 Ga0395900_0082557
543 Ga0395901_0005205
544 Ga0395901_0345039
545 Ga0439455_0017885
546 Ga0451577_0004492
547 Ga0451577_0175965
548 Ga0453683_0000278
549 Ga0453684_0002338
550 Ga0453684_0047010
551 Ga0453684_0193004
552 Ga0451576_0017062
553 Ga0451576_0428286
554 Ga0451576_1326973
555 Ga0495580_0032211
556 Ga0495580_0088900
557 Ga0495585_0239062
558 Ga0495621_0145756
559 Ga0495659_0143165
560 Ga0496102_1153020
561 Ga0496104_0404814
562 Ga0496107_0212159
563 Ga0496112_0003213
564 Ga0501031_0224398
565 Ga0501036_0215702
566 Ga0501037_0416327
567 Ga0501038_0073516
568 Ga0501039_0093400
569 Ga0501039_0290544
570 Ga0501040_0009868
571 Ga0501040_0030938
572 Ga0501041_0034150
573 Ga0501043_0172571
574 Ga0501043_0384406
575 Ga0501043_0495552
576 Ga0501046_0000013
577 Ga0501046_0146966
578 Ga0501047_0363387
579 Ga0501048_0207867
580 Ga0501048_0575657
581 Ga0501068_0630214
582 Ga0501070_0455354
583 Ga0501071_0039552
584 Ga0501071_0070105
585 Ga0501071_0079336
586 Ga0501072_0068581
587 Ga0501072_0094504
588 Ga0501072_0139683
589 Ga0501072_0858747
590 Ga0501075_0075462
591 Ga0501075_0226764
592 Ga0501075_0932603
593 Ga0501076_0003488
594 Ga0501076_0054828
595 Ga0501077_0061913
596 Ga0501077_0236143
597 Ga0501079_0295758
598 Ga0501079_0567854
599 Ga0501080_0207398
600 Ga0501080_0350471
601 Ga0501081_0000203
602 Ga0501081_0160435
603 Ga0501083_0151536
604 Ga0501083_0327464
605 Ga0501045_0020214
606 Ga0501045_0192473
607 Ga0501045_0477277
608 nmdc:mga05p37_1557_c1
609 nmdc:mga05p37_231975_c1
610 nmdc:mga05p37_29897_c1
611 nmdc:mga05p37_30212_c1
612 nmdc:mga05p37_46394_c1
613 nmdc:mga09592_20734_c1
614 nmdc:mga09592_474093_c1
615 nmdc:mga0qj67_51073_c1
616 nmdc:mga0qj67_6629_c1
617 nmdc:mga06r32_905_c1
618 nmdc:mga06r32_93730_c1
619 nmdc:mga08y16_1115617_c1
620 nmdc:mga08y16_435463_c1
621 nmdc:mga08y16_58884_c1
622 nmdc:mga08y16_83240_c1
623 nmdc:mga0n895_1120895_c1
624 nmdc:mga0n895_11758_c1
625 nmdc:mga0n895_2136_c1
626 nmdc:mga0n895_282324_c1
627 nmdc:mga0n895_41840_c1
628 nmdc:mga0n895_539551_c1
629 nmdc:mga0n895_6875_c1
630 nmdc:mga0rr50_16963_c1
631 nmdc:mga0rr50_25829_c1
632 nmdc:mga0rr50_398232_c1
633 nmdc:mga0rr50_67358_c1
634 nmdc:mga08x19_166239_c1
635 nmdc:mga08x19_19694_c1
636 nmdc:mga08x19_3789_c1
637 nmdc:mga0a205_2812_c1
638 nmdc:mga0a205_292918_c1
639 nmdc:mga0a205_4948_c2
640 nmdc:mga0a205_525490_c1
641 nmdc:mga0a205_58573_c1
642 Ga0501084_0026936
643 Ga0501084_0212688
644 Ga0501084_0634771
645 Ga0501082_0023509
646 Ga0501082_0037376
647 Ga0501082_0083501
648 Ga0501082_0094970
649 Ga0501082_0342764
650 Ga0530510_0307410
651 Ga0530510_0613103
652 Ga0530510_0859930

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00857

Isochorismatase

Isochorismatase family

14

200

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
1im5-assembly1.cif.gz_A crystal structure of pyrazinamidase of pyrococcus horikoshii in complex with zinc 0.9724 4 188
1im5-assembly1.cif.gz_A crystal structure of pyrazinamidase of pyrococcus horikoshii in complex with zinc 0.9512 4 188
3oqp-assembly1.cif.gz_B crystal structure of a putative isochorismatase (bxe_a0706) from burkholderia xenovorans lb400 at 1.22 a resolution 0.8967 4 163
2wt9-assembly1.cif.gz_A acinetobacter baumanii nicotinamidase pyrazinamidease 0.8905 1 192
3eef-assembly1.cif.gz_A crystal structure of n-carbamoylsarcosine amidase from thermoplasma acidophilum 0.8889 4 187
ID Description Score Start End Superfamily
1im5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9725 4 188 3.40.50.850
1im5A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.9512 4 188 3.40.50.850
af_P21369_4_203_3.40.50.850 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.92 6 188 3.40.50.850
3r2jB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8937 3 188 3.40.50.850
2wt9A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Isochorismatase-like 0.8905 1 192 3.40.50.850
ID Description Score Start End GO Terms
AF-A0A705VVS1-F1-model_v4 nicotinamidase (EC 3.5.1.19) (Nicotinamide deamidase) 1.002 119 188 GO:0016811
GO:0019363
GO:0046872
AF-A0A7V2GFE3-F1-model_v4 nicotinamidase (EC 3.5.1.19) (Nicotinamide deamidase) 0.9979 1 188 GO:0016811
GO:0019363
GO:0046872
AF-A0A139DBE1-F1-model_v4 nicotinamidase (EC 3.5.1.19) (Nicotinamide deamidase) 0.9976 6 96 GO:0016787
GO:0019363
GO:0046872
AF-A0A7Y8M326-F1-model_v4 nicotinamidase (EC 3.5.1.19) (Nicotinamide deamidase) 0.9959 1 83 GO:0016811
GO:0019363
GO:0046872
AF-A0A554LAF7-F1-model_v4 nicotinamidase (EC 3.5.1.19) (Nicotinamide deamidase) 0.9948 9 188 GO:0016811
GO:0019363
GO:0046872

Map