F408247

General Info

Members Datasets Scaffolds Average Seq Length
326 167 326 201

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100292618|Ga0075428_1002926182
Length 231
Sequence MQAAEAICVFANLRDLWSGDLTSYGSGSKVISMEKNADSTKPDFWTIRYAAGRTPWDFGGVPAALKSFLARSSAPGRVLIPGCGSGYEVQAFHTAGYDVTAIDFSPAAVDQAKTVLGVLAERVIFGDFFTHDFGQRRFDLIYERTFLCSMPPSRWPDYANRMADLLSGGGRLIGVFLYAQQPASGPPYPLTDGQGEQLFEGRFQLVRSELVTDSLPLFRGMERWQEWLKTI

Samples

Sample ID Description Type Environment
1 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
8 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
9 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
10 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
11 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
12 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
13 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
14 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
15 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
16 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
17 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
18 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
19 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
20 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
21 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
22 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
23 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
24 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
25 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
26 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
27 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
28 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
29 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
30 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
31 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
33 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
34 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
35 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
36 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
37 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
45 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
46 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
47 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
48 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
49 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
50 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
51 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
52 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
53 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
54 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
55 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
56 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
57 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
58 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
59 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
60 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
61 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
62 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
63 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
64 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
65 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
66 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
67 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
68 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
69 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
70 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
71 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
72 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
73 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
74 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
75 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
76 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
77 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
78 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
79 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
80 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
81 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
82 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
83 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
84 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
85 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
86 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
87 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
88 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
89 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
90 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
91 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
92 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
93 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
94 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
95 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
96 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
97 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
98 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
99 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
100 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
101 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
102 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
103 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
104 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
105 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
106 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
107 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
108 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
109 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
110 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
111 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
112 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
113 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
114 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
115 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
116 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
117 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
118 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
119 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
120 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
121 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
122 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
123 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
124 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
125 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
126 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
127 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
137 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
138 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
139 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
140 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
141 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
142 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
143 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
144 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
145 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
146 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
147 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
148 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
149 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
150 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
151 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
152 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
153 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
154 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
155 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
156 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
157 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
158 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
159 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
160 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
161 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
162 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
163 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
164 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
165 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
166 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
167 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.31
Nodule 0
Rhizoplane 0.31
Rhizosphere 98.77
Stem 0
Stem Tuber 0
Unclassified 0.61

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10077125 3300003322 Bacteria 1175
2 JGI25405J52794_10033713 3300003911 Unclassified 1069
3 Ga0070670_100195272 3300005331 Unclassified 1758
4 Ga0070680_100928212 3300005336 Bacteria 751
5 Ga0070660_100180818 3300005339 Bacteria 1706
6 Ga0070689_100650492 3300005340 Bacteria 917
7 Ga0070673_100368367 3300005364 Bacteria 1279
8 Ga0070705_100752755 3300005440 Unclassified 770
9 Ga0070706_100270324 3300005467 Bacteria 1586
10 Ga0070706_100408185 3300005467 Bacteria 1265
11 Ga0070706_100450069 3300005467 Bacteria 1198
12 Ga0070707_100113363 3300005468 Bacteria 2631
13 Ga0070707_100330119 3300005468 Bacteria 1482
14 Ga0070698_100002612 3300005471 Bacteria 19852
15 Ga0070698_100056402 3300005471 Bacteria 3981
16 Ga0070699_100265445 3300005518 Bacteria 1536
17 Ga0070699_100573764 3300005518 Bacteria 1028
18 Ga0070697_100015742 3300005536 Bacteria 5938
19 Ga0070697_100045731 3300005536 Bacteria 3548
20 Ga0068853_100659356 3300005539 Unclassified 996
21 Ga0070695_100135802 3300005545 Bacteria 1700
22 Ga0070696_100118267 3300005546 Bacteria 1916
23 Ga0070696_100203165 3300005546 Bacteria 1480
24 Ga0070704_100192458 3300005549 Bacteria 1641
25 Ga0070704_100442159 3300005549 Bacteria 1118
26 Ga0081455_10020434 3300005937 Bacteria 6235
27 Ga0081539_10000686 3300005985 Bacteria 67858
28 Ga0070717_10028016 3300006028 Bacteria 4506
29 Ga0075428_100292618 3300006844 Bacteria 1751
30 Ga0075430_100105747 3300006846 Bacteria 2349
31 Ga0075431_100039441 3300006847 Unclassified 4865
32 Ga0075431_100659251 3300006847 Unclassified 1026
33 Ga0075433_10002950 3300006852 Bacteria 13059
34 Ga0075433_10076445 3300006852 Bacteria 2948
35 Ga0075433_10133486 3300006852 Bacteria 2206
36 Ga0075433_10199368 3300006852 Bacteria 1780
37 Ga0075433_10732351 3300006852 Unclassified 865
38 Ga0075434_100003795 3300006871 Bacteria 13509
39 Ga0075434_100031273 3300006871 Bacteria 5247
40 Ga0075434_100290681 3300006871 Bacteria 1654
41 Ga0075434_100509186 3300006871 Bacteria 1224
42 Ga0075429_100136999 3300006880 Bacteria 2143
43 Ga0075429_100143240 3300006880 Bacteria 2092
44 Ga0075429_100549426 3300006880 Bacteria 1012
45 Ga0075436_100017180 3300006914 Bacteria 4951
46 Ga0075436_100056179 3300006914 Bacteria 2719
47 Ga0075436_100176984 3300006914 Bacteria 1507
48 Ga0075436_100384582 3300006914 Unclassified 1015
49 Ga0075436_100451830 3300006914 Bacteria 936
50 Ga0075436_100579481 3300006914 Bacteria 825
51 Ga0075435_100058979 3300007076 Bacteria 3110
52 Ga0075435_100143351 3300007076 Bacteria 2005
53 Ga0075435_100226289 3300007076 Bacteria 1589
54 Ga0075435_100411927 3300007076 Bacteria 1163
55 Ga0099794_10025328 3300007265 Bacteria 2731
56 Ga0099794_10072635 3300007265 Bacteria 1687
57 Ga0111539_10045929 3300009094 Bacteria 5227
58 Ga0111539_10062807 3300009094 Bacteria 4396
59 Ga0114129_10120705 3300009147 Bacteria 3609
60 Ga0114129_10442176 3300009147 Bacteria 1707
61 Ga0114129_10695236 3300009147 Unclassified 1308
62 Ga0114129_11091843 3300009147 Bacteria 999
63 Ga0157374_10298740 3300013296 Bacteria 1593
64 Ga0157374_11342816 3300013296 Bacteria 737
65 Ga0157378_10658163 3300013297 Unclassified 1064
66 Ga0157378_11135142 3300013297 Unclassified 819
67 Ga0157378_11247357 3300013297 Bacteria 784
68 Ga0157372_10151705 3300013307 Bacteria 2675
69 Ga0213872_10062577 3300021361 Bacteria 1681
70 Ga0213872_10161372 3300021361 Unclassified 975
71 Ga0209672_105721 3300025228 Bacteria 2102
72 Ga0207684_10269658 3300025910 Bacteria 1468
73 Ga0207660_10687827 3300025917 Bacteria 834
74 Ga0207660_10946674 3300025917 Bacteria 703
75 Ga0207646_10148523 3300025922 Bacteria 2113
76 Ga0207646_10316980 3300025922 Bacteria 1409
77 Ga0207679_10120430 3300025945 Bacteria 2088
78 Ga0207651_10765016 3300025960 Bacteria 854
79 Ga0207639_10852841 3300026041 Unclassified 850
80 Ga0207708_10316868 3300026075 Bacteria 1272
81 Ga0207708_10667714 3300026075 Bacteria 886
82 Ga0209971_1015866 3300027682 Bacteria 1786
83 Ga0209974_10097859 3300027876 Bacteria 1023
84 Ga0209974_10135096 3300027876 Bacteria 881
85 Ga0265316_10020523 3300031344 Bacteria 5623
86 Ga0265316_10094401 3300031344 Bacteria 2279
87 Ga0307408_100223365 3300031548 Bacteria 1538
88 Ga0307408_100293233 3300031548 Bacteria 1359
89 Ga0265314_10273652 3300031711 Bacteria 958
90 Ga0307410_10270119 3300031852 Bacteria 1330
91 Ga0307406_10587922 3300031901 Bacteria 916
92 Ga0307412_10062494 3300031911 Bacteria 2508
93 Ga0307416_100020454 3300032002 Bacteria 4724
94 Ga0307416_100446050 3300032002 Bacteria 1345
95 Ga0307416_101173676 3300032002 Unclassified 873
96 Ga0307414_10039588 3300032004 Unclassified 3177
97 Ga0307411_10836440 3300032005 Bacteria 813
98 Ga0316583_10001078 3300032133 Bacteria 8862
99 Ga0373934_0005108 3300035086 Bacteria 4864
100 Ga0373940_0056315 3300035088 Bacteria 1115
101 Ga0373923_0101112 3300035111 Bacteria 1271
102 Ga0373923_0326446 3300035111 Bacteria 729
103 Ga0373936_0016250 3300035113 Bacteria 2862
104 Ga0373945_0041854 3300035116 Bacteria 1658
105 Ga0373953_0008373 3300035117 Bacteria 3510
106 Ga0373953_0155489 3300035117 Bacteria 981
107 Ga0373954_0009313 3300035118 Bacteria 4321
108 Ga0373954_0018812 3300035118 Bacteria 3112
109 Ga0373954_0021877 3300035118 Bacteria 2897
110 Ga0373954_0037799 3300035118 Bacteria 2243
111 Ga0373956_0001805 3300035119 Bacteria 8822
112 Ga0373956_0002923 3300035119 Bacteria 6914
113 Ga0373956_0021880 3300035119 Bacteria 2730
114 Ga0373956_0255276 3300035119 Bacteria 833
115 Ga0373957_0003195 3300035120 Bacteria 4805
116 Ga0373957_0006031 3300035120 Bacteria 3795
117 Ga0373957_0094443 3300035120 Bacteria 1191
118 Ga0373946_0246215 3300035171 Bacteria 871
119 Ga0373955_0023074 3300035172 Bacteria 3165
120 Ga0373955_0094755 3300035172 Bacteria 1706
121 Ga0373955_0157304 3300035172 Bacteria 1339
122 Ga0373955_0188187 3300035172 Bacteria 1226
123 Ga0373955_0453673 3300035172 Bacteria 781
124 Ga0316574_0122929 3300035398 Bacteria 1667
125 Ga0373924_0003676 3300035410 Bacteria 5290
126 Ga0373935_0131099 3300035692 Bacteria 1684
127 Ga0373933_0001693 3300035724 Bacteria 12822
128 Ga0373933_0006741 3300035724 Bacteria 6260
129 Ga0373933_0437735 3300035724 Bacteria 854
130 Ga0373937_0046273 3300036401 Bacteria 3978
131 Ga0373937_0158171 3300036401 Bacteria 2124
132 Ga0373937_0269070 3300036401 Bacteria 1608
133 Ga0373925_0290846 3300037068 Bacteria 1317
134 Ga0436365_1372500 3300039437 Bacteria 3307
135 Ga0436360_0841923 3300039438 Bacteria 1356
136 Ga0436361_0142669 3300039447 Bacteria 8117
137 Ga0436361_0283040 3300039447 Bacteria 6000
138 Ga0436361_0706926 3300039447 Bacteria 2722
139 Ga0436362_0268858 3300039453 Bacteria 1221
140 Ga0439439_0144246 3300041406 Unclassified 674
141 Ga0439444_0035911 3300042437 Unclassified 953
142 Ga0451577_0438827 3300042876 Unclassified 1185
143 Ga0466969_0002527 3300044656 Bacteria 9776
144 Ga0466965_0054394 3300044683 Bacteria 1990
145 Ga0466966_0041800 3300044684 Bacteria 2945
146 Ga0466961_0003391 3300044693 Bacteria 9947
147 Ga0466964_0194894 3300044706 Bacteria 969
148 Ga0453684_0015091 3300044712 Bacteria 12259
149 Ga0466959_0015170 3300045049 Bacteria 5612
150 Ga0451576_0059883 3300045051 Unclassified 3974
151 Ga0451576_0181823 3300045051 Bacteria 2195
152 Ga0451576_0238501 3300045051 Archaea 1899
153 Ga0451576_0275240 3300045051 Bacteria 1760
154 Ga0451576_0493715 3300045051 Bacteria 1286
155 Ga0451576_1255200 3300045051 Unclassified 773
156 Ga0466967_0001049 3300045976 Bacteria 15200
157 Ga0495592_0002820 3300046454 Bacteria 12321
158 Ga0495592_0038599 3300046454 Bacteria 3592
159 Ga0495592_0119509 3300046454 Bacteria 1855
160 Ga0495592_0220204 3300046454 Bacteria 1269
161 Ga0495641_0016637 3300046461 Bacteria 3865
162 Ga0495651_0003037 3300046462 Bacteria 12945
163 Ga0495651_0069173 3300046462 Bacteria 2689
164 Ga0495653_0192452 3300046463 Bacteria 1390
165 Ga0495653_0394784 3300046463 Bacteria 880
166 Ga0495580_0544232 3300046472 Bacteria 771
167 Ga0495664_0019501 3300046477 Bacteria 3900
168 Ga0495584_0002496 3300046491 Bacteria 10423
169 Ga0495585_0112109 3300046492 Bacteria 1449
170 Ga0495594_0434007 3300046499 Bacteria 747
171 Ga0495608_0033369 3300046511 Bacteria 3479
172 Ga0495608_0074147 3300046511 Bacteria 2218
173 Ga0495618_0078799 3300046514 Bacteria 2100
174 Ga0495628_0002746 3300046516 Bacteria 15750
175 Ga0495628_0003854 3300046516 Bacteria 13352
176 Ga0495630_0007297 3300046517 Bacteria 7889
177 Ga0495630_0063646 3300046517 Bacteria 2771
178 Ga0495630_0068140 3300046517 Bacteria 2675
179 Ga0495648_0026331 3300046524 Bacteria 3917
180 Ga0495666_0054263 3300046526 Bacteria 1922
181 Ga0495652_0053124 3300046529 Bacteria 3454
182 Ga0495652_0088353 3300046529 Bacteria 2540
183 Ga0495652_0290490 3300046529 Bacteria 1193
184 Ga0495640_0010841 3300046533 Bacteria 7031
185 Ga0495640_0469266 3300046533 Bacteria 767
186 Ga0495586_0225923 3300046535 Bacteria 1064
187 Ga0495586_0759362 3300046535 Bacteria 559
188 Ga0495587_0073276 3300046536 Bacteria 1989
189 Ga0495587_0165918 3300046536 Bacteria 1255
190 Ga0495597_0097139 3300046542 Bacteria 1245
191 Ga0495645_0018500 3300046543 Bacteria 5005
192 Ga0495645_0022685 3300046543 Bacteria 4542
193 Ga0495667_0015086 3300046559 Bacteria 5215
194 Ga0495667_0018499 3300046559 Bacteria 4707
195 Ga0495667_0020570 3300046559 Bacteria 4452
196 Ga0495667_0294588 3300046559 Bacteria 1028
197 Ga0495634_0038145 3300046642 Bacteria 3276
198 Ga0495635_0025862 3300046663 Bacteria 4088
199 Ga0495657_0027943 3300046675 Bacteria 3972
200 Ga0495657_0049068 3300046675 Bacteria 2845
201 Ga0495657_0256546 3300046675 Bacteria 1051
202 Ga0495599_0001821 3300046678 Bacteria 12361
203 Ga0495646_0007640 3300046680 Bacteria 6871
204 Ga0495647_0021718 3300046681 Bacteria 2313
205 Ga0495647_0026439 3300046681 Bacteria 2126
206 Ga0495658_0016702 3300046683 Bacteria 3779
207 Ga0495669_0000900 3300046684 Bacteria 12507
208 Ga0495624_0082750 3300046690 Bacteria 1986
209 Ga0495604_0063904 3300047317 Bacteria 2806
210 Ga0495604_0098654 3300047317 Bacteria 2151
211 Ga0495604_0122900 3300047317 Bacteria 1876
212 Ga0495604_0284703 3300047317 Bacteria 1115
213 Ga0495674_0013963 3300047319 Bacteria 7533
214 Ga0495674_0418718 3300047319 Bacteria 1079
215 Ga0495680_0176995 3300047322 Bacteria 1542
216 Ga0495680_0208811 3300047322 Bacteria 1398
217 Ga0495680_0258657 3300047322 Bacteria 1231
218 Ga0495680_0504691 3300047322 Bacteria 820
219 Ga0495675_0022656 3300047444 Bacteria 4005
220 Ga0495675_0223851 3300047444 Bacteria 1137
221 Ga0495677_0043361 3300047445 Bacteria 1649
222 Ga0495684_0063293 3300047471 Bacteria 2812
223 Ga0496102_0519257 3300048905 Bacteria 1113
224 Ga0501036_0016009 3300049572 Bacteria 6264
225 Ga0501038_0034614 3300049574 Bacteria 4440
226 Ga0501038_0114247 3300049574 Bacteria 2233
227 Ga0501038_0523443 3300049574 Bacteria 904
228 Ga0501039_0019390 3300049575 Bacteria 5213
229 Ga0501039_0095994 3300049575 Bacteria 2311
230 Ga0501039_0152230 3300049575 Bacteria 1817
231 Ga0501040_0000065 3300049576 Bacteria 50924
232 Ga0501040_0002570 3300049576 Bacteria 11708
233 Ga0501040_0030002 3300049576 Bacteria 3671
234 Ga0501041_0043618 3300049577 Bacteria 2726
235 Ga0501041_0050045 3300049577 Unclassified 2546
236 Ga0501041_0076961 3300049577 Bacteria 2052
237 Ga0501042_0036410 3300049578 Bacteria 3491
238 Ga0501042_0082993 3300049578 Bacteria 2297
239 Ga0501046_0044740 3300049580 Unclassified 3520
240 Ga0501046_0074950 3300049580 Bacteria 2624
241 Ga0501047_0001885 3300049581 Bacteria 20152
242 Ga0501048_0009387 3300049582 Bacteria 7345
243 Ga0501048_0082674 3300049582 Bacteria 2265
244 Ga0501068_0244234 3300049584 Bacteria 1143
245 Ga0501069_0520730 3300049585 Bacteria 710
246 Ga0501070_0379521 3300049586 Bacteria 1145
247 Ga0501071_0310475 3300049587 Bacteria 1196
248 Ga0501071_0373899 3300049587 Unclassified 1086
249 Ga0501072_0001305 3300049588 Bacteria 18671
250 Ga0501072_0025177 3300049588 Unclassified 4634
251 Ga0501072_0047292 3300049588 Bacteria 3388
252 Ga0501074_0142455 3300049590 Bacteria 1714
253 Ga0501075_0010927 3300049591 Bacteria 6402
254 Ga0501075_0025355 3300049591 Unclassified 4357
255 Ga0501075_0085529 3300049591 Unclassified 2389
256 Ga0501075_0097717 3300049591 Bacteria 2228
257 Ga0501076_0002338 3300049592 Bacteria 12975
258 Ga0501076_0016125 3300049592 Bacteria 5655
259 Ga0501076_0064320 3300049592 Bacteria 2923
260 Ga0501076_0314975 3300049592 Bacteria 1284
261 Ga0501077_0000695 3300049593 Bacteria 20355
262 Ga0501077_0039583 3300049593 Bacteria 3004
263 Ga0501077_0107089 3300049593 Bacteria 1771
264 Ga0501230_066502 3300049667 Unclassified 736
265 Ga0501079_0008736 3300049741 Bacteria 7678
266 Ga0501079_0036807 3300049741 Bacteria 3769
267 Ga0501079_0099718 3300049741 Bacteria 2251
268 Ga0501080_0040873 3300049742 Bacteria 4324
269 Ga0501081_0008854 3300049743 Bacteria 6542
270 Ga0501081_0010048 3300049743 Bacteria 6171
271 Ga0501081_0089063 3300049743 Bacteria 2168
272 Ga0501083_0036509 3300049744 Bacteria 3352
273 Ga0501083_0078364 3300049744 Bacteria 2192
274 Ga0501035_0045508 3300049822 Bacteria 3949
275 Ga0501035_0215510 3300049822 Unclassified 1641
276 Ga0501035_0255453 3300049822 Bacteria 1487
277 Ga0501035_0701490 3300049822 Unclassified 816
278 Ga0501045_0002383 3300049824 Bacteria 12761
279 Ga0501045_0007731 3300049824 Bacteria 7476
280 Ga0501045_0011662 3300049824 Bacteria 6172
281 nmdc:mga05p37_22671_c1 3300050507 Bacteria 7616
282 nmdc:mga05p37_317923_c1 3300050507 Bacteria 1844
283 nmdc:mga05p37_387281_c1 3300050507 Bacteria 976
284 nmdc:mga05p37_584770_c1 3300050507 Bacteria 1264
285 nmdc:mga05p37_67164_c1 3300050507 Unclassified 4411
286 nmdc:mga09592_147802_c1 3300050508 Bacteria 2027
287 nmdc:mga09592_797387_c1 3300050508 Unclassified 799
288 nmdc:mga0qj67_569228_c1 3300050509 Unclassified 908
289 nmdc:mga06r32_261156_c1 3300050510 Bacteria 1719
290 nmdc:mga06r32_610011_c1 3300050510 Unclassified 1061
291 nmdc:mga08y16_114473_c1 3300050511 Bacteria 2808
292 nmdc:mga08y16_402433_c1 3300050511 Bacteria 1401
293 nmdc:mga0n895_101030_c1 3300050512 Bacteria 2894
294 nmdc:mga0n895_174084_c1 3300050512 Bacteria 2184
295 nmdc:mga0n895_3780_c1 3300050512 Bacteria 12257
296 nmdc:mga0n895_484113_c1 3300050512 Unclassified 1248
297 nmdc:mga0rr50_158798_c1 3300050513 Bacteria 1833
298 nmdc:mga0rr50_238372_c1 3300050513 Bacteria 1507
299 nmdc:mga0rr50_366900_c1 3300050513 Bacteria 1213
300 nmdc:mga0rr50_522583_c1 3300050513 Bacteria 1010
301 nmdc:mga08x19_13941_c1 3300050514 Bacteria 4869
302 nmdc:mga08x19_185323_c1 3300050514 Bacteria 1422
303 nmdc:mga08x19_226774_c1 3300050514 Bacteria 1285
304 nmdc:mga08x19_311865_c1 3300050514 Bacteria 1094
305 nmdc:mga0a205_133094_c1 3300050515 Bacteria 2387
306 nmdc:mga0a205_21134_c1 3300050515 Bacteria 6155
307 nmdc:mga0a205_213501_c1 3300050515 Bacteria 1817
308 nmdc:mga0a205_80747_c1 3300050515 Bacteria 3142
309 Ga0495601_0007450 3300053077 Bacteria 6419
310 Ga0495601_0067665 3300053077 Bacteria 2276
311 Ga0495601_0079041 3300053077 Bacteria 2108
312 Ga0495612_0185830 3300053078 Bacteria 914
313 Ga0495595_0260286 3300053084 Bacteria 869
314 Ga0495619_0016794 3300053085 Bacteria 4634
315 Ga0495619_0260596 3300053085 Bacteria 1201
316 Ga0495619_0300662 3300053085 Bacteria 1111
317 Ga0501084_0019138 3300054114 Bacteria 5703
318 Ga0501084_0165493 3300054114 Bacteria 1866
319 Ga0501084_0244311 3300054114 Bacteria 1515
320 Ga0501084_1161518 3300054114 Unclassified 648
321 Ga0501082_0004701 3300060353 Bacteria 11907
322 Ga0501082_0006771 3300060353 Bacteria 9903
323 Ga0501082_0089148 3300060353 Bacteria 2663
324 Ga0501082_0122561 3300060353 Unclassified 2254
325 Ga0530510_0002418 3300061734 Bacteria 12862
326 Ga0530510_0088283 3300061734 Bacteria 2259

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005549 Ga0070704_100192458 Ga0070704_1001924582 153
2 3300005471 Ga0070698_100002612 Ga0070698_1000026127 160
3 3300046492 Ga0495585_0112109 Ga0495585_0112109_827_1333 167
4 3300046535 Ga0495586_0759362 Ga0495586_0759362_10_516 167
5 3300047445 Ga0495677_0043361 Ga0495677_0043361_15_521 167
6 3300049667 Ga0501230_066502 Ga0501230_066502_154_726 182
7 3300027876 Ga0209974_10135096 Ga0209974_101350962 184
8 3300035113 Ga0373936_0016250 Ga0373936_0016250_2234_2839 185
9 3300035117 Ga0373953_0155489 Ga0373953_0155489_190_795 185
10 3300035118 Ga0373954_0021877 Ga0373954_0021877_2219_2824 185
11 3300035119 Ga0373956_0255276 Ga0373956_0255276_155_760 185
12 3300035120 Ga0373957_0006031 Ga0373957_0006031_1778_2383 185
13 3300035172 Ga0373955_0188187 Ga0373955_0188187_548_1153 185
14 3300035724 Ga0373933_0437735 Ga0373933_0437735_74_679 185
15 3300037068 Ga0373925_0290846 Ga0373925_0290846_100_705 185
16 3300046454 Ga0495592_0220204 Ga0495592_0220204_181_786 185
17 3300046462 Ga0495651_0069173 Ga0495651_0069173_32_637 185
18 3300046463 Ga0495653_0394784 Ga0495653_0394784_43_648 185
19 3300046472 Ga0495580_0544232 Ga0495580_0544232_40_645 185
20 3300046477 Ga0495664_0019501 Ga0495664_0019501_2417_3022 185
21 3300046511 Ga0495608_0033369 Ga0495608_0033369_2465_3070 185
22 3300046517 Ga0495630_0007297 Ga0495630_0007297_276_881 185
23 3300046533 Ga0495640_0010841 Ga0495640_0010841_4510_5115 185
24 3300046535 Ga0495586_0225923 Ga0495586_0225923_273_878 185
25 3300046536 Ga0495587_0073276 Ga0495587_0073276_709_1314 185
26 3300046559 Ga0495667_0015086 Ga0495667_0015086_4435_5040 185
27 3300046675 Ga0495657_0049068 Ga0495657_0049068_52_657 185
28 3300046681 Ga0495647_0021718 Ga0495647_0021718_1688_2293 185
29 3300046683 Ga0495658_0016702 Ga0495658_0016702_74_679 185
30 3300047317 Ga0495604_0284703 Ga0495604_0284703_409_1014 185
31 3300047319 Ga0495674_0013963 Ga0495674_0013963_6703_7308 185
32 3300047322 Ga0495680_0258657 Ga0495680_0258657_148_753 185
33 3300047444 Ga0495675_0223851 Ga0495675_0223851_361_966 185
34 3300053085 Ga0495619_0016794 Ga0495619_0016794_46_651 185
35 3300005545 Ga0070695_100135802 Ga0070695_1001358022 186
36 3300005440 Ga0070705_100752755 Ga0070705_1007527552 187
37 3300005468 Ga0070707_100330119 Ga0070707_1003301192 187
38 3300006852 Ga0075433_10076445 Ga0075433_100764452 187
39 3300006914 Ga0075436_100056179 Ga0075436_1000561792 187
40 3300007076 Ga0075435_100058979 Ga0075435_1000589793 187
41 3300025922 Ga0207646_10316980 Ga0207646_103169802 187
42 3300035088 Ga0373940_0056315 Ga0373940_0056315_127_705 187
43 3300045051 Ga0451576_0181823 Ga0451576_0181823_140_718 187
44 3300050512 nmdc:mga0n895_174084_c1 nmdc:mga0n895_174084_c1_399_977 187
45 3300050515 nmdc:mga0a205_21134_c1 nmdc:mga0a205_21134_c1_2319_2897 187
46 3300031548 Ga0307408_100223365 Ga0307408_1002233652 190
47 3300032002 Ga0307416_100020454 Ga0307416_1000204546 190
48 3300005336 Ga0070680_100928212 Ga0070680_1009282121 191
49 3300005340 Ga0070689_100650492 Ga0070689_1006504922 191
50 3300006852 Ga0075433_10199368 Ga0075433_101993682 191
51 3300006880 Ga0075429_100136999 Ga0075429_1001369992 191
52 3300006914 Ga0075436_100176984 Ga0075436_1001769842 191
53 3300007076 Ga0075435_100226289 Ga0075435_1002262892 191
54 3300009094 Ga0111539_10062807 Ga0111539_100628072 191
55 3300025917 Ga0207660_10946674 Ga0207660_109466742 191
56 3300026075 Ga0207708_10316868 Ga0207708_103168682 191
57 3300050511 nmdc:mga08y16_114473_c1 nmdc:mga08y16_114473_c1_1432_2007 191
58 3300050513 nmdc:mga0rr50_158798_c1 nmdc:mga0rr50_158798_c1_479_1054 191
59 3300050514 nmdc:mga08x19_185323_c1 nmdc:mga08x19_185323_c1_791_1393 191
60 3300050515 nmdc:mga0a205_213501_c1 nmdc:mga0a205_213501_c1_874_1449 191
61 3300005364 Ga0070673_100368367 Ga0070673_1003683672 192
62 3300005467 Ga0070706_100270324 Ga0070706_1002703242 192
63 3300005467 Ga0070706_100450069 Ga0070706_1004500691 192
64 3300005471 Ga0070698_100056402 Ga0070698_1000564025 192
65 3300005518 Ga0070699_100265445 Ga0070699_1002654451 192
66 3300005518 Ga0070699_100573764 Ga0070699_1005737642 192
67 3300005536 Ga0070697_100045731 Ga0070697_1000457314 192
68 3300006028 Ga0070717_10028016 Ga0070717_100280165 192
69 3300006852 Ga0075433_10732351 Ga0075433_107323512 192
70 3300006914 Ga0075436_100384582 Ga0075436_1003845822 192
71 3300009147 Ga0114129_10120705 Ga0114129_101207052 192
72 3300025910 Ga0207684_10269658 Ga0207684_102696582 192
73 3300025917 Ga0207660_10687827 Ga0207660_106878271 192
74 3300025922 Ga0207646_10148523 Ga0207646_101485233 192
75 3300025960 Ga0207651_10765016 Ga0207651_107650162 192
76 3300026075 Ga0207708_10667714 Ga0207708_106677142 192
77 3300050507 nmdc:mga05p37_584770_c1 nmdc:mga05p37_584770_c1_215_811 192
78 3300003911 JGI25405J52794_10033713 JGI25405J52794_100337132 193
79 3300005331 Ga0070670_100195272 Ga0070670_1001952722 193
80 3300005339 Ga0070660_100180818 Ga0070660_1001808183 193
81 3300005467 Ga0070706_100408185 Ga0070706_1004081852 193
82 3300005539 Ga0068853_100659356 Ga0068853_1006593562 193
83 3300005546 Ga0070696_100118267 Ga0070696_1001182672 193
84 3300005546 Ga0070696_100203165 Ga0070696_1002031652 193
85 3300005549 Ga0070704_100442159 Ga0070704_1004421592 193
86 3300005937 Ga0081455_10020434 Ga0081455_100204347 193
87 3300006871 Ga0075434_100290681 Ga0075434_1002906811 193
88 3300006880 Ga0075429_100549426 Ga0075429_1005494262 193
89 3300006914 Ga0075436_100017180 Ga0075436_1000171803 193
90 3300006914 Ga0075436_100579481 Ga0075436_1005794812 193
91 3300007076 Ga0075435_100143351 Ga0075435_1001433512 193
92 3300009147 Ga0114129_11091843 Ga0114129_110918431 193
93 3300013296 Ga0157374_10298740 Ga0157374_102987403 193
94 3300013296 Ga0157374_11342816 Ga0157374_113428161 193
95 3300013307 Ga0157372_10151705 Ga0157372_101517054 193
96 3300021361 Ga0213872_10062577 Ga0213872_100625774 193
97 3300025228 Ga0209672_105721 Ga0209672_1057212 193
98 3300025945 Ga0207679_10120430 Ga0207679_101204303 193
99 3300026041 Ga0207639_10852841 Ga0207639_108528411 193
100 3300031344 Ga0265316_10020523 Ga0265316_100205236 193
101 3300031344 Ga0265316_10094401 Ga0265316_100944012 193
102 3300031711 Ga0265314_10273652 Ga0265314_102736522 193
103 3300035118 Ga0373954_0018812 Ga0373954_0018812_1771_2358 193
104 3300035171 Ga0373946_0246215 Ga0373946_0246215_179_787 193
105 3300035172 Ga0373955_0157304 Ga0373955_0157304_226_813 193
106 3300036401 Ga0373937_0158171 Ga0373937_0158171_461_1048 193
107 3300039447 Ga0436361_0142669 Ga0436361_0142669_4510_5094 193
108 3300041406 Ga0439439_0144246 Ga0439439_0144246_22_618 193
109 3300045051 Ga0451576_0059883 Ga0451576_0059883_3146_3736 193
110 3300045976 Ga0466967_0001049 Ga0466967_0001049_10709_11290 193
111 3300046491 Ga0495584_0002496 Ga0495584_0002496_6587_7204 193
112 3300046517 Ga0495630_0063646 Ga0495630_0063646_1511_2098 193
113 3300046529 Ga0495652_0088353 Ga0495652_0088353_1512_2150 193
114 3300046543 Ga0495645_0018500 Ga0495645_0018500_2815_3453 193
115 3300046559 Ga0495667_0018499 Ga0495667_0018499_1856_2443 193
116 3300046680 Ga0495646_0007640 Ga0495646_0007640_829_1467 193
117 3300046684 Ga0495669_0000900 Ga0495669_0000900_1836_2417 193
118 3300047317 Ga0495604_0122900 Ga0495604_0122900_862_1449 193
119 3300047322 Ga0495680_0176995 Ga0495680_0176995_143_730 193
120 3300049572 Ga0501036_0016009 Ga0501036_0016009_2767_3429 193
121 3300049574 Ga0501038_0034614 Ga0501038_0034614_1154_1816 193
122 3300049574 Ga0501038_0523443 Ga0501038_0523443_36_698 193
123 3300049575 Ga0501039_0019390 Ga0501039_0019390_2354_3016 193
124 3300049575 Ga0501039_0152230 Ga0501039_0152230_291_953 193
125 3300049576 Ga0501040_0002570 Ga0501040_0002570_4967_5629 193
126 3300049576 Ga0501040_0030002 Ga0501040_0030002_1241_1903 193
127 3300049577 Ga0501041_0043618 Ga0501041_0043618_1296_1958 193
128 3300049578 Ga0501042_0036410 Ga0501042_0036410_673_1335 193
129 3300049580 Ga0501046_0074950 Ga0501046_0074950_913_1575 193
130 3300049582 Ga0501048_0009387 Ga0501048_0009387_1284_1946 193
131 3300049584 Ga0501068_0244234 Ga0501068_0244234_512_1132 193
132 3300049585 Ga0501069_0520730 Ga0501069_0520730_21_641 193
133 3300049586 Ga0501070_0379521 Ga0501070_0379521_64_726 193
134 3300049587 Ga0501071_0373899 Ga0501071_0373899_143_736 193
135 3300049588 Ga0501072_0047292 Ga0501072_0047292_1885_2547 193
136 3300049591 Ga0501075_0010927 Ga0501075_0010927_4207_4869 193
137 3300049591 Ga0501075_0085529 Ga0501075_0085529_192_785 193
138 3300049592 Ga0501076_0002338 Ga0501076_0002338_6605_7267 193
139 3300049592 Ga0501076_0064320 Ga0501076_0064320_665_1327 193
140 3300049593 Ga0501077_0039583 Ga0501077_0039583_1027_1689 193
141 3300049593 Ga0501077_0107089 Ga0501077_0107089_257_919 193
142 3300049741 Ga0501079_0008736 Ga0501079_0008736_4576_5238 193
143 3300049742 Ga0501080_0040873 Ga0501080_0040873_2929_3591 193
144 3300049743 Ga0501081_0008854 Ga0501081_0008854_3182_3844 193
145 3300049744 Ga0501083_0036509 Ga0501083_0036509_34_696 193
146 3300049822 Ga0501035_0045508 Ga0501035_0045508_2306_2968 193
147 3300049822 Ga0501035_0255453 Ga0501035_0255453_694_1356 193
148 3300049824 Ga0501045_0007731 Ga0501045_0007731_1533_2195 193
149 3300049824 Ga0501045_0011662 Ga0501045_0011662_413_1075 193
150 3300050508 nmdc:mga09592_797387_c1 nmdc:mga09592_797387_c1_164_751 193
151 3300050510 nmdc:mga06r32_261156_c1 nmdc:mga06r32_261156_c1_384_971 193
152 3300050510 nmdc:mga06r32_610011_c1 nmdc:mga06r32_610011_c1_43_639 193
153 3300050514 nmdc:mga08x19_226774_c1 nmdc:mga08x19_226774_c1_604_1209 193
154 3300054114 Ga0501084_0019138 Ga0501084_0019138_2371_3033 193
155 3300060353 Ga0501082_0004701 Ga0501082_0004701_5562_6224 193
156 3300060353 Ga0501082_0089148 Ga0501082_0089148_535_1197 193
157 3300061734 Ga0530510_0002418 Ga0530510_0002418_10299_10961 193
158 3300005468 Ga0070707_100113363 Ga0070707_1001133634 194
159 3300005536 Ga0070697_100015742 Ga0070697_1000157424 194
160 3300006844 Ga0075428_100292618 Ga0075428_1002926182 194
161 3300006847 Ga0075431_100039441 Ga0075431_1000394413 194
162 3300006847 Ga0075431_100659251 Ga0075431_1006592512 194
163 3300006852 Ga0075433_10002950 Ga0075433_100029509 194
164 3300006852 Ga0075433_10133486 Ga0075433_101334862 194
165 3300006871 Ga0075434_100003795 Ga0075434_1000037951 194
166 3300006871 Ga0075434_100031273 Ga0075434_1000312739 194
167 3300006871 Ga0075434_100509186 Ga0075434_1005091862 194
168 3300006880 Ga0075429_100143240 Ga0075429_1001432402 194
169 3300006914 Ga0075436_100451830 Ga0075436_1004518301 194
170 3300007076 Ga0075435_100411927 Ga0075435_1004119271 194
171 3300009094 Ga0111539_10045929 Ga0111539_100459292 194
172 3300009147 Ga0114129_10442176 Ga0114129_104421762 194
173 3300009147 Ga0114129_10695236 Ga0114129_106952361 194
174 3300013297 Ga0157378_11135142 Ga0157378_111351421 194
175 3300021361 Ga0213872_10161372 Ga0213872_101613721 194
176 3300027682 Ga0209971_1015866 Ga0209971_10158661 194
177 3300027876 Ga0209974_10097859 Ga0209974_100978591 194
178 3300031852 Ga0307410_10270119 Ga0307410_102701191 194
179 3300031901 Ga0307406_10587922 Ga0307406_105879221 194
180 3300031911 Ga0307412_10062494 Ga0307412_100624943 194
181 3300032002 Ga0307416_101173676 Ga0307416_1011736762 194
182 3300032004 Ga0307414_10039588 Ga0307414_100395881 194
183 3300032005 Ga0307411_10836440 Ga0307411_108364401 194
184 3300032133 Ga0316583_10001078 Ga0316583_100010786 194
185 3300035086 Ga0373934_0005108 Ga0373934_0005108_1167_1772 194
186 3300035111 Ga0373923_0101112 Ga0373923_0101112_494_1099 194
187 3300035111 Ga0373923_0326446 Ga0373923_0326446_22_627 194
188 3300035116 Ga0373945_0041854 Ga0373945_0041854_46_651 194
189 3300035117 Ga0373953_0008373 Ga0373953_0008373_2719_3324 194
190 3300035118 Ga0373954_0009313 Ga0373954_0009313_282_887 194
191 3300035118 Ga0373954_0037799 Ga0373954_0037799_152_757 194
192 3300035119 Ga0373956_0001805 Ga0373956_0001805_6664_7269 194
193 3300035119 Ga0373956_0002923 Ga0373956_0002923_3787_4392 194
194 3300035119 Ga0373956_0021880 Ga0373956_0021880_74_679 194
195 3300035120 Ga0373957_0003195 Ga0373957_0003195_3819_4424 194
196 3300035120 Ga0373957_0094443 Ga0373957_0094443_186_791 194
197 3300035172 Ga0373955_0023074 Ga0373955_0023074_1812_2417 194
198 3300035172 Ga0373955_0094755 Ga0373955_0094755_250_855 194
199 3300035172 Ga0373955_0453673 Ga0373955_0453673_74_679 194
200 3300035398 Ga0316574_0122929 Ga0316574_0122929_770_1357 194
201 3300035410 Ga0373924_0003676 Ga0373924_0003676_2093_2698 194
202 3300035692 Ga0373935_0131099 Ga0373935_0131099_698_1303 194
203 3300035724 Ga0373933_0001693 Ga0373933_0001693_1369_1974 194
204 3300035724 Ga0373933_0006741 Ga0373933_0006741_723_1328 194
205 3300036401 Ga0373937_0046273 Ga0373937_0046273_187_792 194
206 3300036401 Ga0373937_0269070 Ga0373937_0269070_882_1481 194
207 3300039437 Ga0436365_1372500 Ga0436365_1372500_1649_2272 194
208 3300039438 Ga0436360_0841923 Ga0436360_0841923_315_965 194
209 3300039447 Ga0436361_0283040 Ga0436361_0283040_2591_3181 194
210 3300039447 Ga0436361_0706926 Ga0436361_0706926_658_1308 194
211 3300039453 Ga0436362_0268858 Ga0436362_0268858_314_964 194
212 3300042437 Ga0439444_0035911 Ga0439444_0035911_183_788 194
213 3300042876 Ga0451577_0438827 Ga0451577_0438827_253_861 194
214 3300044656 Ga0466969_0002527 Ga0466969_0002527_4935_5555 194
215 3300044683 Ga0466965_0054394 Ga0466965_0054394_411_1037 194
216 3300044684 Ga0466966_0041800 Ga0466966_0041800_1720_2340 194
217 3300044693 Ga0466961_0003391 Ga0466961_0003391_4714_5334 194
218 3300044706 Ga0466964_0194894 Ga0466964_0194894_76_696 194
219 3300045049 Ga0466959_0015170 Ga0466959_0015170_4361_4987 194
220 3300045051 Ga0451576_0238501 Ga0451576_0238501_1285_1884 194
221 3300046454 Ga0495592_0002820 Ga0495592_0002820_3943_4548 194
222 3300046454 Ga0495592_0038599 Ga0495592_0038599_2709_3314 194
223 3300046454 Ga0495592_0119509 Ga0495592_0119509_909_1514 194
224 3300046461 Ga0495641_0016637 Ga0495641_0016637_2501_3106 194
225 3300046462 Ga0495651_0003037 Ga0495651_0003037_1271_1876 194
226 3300046463 Ga0495653_0192452 Ga0495653_0192452_167_772 194
227 3300046499 Ga0495594_0434007 Ga0495594_0434007_28_621 194
228 3300046511 Ga0495608_0074147 Ga0495608_0074147_66_671 194
229 3300046514 Ga0495618_0078799 Ga0495618_0078799_559_1164 194
230 3300046516 Ga0495628_0002746 Ga0495628_0002746_7097_7702 194
231 3300046516 Ga0495628_0003854 Ga0495628_0003854_2788_3393 194
232 3300046517 Ga0495630_0068140 Ga0495630_0068140_1661_2266 194
233 3300046524 Ga0495648_0026331 Ga0495648_0026331_2761_3375 194
234 3300046526 Ga0495666_0054263 Ga0495666_0054263_762_1367 194
235 3300046529 Ga0495652_0053124 Ga0495652_0053124_673_1278 194
236 3300046529 Ga0495652_0290490 Ga0495652_0290490_105_710 194
237 3300046533 Ga0495640_0469266 Ga0495640_0469266_46_651 194
238 3300046536 Ga0495587_0165918 Ga0495587_0165918_390_995 194
239 3300046542 Ga0495597_0097139 Ga0495597_0097139_566_1168 194
240 3300046543 Ga0495645_0022685 Ga0495645_0022685_2687_3292 194
241 3300046559 Ga0495667_0020570 Ga0495667_0020570_1226_1831 194
242 3300046559 Ga0495667_0294588 Ga0495667_0294588_361_966 194
243 3300046642 Ga0495634_0038145 Ga0495634_0038145_607_1212 194
244 3300046663 Ga0495635_0025862 Ga0495635_0025862_3348_3953 194
245 3300046675 Ga0495657_0027943 Ga0495657_0027943_184_789 194
246 3300046675 Ga0495657_0256546 Ga0495657_0256546_272_877 194
247 3300046678 Ga0495599_0001821 Ga0495599_0001821_630_1235 194
248 3300046681 Ga0495647_0026439 Ga0495647_0026439_1490_2095 194
249 3300046690 Ga0495624_0082750 Ga0495624_0082750_266_871 194
250 3300047317 Ga0495604_0063904 Ga0495604_0063904_559_1164 194
251 3300047317 Ga0495604_0098654 Ga0495604_0098654_1483_2088 194
252 3300047319 Ga0495674_0418718 Ga0495674_0418718_143_748 194
253 3300047322 Ga0495680_0208811 Ga0495680_0208811_364_969 194
254 3300047322 Ga0495680_0504691 Ga0495680_0504691_47_652 194
255 3300047444 Ga0495675_0022656 Ga0495675_0022656_3369_3974 194
256 3300047471 Ga0495684_0063293 Ga0495684_0063293_52_657 194
257 3300048905 Ga0496102_0519257 Ga0496102_0519257_323_943 194
258 3300049574 Ga0501038_0114247 Ga0501038_0114247_1471_2076 194
259 3300049575 Ga0501039_0095994 Ga0501039_0095994_1571_2176 194
260 3300049576 Ga0501040_0000065 Ga0501040_0000065_23949_24554 194
261 3300049577 Ga0501041_0050045 Ga0501041_0050045_893_1498 194
262 3300049577 Ga0501041_0076961 Ga0501041_0076961_157_762 194
263 3300049578 Ga0501042_0082993 Ga0501042_0082993_1513_2118 194
264 3300049582 Ga0501048_0082674 Ga0501048_0082674_180_785 194
265 3300049587 Ga0501071_0310475 Ga0501071_0310475_412_1017 194
266 3300049588 Ga0501072_0001305 Ga0501072_0001305_1488_2093 194
267 3300049588 Ga0501072_0025177 Ga0501072_0025177_2546_3151 194
268 3300049590 Ga0501074_0142455 Ga0501074_0142455_99_704 194
269 3300049591 Ga0501075_0025355 Ga0501075_0025355_1531_2136 194
270 3300049591 Ga0501075_0097717 Ga0501075_0097717_164_769 194
271 3300049592 Ga0501076_0016125 Ga0501076_0016125_180_785 194
272 3300049592 Ga0501076_0314975 Ga0501076_0314975_163_768 194
273 3300049593 Ga0501077_0000695 Ga0501077_0000695_19338_19943 194
274 3300049741 Ga0501079_0036807 Ga0501079_0036807_3031_3636 194
275 3300049741 Ga0501079_0099718 Ga0501079_0099718_1491_2096 194
276 3300049743 Ga0501081_0010048 Ga0501081_0010048_582_1187 194
277 3300049743 Ga0501081_0089063 Ga0501081_0089063_163_768 194
278 3300049744 Ga0501083_0078364 Ga0501083_0078364_1305_1910 194
279 3300049822 Ga0501035_0701490 Ga0501035_0701490_136_741 194
280 3300049824 Ga0501045_0002383 Ga0501045_0002383_1269_1874 194
281 3300050507 nmdc:mga05p37_22671_c1 nmdc:mga05p37_22671_c1_5951_6556 194
282 3300050507 nmdc:mga05p37_317923_c1 nmdc:mga05p37_317923_c1_30_725 194
283 3300050507 nmdc:mga05p37_387281_c1 nmdc:mga05p37_387281_c1_337_939 194
284 3300050507 nmdc:mga05p37_67164_c1 nmdc:mga05p37_67164_c1_3127_3732 194
285 3300050508 nmdc:mga09592_147802_c1 nmdc:mga09592_147802_c1_804_1499 194
286 3300050509 nmdc:mga0qj67_569228_c1 nmdc:mga0qj67_569228_c1_292_891 194
287 3300050511 nmdc:mga08y16_402433_c1 nmdc:mga08y16_402433_c1_195_809 194
288 3300050512 nmdc:mga0n895_101030_c1 nmdc:mga0n895_101030_c1_1657_2352 194
289 3300050512 nmdc:mga0n895_3780_c1 nmdc:mga0n895_3780_c1_10809_11423 194
290 3300050512 nmdc:mga0n895_484113_c1 nmdc:mga0n895_484113_c1_105_704 194
291 3300050513 nmdc:mga0rr50_366900_c1 nmdc:mga0rr50_366900_c1_305_1000 194
292 3300050513 nmdc:mga0rr50_522583_c1 nmdc:mga0rr50_522583_c1_119_733 194
293 3300050514 nmdc:mga08x19_311865_c1 nmdc:mga08x19_311865_c1_308_1003 194
294 3300050515 nmdc:mga0a205_133094_c1 nmdc:mga0a205_133094_c1_175_789 194
295 3300050515 nmdc:mga0a205_80747_c1 nmdc:mga0a205_80747_c1_1772_2371 194
296 3300053077 Ga0495601_0007450 Ga0495601_0007450_65_670 194
297 3300053077 Ga0495601_0067665 Ga0495601_0067665_1274_1879 194
298 3300053077 Ga0495601_0079041 Ga0495601_0079041_705_1310 194
299 3300053078 Ga0495612_0185830 Ga0495612_0185830_175_780 194
300 3300053084 Ga0495595_0260286 Ga0495595_0260286_177_782 194
301 3300053085 Ga0495619_0260596 Ga0495619_0260596_410_1015 194
302 3300053085 Ga0495619_0300662 Ga0495619_0300662_97_702 194
303 3300054114 Ga0501084_0165493 Ga0501084_0165493_1096_1701 194
304 3300054114 Ga0501084_0244311 Ga0501084_0244311_757_1362 194
305 3300054114 Ga0501084_1161518 Ga0501084_1161518_15_614 194
306 3300060353 Ga0501082_0006771 Ga0501082_0006771_7813_8418 194
307 3300060353 Ga0501082_0122561 Ga0501082_0122561_1312_1917 194
308 3300061734 Ga0530510_0088283 Ga0530510_0088283_180_785 194
309 3300013297 Ga0157378_10658163 Ga0157378_106581632 195
310 3300031548 Ga0307408_100293233 Ga0307408_1002932332 195
311 3300032002 Ga0307416_100446050 Ga0307416_1004460502 195
312 3300045051 Ga0451576_0493715 Ga0451576_0493715_273_878 195
313 3300045051 Ga0451576_1255200 Ga0451576_1255200_83_700 195
314 3300049580 Ga0501046_0044740 Ga0501046_0044740_554_1153 195
315 3300049581 Ga0501047_0001885 Ga0501047_0001885_4759_5358 195
316 3300049822 Ga0501035_0215510 Ga0501035_0215510_539_1138 195
317 3300003322 rootL2_10077125 rootL2_100771252 196
318 3300005985 Ga0081539_10000686 Ga0081539_1000068642 196
319 3300006846 Ga0075430_100105747 Ga0075430_1001057472 196
320 3300007265 Ga0099794_10025328 Ga0099794_100253283 196
321 3300007265 Ga0099794_10072635 Ga0099794_100726352 196
322 3300013297 Ga0157378_11247357 Ga0157378_112473571 196
323 3300044712 Ga0453684_0015091 Ga0453684_0015091_5665_6321 196
324 3300045051 Ga0451576_0275240 Ga0451576_0275240_352_942 196
325 3300050513 nmdc:mga0rr50_238372_c1 nmdc:mga0rr50_238372_c1_591_1193 196
326 3300050514 nmdc:mga08x19_13941_c1 nmdc:mga08x19_13941_c1_2498_3100 196

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

79

174

0.94

PF13649

Methyltransf_25

Methyltransferase domain

78

170

0.93

PF05724

TPMT

Thiopurine S-methyltransferase (TPMT)

40

229

0.89

PF08242

Methyltransf_12

Methyltransferase domain

79

172

0.89

PF13489

Methyltransf_23

Methyltransferase domain

56

212

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ajp-assembly1.cif.gz_A crystal structure of halogen methyl transferase from paraburkholderia xenovorans at 1.8 a in complex with sah 0.9593 2 196
8ajp-assembly1.cif.gz_A crystal structure of halogen methyl transferase from paraburkholderia xenovorans at 1.8 a in complex with sah 0.945 2 196
3lcc-assembly1.cif.gz_A structure of a sam-dependent halide methyltransferase from arabidopsis thaliana 0.8622 11 194
6mro-assembly1.cif.gz_A crystal structure of methyl transferase from methanosarcina acetivorans at 1.6 angstroms resolution, northeast structural genomics consortium (nesg) target mvr53. 0.8379 10 194
5dpl-assembly1.cif.gz_B the structure of pkmt2 from rickettsia typhi in complex with adohcy 0.8312 42 144
ID Description Score Start End Superfamily
af_B7E650_31_245_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8799 8 196 3.40.50.150
af_Q9VBJ3_147_316_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8625 27 134 3.40.50.150
af_F1R3E3_35_208_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8508 43 136 3.40.50.150
af_B7E650_31_245_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8466 8 196 3.40.50.150
af_Q2QUD2_542_827_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8459 30 172 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A521Z530-F1-model_v4 Methyltransferase domain-containing protein 0.9832 1 196 GO:0008757
GO:0032259
AF-A0A536WNL5-F1-model_v4 Methyltransferase domain-containing protein 0.9811 1 163 GO:0008757
GO:0032259
AF-A0A537C7B3-F1-model_v4 Methyltransferase domain-containing protein 0.9803 3 195 GO:0008757
GO:0032259
AF-A0A0K6GUF6-F1-model_v4 Thiopurine S-methyltransferase (TPMT) 0.9778 1 194 GO:0008757
GO:0032259
AF-A0A845H1D8-F1-model_v4 SAM-dependent methyltransferase 0.9762 64 196 GO:0008757
GO:0032259

Feature Viewer

pLDDT pTM Quality
94.32 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map