F408129

General Info

Members Datasets Scaffolds Average Seq Length
326 247 652 148

Family's Representative Sequence

Representative Sequence 3300003771|Ga0055526_1033086|Ga0055526_10330861
Length 176
Sequence MRSPSFHRAYGRLGRRRHHQGDDRTMTRSKLLRMDNVGVVVESLDDTVAFFTELGLTLEGRGMVEGEWAGRITGLGDQRVEIAMMVTPDGHGRLELSRFLAPSVVADHRNAPVNALGYLRAMFTVSDIDETLARLRQHGAQLVGQVVQYEDVYRLCYIRGPEGLLIGLAEPLGRNR

Samples

Sample ID Description Type Environment
1 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
6 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
7 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
54 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
55 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
56 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
68 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
71 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
72 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
74 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
110 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
111 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
112 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
113 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
114 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
115 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
116 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
117 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
118 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
119 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
120 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
121 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
122 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
123 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
126 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
127 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
128 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
129 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
130 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
131 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
132 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
133 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
134 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
135 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
136 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
137 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
138 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
139 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
140 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
141 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
142 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
143 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
144 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
145 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
146 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
147 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
148 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
149 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
150 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
151 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
152 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
153 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
154 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
155 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
156 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
157 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
158 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
159 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
160 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
161 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
162 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
163 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
164 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
165 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
166 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
167 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
168 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
169 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
170 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
182 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
183 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
184 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
185 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
186 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
187 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
188 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
189 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
190 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
191 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
192 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
195 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
196 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
197 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
198 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
199 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
200 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
201 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
202 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
203 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
204 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
205 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
206 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
207 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
208 2512564013 Brevibacillus sp. BC25 Isolate Rhizosphere
209 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
210 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
211 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
212 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
213 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
214 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
215 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
216 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
217 2643221584 Caulobacter sp. Root656 Isolate Unclassified
218 2643221640 Caulobacter sp. Root342 Isolate Unclassified
219 2643221642 Caulobacter sp. Root343 Isolate Unclassified
220 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
221 2703719227 Bacillus mycoides GOE6 Isolate Rhizosphere
222 2739367651 Pedobacter sp. OK291 Isolate Unclassified
223 2818991435 Caulobacter henricii 536 Isolate Unclassified
224 2818991442 Chitinophaga pinensis 1204 Isolate Unclassified
225 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
226 2833640130 Mariniflexile sp. TRM1-10 Isolate Rhizosphere
227 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
228 2857586860 Bacillus sp. R-71935 Isolate Unclassified
229 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
230 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
231 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
232 2915597211 Brevibacillus brevis Ag35 Isolate Nodule
233 2915606848 Brevibacillus sp. HD1.4A Isolate Rhizosphere
234 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
235 2929183550 Brevibacillus sp. R-71971 Hybrid assembly Isolate Unclassified
236 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
237 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
238 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
239 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
240 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
241 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
242 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
243 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
244 3001267043 Bacillus sp. FJAT-49870 Isolate Rhizosphere
245 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
246 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
247 8054795415 Paenibacillus periandrae PM10 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.42
Metatranscriptomes 0
Isolates 12.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.82
Nodule 1.23
Rhizoplane 3.68
Rhizosphere 76.07
Stem 0
Stem Tuber 0
Unclassified 2.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055526_1033086 3300003771 Bacteria 1443
2 JGI25151J46595_10045881 3300003187 Bacteria 1537
3 rootL2_10089548 3300003322 Bacteria 3400
4 rootH1_10375682 3300003323 Unclassified 1799
5 Ga0055538_1000683 3300003751 Bacteria 10484
6 Ga0055526_1034437 3300003771 Bacteria 1383
7 Ga0055536_1031222 3300003781 Bacteria 1398
8 Ga0055531_10001797 3300003794 Bacteria 15236
9 Ga0065165_1000030 3300005262 Bacteria 218104
10 Ga0065165_1000421 3300005262 Bacteria 66912
11 Ga0065714_10075984 3300005288 Bacteria 2841
12 Ga0065704_10304050 3300005289 Bacteria 880
13 Ga0065707_10685572 3300005295 Bacteria 592
14 Ga0070658_10147929 3300005327 Bacteria 1965
15 Ga0070683_100023510 3300005329 Bacteria 5513
16 Ga0070683_100106174 3300005329 Bacteria 2647
17 Ga0070683_100170025 3300005329 Bacteria 2069
18 Ga0068869_100069253 3300005334 Bacteria 2608
19 Ga0070666_10930980 3300005335 Bacteria 643
20 Ga0070680_100058027 3300005336 Bacteria 3165
21 Ga0070680_100649786 3300005336 Bacteria 906
22 Ga0070682_100148573 3300005337 Bacteria 1605
23 Ga0068868_100626301 3300005338 Bacteria 955
24 Ga0070691_10035270 3300005341 Bacteria 2355
25 Ga0070669_100015152 3300005353 Bacteria 5492
26 Ga0070671_100075539 3300005355 Bacteria 2815
27 Ga0070673_100398399 3300005364 Bacteria 1230
28 Ga0070688_100780098 3300005365 Bacteria 746
29 Ga0070667_100264783 3300005367 Bacteria 1540
30 Ga0070714_100345334 3300005435 Bacteria 1397
31 Ga0070713_100263477 3300005436 Bacteria 1576
32 Ga0070663_100457122 3300005455 Bacteria 1053
33 Ga0070681_10077572 3300005458 Bacteria 3280
34 Ga0070681_10330520 3300005458 Bacteria 1434
35 Ga0070681_10352674 3300005458 Bacteria 1381
36 Ga0070681_10666974 3300005458 Bacteria 955
37 Ga0070681_10688358 3300005458 Bacteria 938
38 Ga0070698_101716729 3300005471 Bacteria 580
39 Ga0070679_100024164 3300005530 Bacteria 5954
40 Ga0070679_100031909 3300005530 Bacteria 5208
41 Ga0070679_100084052 3300005530 Bacteria 3171
42 Ga0070679_100122667 3300005530 Bacteria 2582
43 Ga0070679_100429967 3300005530 Bacteria 1265
44 Ga0070684_100749922 3300005535 Unclassified 911
45 Ga0068853_100002552 3300005539 Bacteria 13678
46 Ga0068853_100835675 3300005539 Unclassified 883
47 Ga0070696_100350104 3300005546 Bacteria 1144
48 Ga0070693_100028296 3300005547 Bacteria 3046
49 Ga0070704_100822588 3300005549 Bacteria 831
50 Ga0068855_100030813 3300005563 Bacteria 6412
51 Ga0070664_101653757 3300005564 Bacteria 607
52 Ga0068857_101059287 3300005577 Bacteria 782
53 Ga0068854_100640365 3300005578 Bacteria 912
54 Ga0068856_100442307 3300005614 Bacteria 1321
55 Ga0068852_100814018 3300005616 Bacteria 949
56 Ga0068861_100045751 3300005719 Bacteria 3297
57 Ga0068861_100051801 3300005719 Bacteria 3118
58 Ga0068861_100943712 3300005719 Bacteria 820
59 Ga0068851_10106889 3300005834 Bacteria 1490
60 Ga0068860_100084901 3300005843 Bacteria 3011
61 Ga0075366_10012353 3300006195 Bacteria 4842
62 Ga0075366_10077427 3300006195 Bacteria 1985
63 Ga0075370_10070118 3300006353 Bacteria 2004
64 Ga0075430_100081190 3300006846 Bacteria 2716
65 Ga0105240_10099748 3300009093 Bacteria 3534
66 Ga0105245_10175111 3300009098 Bacteria 2046
67 Ga0105247_10001974 3300009101 Bacteria 14247
68 Ga0105241_11419863 3300009174 Bacteria 665
69 Ga0105248_10316348 3300009177 Bacteria 1758
70 Ga0105237_10068190 3300009545 Bacteria 3551
71 Ga0105237_10748217 3300009545 Bacteria 984
72 Ga0105238_10040234 3300009551 Bacteria 4737
73 Ga0105249_10001743 3300009553 Bacteria 18966
74 Ga0105249_10615427 3300009553 Unclassified 1142
75 Ga0157373_10021728 3300013100 Bacteria 4657
76 Ga0157371_10029729 3300013102 Unclassified 3947
77 Ga0157371_10516718 3300013102 Bacteria 883
78 Ga0157370_10212846 3300013104 Bacteria 1791
79 Ga0157370_10250948 3300013104 Bacteria 1637
80 Ga0157369_10168677 3300013105 Bacteria 2307
81 Ga0157369_10515601 3300013105 Bacteria 1237
82 Ga0157374_10126656 3300013296 Bacteria 2469
83 Ga0157372_11467020 3300013307 Bacteria 786
84 Ga0163163_10486609 3300014325 Bacteria 1295
85 Ga0157380_10011412 3300014326 Bacteria 6420
86 Ga0163161_10470595 3300017792 Bacteria 1019
87 Ga0209784_101308 3300025224 Bacteria 3568
88 Ga0209566_100103 3300025225 Bacteria 130803
89 Ga0209130_1000170 3300025284 Bacteria 94517
90 Ga0209675_1019456 3300025291 Bacteria 1868
91 Ga0209676_1000515 3300025292 Bacteria 60624
92 Ga0209025_1031314 3300025294 Bacteria 2519
93 Ga0209025_1033841 3300025294 Bacteria 2351
94 Ga0209564_1001313 3300025295 Bacteria 26657
95 Ga0209050_1051712 3300025298 Bacteria 1033
96 Ga0207426_1101979 3300025302 Bacteria 739
97 Ga0209257_1000200 3300025304 Bacteria 147538
98 Ga0207656_10070112 3300025321 Bacteria 1556
99 Ga0207642_10082334 3300025899 Bacteria 1567
100 Ga0207710_10002044 3300025900 Bacteria 9586
101 Ga0207710_10040532 3300025900 Bacteria 2064
102 Ga0207688_10156399 3300025901 Bacteria 1349
103 Ga0207645_10308198 3300025907 Bacteria 1055
104 Ga0207645_10815413 3300025907 Bacteria 634
105 Ga0207705_10619910 3300025909 Bacteria 841
106 Ga0207654_10132767 3300025911 Bacteria 1578
107 Ga0207707_10330022 3300025912 Bacteria 1316
108 Ga0207671_10302976 3300025914 Bacteria 1263
109 Ga0207671_10594269 3300025914 Bacteria 882
110 Ga0207660_10061307 3300025917 Bacteria 2707
111 Ga0207660_10116023 3300025917 Bacteria 2022
112 Ga0207660_10283584 3300025917 Bacteria 1315
113 Ga0207652_10001442 3300025921 Bacteria 21070
114 Ga0207652_10097469 3300025921 Bacteria 2592
115 Ga0207652_10212231 3300025921 Bacteria 1743
116 Ga0207681_10016208 3300025923 Bacteria 4657
117 Ga0207694_10272948 3300025924 Bacteria 1387
118 Ga0207650_10360488 3300025925 Bacteria 1198
119 Ga0207687_10199951 3300025927 Bacteria 1561
120 Ga0207664_10038397 3300025929 Bacteria 3713
121 Ga0207664_10368880 3300025929 Bacteria 1273
122 Ga0207644_10761295 3300025931 Bacteria 809
123 Ga0207711_10241010 3300025941 Bacteria 1658
124 Ga0207661_10104559 3300025944 Bacteria 2384
125 Ga0207661_10137097 3300025944 Bacteria 2103
126 Ga0207661_10265706 3300025944 Bacteria 1530
127 Ga0207661_10584585 3300025944 Bacteria 1024
128 Ga0207667_10073729 3300025949 Bacteria 3546
129 Ga0207667_10297370 3300025949 Bacteria 1649
130 Ga0207667_10350655 3300025949 Bacteria 1505
131 Ga0207651_10258682 3300025960 Bacteria 1428
132 Ga0207651_10469860 3300025960 Bacteria 1082
133 Ga0207712_10010062 3300025961 Bacteria 5996
134 Ga0207712_10072019 3300025961 Bacteria 2488
135 Ga0207712_10441307 3300025961 Bacteria 1102
136 Ga0207668_11227594 3300025972 Bacteria 674
137 Ga0207658_10258519 3300025986 Bacteria 1483
138 Ga0207677_10649378 3300026023 Bacteria 931
139 Ga0207639_10017147 3300026041 Bacteria 5132
140 Ga0207702_11133575 3300026078 Bacteria 776
141 Ga0207674_11035324 3300026116 Bacteria 790
142 Ga0207675_100051702 3300026118 Bacteria 3834
143 Ga0207683_11339192 3300026121 Bacteria 662
144 Ga0207698_10157701 3300026142 Bacteria 1980
145 Ga0207698_10258768 3300026142 Bacteria 1597
146 Ga0268266_11690797 3300028379 Unclassified 608
147 Ga0268265_10280142 3300028380 Bacteria 1491
148 Ga0268265_10283421 3300028380 Bacteria 1484
149 Ga0268264_10023936 3300028381 Bacteria 4982
150 Ga0307517_10019930 3300028786 Bacteria 8576
151 Ga0316177_1181300 3300030731 Bacteria 639
152 Ga0307509_10759413 3300031507 Bacteria 635
153 Ga0307408_100003826 3300031548 Bacteria 10245
154 Ga0307406_10005481 3300031901 Bacteria 6943
155 Ga0307412_10018880 3300031911 Bacteria 4161
156 Ga0307412_10440001 3300031911 Bacteria 1071
157 Ga0307414_10313594 3300032004 Bacteria 1332
158 Ga0307414_10665519 3300032004 Bacteria 940
159 Ga0307411_10294868 3300032005 Bacteria 1298
160 Ga0307507_10037333 3300033179 Bacteria 4946
161 Ga0307510_10157444 3300033180 Bacteria 1875
162 Ga0373936_0008289 3300035113 Bacteria 3908
163 Ga0395899_0000126 3300037312 Bacteria 120125
164 Ga0395899_0018076 3300037312 Bacteria 5365
165 Ga0395899_0100921 3300037312 Bacteria 2083
166 Ga0395899_0145046 3300037312 Bacteria 1686
167 Ga0395899_0359312 3300037312 Bacteria 972
168 Ga0395900_0009715 3300037418 Bacteria 9855
169 Ga0395900_0041427 3300037418 Bacteria 4748
170 Ga0395900_0108501 3300037418 Bacteria 2852
171 Ga0395900_0338200 3300037418 Bacteria 1481
172 Ga0395900_0469760 3300037418 Bacteria 1211
173 Ga0395898_0011061 3300037466 Bacteria 9398
174 Ga0395898_0012283 3300037466 Bacteria 8857
175 Ga0395898_0750003 3300037466 Bacteria 917
176 Ga0395905_0003342 3300037471 Bacteria 17212
177 Ga0395905_1102956 3300037471 Unclassified 697
178 Ga0395901_0011221 3300038443 Bacteria 9076
179 Ga0395901_0098277 3300038443 Bacteria 3069
180 Ga0395901_1144804 3300038443 Bacteria 746
181 Ga0439439_0039135 3300041406 Bacteria 1225
182 Ga0451837_0524944 3300041494 Bacteria 1467
183 Ga0439433_0019529 3300041999 Bacteria 1510
184 Ga0439449_0006637 3300042007 Bacteria 4424
185 Ga0439449_0045306 3300042007 Bacteria 1630
186 Ga0439457_007348 3300042014 Bacteria 2650
187 Ga0451577_0160961 3300042876 Bacteria 2021
188 Ga0453684_0001324 3300044712 Bacteria 73175
189 Ga0453684_0066104 3300044712 Bacteria 4606
190 Ga0495638_0001341 3300046460 Bacteria 22588
191 Ga0495638_0025616 3300046460 Bacteria 3831
192 Ga0495580_0206717 3300046472 Bacteria 1352
193 Ga0495605_0370796 3300046474 Bacteria 598
194 Ga0495607_0060518 3300046501 Bacteria 2155
195 Ga0495610_0000064 3300046512 Bacteria 125922
196 Ga0495610_0000157 3300046512 Bacteria 75701
197 Ga0495631_0008281 3300046518 Bacteria 5241
198 Ga0495637_0107385 3300046520 Bacteria 1085
199 Ga0495663_0136765 3300046525 Bacteria 829
200 Ga0495654_0179064 3300046530 Bacteria 919
201 Ga0495621_0014097 3300046539 Bacteria 2524
202 Ga0495597_0028609 3300046542 Bacteria 2550
203 Ga0495597_0260623 3300046542 Bacteria 679
204 Ga0495668_0010609 3300046616 Bacteria 5566
205 Ga0495625_0001072 3300046660 Bacteria 35532
206 Ga0495625_0005390 3300046660 Bacteria 11698
207 Ga0495625_0060135 3300046660 Bacteria 2692
208 Ga0495661_0368572 3300046665 Bacteria 704
209 Ga0495671_0069500 3300046692 Bacteria 1731
210 Ga0495649_0060216 3300046694 Bacteria 2043
211 Ga0495660_0009040 3300046810 Bacteria 5819
212 Ga0495660_0137439 3300046810 Bacteria 1220
213 Ga0495672_0001289 3300047320 Bacteria 24996
214 Ga0495677_0080719 3300047445 Bacteria 1219
215 Ga0495685_012127 3300047447 Bacteria 2916
216 Ga0495626_0072539 3300048091 Bacteria 1544
217 Ga0496101_0056820 3300048904 Bacteria 2829
218 Ga0496102_0046667 3300048905 Bacteria 3935
219 Ga0496102_0361677 3300048905 Bacteria 1366
220 Ga0496105_0018391 3300048908 Bacteria 5615
221 Ga0496107_0825033 3300048910 Bacteria 678
222 Ga0496108_0004798 3300048911 Bacteria 10906
223 Ga0496109_0012593 3300048912 Bacteria 7303
224 Ga0496110_0128052 3300048913 Bacteria 2291
225 Ga0496111_0007742 3300048914 Bacteria 7068
226 Ga0496112_0469511 3300048915 Bacteria 1195
227 Ga0496113_0196223 3300048916 Bacteria 1603
228 Ga0496114_0262870 3300048917 Bacteria 1520
229 Ga0496116_0010971 3300048919 Bacteria 7544
230 Ga0496116_0131415 3300048919 Bacteria 1426
231 Ga0496119_0169705 3300048922 Bacteria 1153
232 Ga0496122_0047824 3300048925 Bacteria 3297
233 Ga0496122_0390252 3300048925 Bacteria 711
234 Ga0496125_0032390 3300048928 Bacteria 4644
235 Ga0496126_0002758 3300048929 Bacteria 23177
236 Ga0496126_0293555 3300048929 Bacteria 1344
237 Ga0495682_0081245 3300049460 Bacteria 1166
238 Ga0501031_0028282 3300049568 Bacteria 3654
239 Ga0501031_0129269 3300049568 Bacteria 1650
240 Ga0501032_0134866 3300049569 Bacteria 1627
241 Ga0501036_0027645 3300049572 Bacteria 4794
242 Ga0501036_1386478 3300049572 Bacteria 570
243 Ga0501037_0260610 3300049573 Bacteria 1211
244 Ga0501038_0736139 3300049574 Bacteria 736
245 Ga0501039_0153770 3300049575 Bacteria 1807
246 Ga0501039_0256331 3300049575 Bacteria 1375
247 Ga0501040_0000727 3300049576 Bacteria 20373
248 Ga0501040_0042735 3300049576 Bacteria 3088
249 Ga0501041_0116577 3300049577 Bacteria 1658
250 Ga0501042_0101949 3300049578 Bacteria 2064
251 Ga0501046_0221248 3300049580 Bacteria 1401
252 Ga0501048_0001055 3300049582 Bacteria 20637
253 Ga0501068_0101082 3300049584 Bacteria 1787
254 Ga0501071_0000117 3300049587 Bacteria 31405
255 Ga0501072_0037430 3300049588 Bacteria 3805
256 Ga0501072_0062046 3300049588 Bacteria 2949
257 Ga0501074_0070170 3300049590 Bacteria 2519
258 Ga0501075_0023707 3300049591 Bacteria 4494
259 Ga0501075_0042588 3300049591 Bacteria 3404
260 Ga0501076_0021110 3300049592 Bacteria 4991
261 Ga0501076_0050183 3300049592 Bacteria 3300
262 Ga0501077_0233404 3300049593 Bacteria 1169
263 Ga0501079_0009124 3300049741 Bacteria 7509
264 Ga0501080_0018629 3300049742 Bacteria 6425
265 Ga0501081_0006403 3300049743 Bacteria 7640
266 Ga0501081_0025669 3300049743 Bacteria 3967
267 Ga0501241_000971 3300049758 Bacteria 6058
268 Ga0501035_0090404 3300049822 Bacteria 2695
269 Ga0501044_0326778 3300049823 Bacteria 1457
270 Ga0501045_0000755 3300049824 Bacteria 20714
271 nmdc:mga0k408_267539_c1 3300050493 Bacteria 1021
272 nmdc:mga09592_415949_c1 3300050508 Bacteria 1162
273 Ga0500644_0031137 3300053088 Bacteria 1694
274 Ga0500555_107591 3300053103 Bacteria 704
275 Ga0500556_0000755 3300053104 Bacteria 19303
276 Ga0500562_000018 3300053108 Bacteria 126890
277 Ga0500562_016356 3300053108 Bacteria 1907
278 Ga0500658_0000384 3300053134 Bacteria 19452
279 Ga0500622_0003258 3300053156 Bacteria 11015
280 Ga0500645_000761 3300053730 Bacteria 19659
281 Ga0500645_046397 3300053730 Bacteria 1275
282 Ga0501084_0013308 3300054114 Bacteria 6807
283 Ga0501084_0075007 3300054114 Bacteria 2833
284 Ga0501082_0034137 3300060353 Bacteria 4388
285 Ga0530510_0591173 3300061734 Bacteria 844
286 2509153423 2508501128 Bacteria 8613869
287 2512639494 2512564013 Bacteria 6286191
288 2522550350 2522125168 Bacteria 7376607
289 2524187431 2524023129 Bacteria 6762600
290 2550901541 2548877040 Bacteria 7507281
291 2563926469 2563366752 Bacteria 4961801
292 2573037826 2571042588 Bacteria 5045676
293 2587742120 2585428059 Bacteria 8696589
294 2587918441 2585428106 Bacteria 5179711
295 2643748681 2643221545 Bacteria 5083237
296 2643928224 2643221584 Bacteria 5511711
297 2644224997 2643221640 Bacteria 5258820
298 2644234069 2643221642 Bacteria 5357871
299 2644510356 2643221691 Bacteria 5093099
300 2705993940 2703719227 Bacteria 5631989
301 2739590030 2739367651 Bacteria 6359826
302 2819539446 2818991435 Bacteria 5433759
303 2819578091 2818991442 Bacteria 8318214
304 2819647680 2818991454 Bacteria 5563326
305 2833642181 2833640130 Bacteria 4858325
306 2852628447 2852627209 Bacteria 5896285
307 2857586979 2857586860 Bacteria 4354574
308 2857593393 2857591370 Bacteria 6569758
309 2888583240 2888578766 Bacteria 6743310
310 2904119973 2904113452 Bacteria 7796941
311 2915603432 2915597211 Bacteria 6475886
312 2915608176 2915606848 Bacteria 6032732
313 2925334129 2925326138 Bacteria 9652120
314 2929186875 2929183550 Bacteria 6377511
315 2929209878 2929206907 Bacteria 5918291
316 2938651714 2938649242 Bacteria 7118381
317 2965322149 2965320100 Bacteria 3975600
318 2968562620 2968558590 Bacteria 6956864
319 2971516474 2971511577 Bacteria 5404012
320 2980179758 2980176882 Bacteria 5397533
321 2988230518 2988225383 Bacteria 7221625
322 2996638067 2996632988 Bacteria 6921523
323 3001267824 3001267043 Bacteria 4823521
324 8006971411 8006964411 Bacteria 8966052
325 8054471593 8054465665 Bacteria 7323556
326 8054799217 8054795415 Bacteria 9785225
327 Ga0055526_1033086
328 JGI25151J46595_10045881
329 rootL2_10089548
330 rootH1_10375682
331 Ga0055538_1000683
332 Ga0055526_1034437
333 Ga0055536_1031222
334 Ga0055531_10001797
335 Ga0065165_1000030
336 Ga0065165_1000421
337 Ga0065714_10075984
338 Ga0065704_10304050
339 Ga0065707_10685572
340 Ga0070658_10147929
341 Ga0070683_100023510
342 Ga0070683_100106174
343 Ga0070683_100170025
344 Ga0068869_100069253
345 Ga0070666_10930980
346 Ga0070680_100058027
347 Ga0070680_100649786
348 Ga0070682_100148573
349 Ga0068868_100626301
350 Ga0070691_10035270
351 Ga0070669_100015152
352 Ga0070671_100075539
353 Ga0070673_100398399
354 Ga0070688_100780098
355 Ga0070667_100264783
356 Ga0070714_100345334
357 Ga0070713_100263477
358 Ga0070663_100457122
359 Ga0070681_10077572
360 Ga0070681_10330520
361 Ga0070681_10352674
362 Ga0070681_10666974
363 Ga0070681_10688358
364 Ga0070698_101716729
365 Ga0070679_100024164
366 Ga0070679_100031909
367 Ga0070679_100084052
368 Ga0070679_100122667
369 Ga0070679_100429967
370 Ga0070684_100749922
371 Ga0068853_100002552
372 Ga0068853_100835675
373 Ga0070696_100350104
374 Ga0070693_100028296
375 Ga0070704_100822588
376 Ga0068855_100030813
377 Ga0070664_101653757
378 Ga0068857_101059287
379 Ga0068854_100640365
380 Ga0068856_100442307
381 Ga0068852_100814018
382 Ga0068861_100045751
383 Ga0068861_100051801
384 Ga0068861_100943712
385 Ga0068851_10106889
386 Ga0068860_100084901
387 Ga0075366_10012353
388 Ga0075366_10077427
389 Ga0075370_10070118
390 Ga0075430_100081190
391 Ga0105240_10099748
392 Ga0105245_10175111
393 Ga0105247_10001974
394 Ga0105241_11419863
395 Ga0105248_10316348
396 Ga0105237_10068190
397 Ga0105237_10748217
398 Ga0105238_10040234
399 Ga0105249_10001743
400 Ga0105249_10615427
401 Ga0157373_10021728
402 Ga0157371_10029729
403 Ga0157371_10516718
404 Ga0157370_10212846
405 Ga0157370_10250948
406 Ga0157369_10168677
407 Ga0157369_10515601
408 Ga0157374_10126656
409 Ga0157372_11467020
410 Ga0163163_10486609
411 Ga0157380_10011412
412 Ga0163161_10470595
413 Ga0209784_101308
414 Ga0209566_100103
415 Ga0209130_1000170
416 Ga0209675_1019456
417 Ga0209676_1000515
418 Ga0209025_1031314
419 Ga0209025_1033841
420 Ga0209564_1001313
421 Ga0209050_1051712
422 Ga0207426_1101979
423 Ga0209257_1000200
424 Ga0207656_10070112
425 Ga0207642_10082334
426 Ga0207710_10002044
427 Ga0207710_10040532
428 Ga0207688_10156399
429 Ga0207645_10308198
430 Ga0207645_10815413
431 Ga0207705_10619910
432 Ga0207654_10132767
433 Ga0207707_10330022
434 Ga0207671_10302976
435 Ga0207671_10594269
436 Ga0207660_10061307
437 Ga0207660_10116023
438 Ga0207660_10283584
439 Ga0207652_10001442
440 Ga0207652_10097469
441 Ga0207652_10212231
442 Ga0207681_10016208
443 Ga0207694_10272948
444 Ga0207650_10360488
445 Ga0207687_10199951
446 Ga0207664_10038397
447 Ga0207664_10368880
448 Ga0207644_10761295
449 Ga0207711_10241010
450 Ga0207661_10104559
451 Ga0207661_10137097
452 Ga0207661_10265706
453 Ga0207661_10584585
454 Ga0207667_10073729
455 Ga0207667_10297370
456 Ga0207667_10350655
457 Ga0207651_10258682
458 Ga0207651_10469860
459 Ga0207712_10010062
460 Ga0207712_10072019
461 Ga0207712_10441307
462 Ga0207668_11227594
463 Ga0207658_10258519
464 Ga0207677_10649378
465 Ga0207639_10017147
466 Ga0207702_11133575
467 Ga0207674_11035324
468 Ga0207675_100051702
469 Ga0207683_11339192
470 Ga0207698_10157701
471 Ga0207698_10258768
472 Ga0268266_11690797
473 Ga0268265_10280142
474 Ga0268265_10283421
475 Ga0268264_10023936
476 Ga0307517_10019930
477 Ga0316177_1181300
478 Ga0307509_10759413
479 Ga0307408_100003826
480 Ga0307406_10005481
481 Ga0307412_10018880
482 Ga0307412_10440001
483 Ga0307414_10313594
484 Ga0307414_10665519
485 Ga0307411_10294868
486 Ga0307507_10037333
487 Ga0307510_10157444
488 Ga0373936_0008289
489 Ga0395899_0000126
490 Ga0395899_0018076
491 Ga0395899_0100921
492 Ga0395899_0145046
493 Ga0395899_0359312
494 Ga0395900_0009715
495 Ga0395900_0041427
496 Ga0395900_0108501
497 Ga0395900_0338200
498 Ga0395900_0469760
499 Ga0395898_0011061
500 Ga0395898_0012283
501 Ga0395898_0750003
502 Ga0395905_0003342
503 Ga0395905_1102956
504 Ga0395901_0011221
505 Ga0395901_0098277
506 Ga0395901_1144804
507 Ga0439439_0039135
508 Ga0451837_0524944
509 Ga0439433_0019529
510 Ga0439449_0006637
511 Ga0439449_0045306
512 Ga0439457_007348
513 Ga0451577_0160961
514 Ga0453684_0001324
515 Ga0453684_0066104
516 Ga0495638_0001341
517 Ga0495638_0025616
518 Ga0495580_0206717
519 Ga0495605_0370796
520 Ga0495607_0060518
521 Ga0495610_0000064
522 Ga0495610_0000157
523 Ga0495631_0008281
524 Ga0495637_0107385
525 Ga0495663_0136765
526 Ga0495654_0179064
527 Ga0495621_0014097
528 Ga0495597_0028609
529 Ga0495597_0260623
530 Ga0495668_0010609
531 Ga0495625_0001072
532 Ga0495625_0005390
533 Ga0495625_0060135
534 Ga0495661_0368572
535 Ga0495671_0069500
536 Ga0495649_0060216
537 Ga0495660_0009040
538 Ga0495660_0137439
539 Ga0495672_0001289
540 Ga0495677_0080719
541 Ga0495685_012127
542 Ga0495626_0072539
543 Ga0496101_0056820
544 Ga0496102_0046667
545 Ga0496102_0361677
546 Ga0496105_0018391
547 Ga0496107_0825033
548 Ga0496108_0004798
549 Ga0496109_0012593
550 Ga0496110_0128052
551 Ga0496111_0007742
552 Ga0496112_0469511
553 Ga0496113_0196223
554 Ga0496114_0262870
555 Ga0496116_0010971
556 Ga0496116_0131415
557 Ga0496119_0169705
558 Ga0496122_0047824
559 Ga0496122_0390252
560 Ga0496125_0032390
561 Ga0496126_0002758
562 Ga0496126_0293555
563 Ga0495682_0081245
564 Ga0501031_0028282
565 Ga0501031_0129269
566 Ga0501032_0134866
567 Ga0501036_0027645
568 Ga0501036_1386478
569 Ga0501037_0260610
570 Ga0501038_0736139
571 Ga0501039_0153770
572 Ga0501039_0256331
573 Ga0501040_0000727
574 Ga0501040_0042735
575 Ga0501041_0116577
576 Ga0501042_0101949
577 Ga0501046_0221248
578 Ga0501048_0001055
579 Ga0501068_0101082
580 Ga0501071_0000117
581 Ga0501072_0037430
582 Ga0501072_0062046
583 Ga0501074_0070170
584 Ga0501075_0023707
585 Ga0501075_0042588
586 Ga0501076_0021110
587 Ga0501076_0050183
588 Ga0501077_0233404
589 Ga0501079_0009124
590 Ga0501080_0018629
591 Ga0501081_0006403
592 Ga0501081_0025669
593 Ga0501241_000971
594 Ga0501035_0090404
595 Ga0501044_0326778
596 Ga0501045_0000755
597 nmdc:mga0k408_267539_c1
598 nmdc:mga09592_415949_c1
599 Ga0500644_0031137
600 Ga0500555_107591
601 Ga0500556_0000755
602 Ga0500562_000018
603 Ga0500562_016356
604 Ga0500658_0000384
605 Ga0500622_0003258
606 Ga0500645_000761
607 Ga0500645_046397
608 Ga0501084_0013308
609 Ga0501084_0075007
610 Ga0501082_0034137
611 Ga0530510_0591173
612 2509153423
613 2512639494
614 2522550350
615 2524187431
616 2550901541
617 2563926469
618 2573037826
619 2587742120
620 2587918441
621 2643748681
622 2643928224
623 2644224997
624 2644234069
625 2644510356
626 2705993940
627 2739590030
628 2819539446
629 2819578091
630 2819647680
631 2833642181
632 2852628447
633 2857586979
634 2857593393
635 2888583240
636 2904119973
637 2915603432
638 2915608176
639 2925334129
640 2929186875
641 2929209878
642 2938651714
643 2965322149
644 2968562620
645 2971516474
646 2980179758
647 2988230518
648 2996638067
649 3001267824
650 8006971411
651 8054471593
652 8054799217

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

33

168

0.9

PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

35

157

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ss4-assembly1.cif.gz_A crystal structure of the glyoxalase family protein apc24694 from bacillus cereus 0.9321 1 148
1ss4-assembly1.cif.gz_A crystal structure of the glyoxalase family protein apc24694 from bacillus cereus 0.9202 1 148
4mtr-assembly1.cif.gz_B zn-bound gloa2 0.8131 7 146
4mtr-assembly1.cif.gz_A zn-bound gloa2 0.8096 7 145
2c21-assembly3.cif.gz_F specificity of the trypanothione-dependednt leishmania major glyoxalase i: structure and biochemical comparison with the human enzyme 0.8062 8 145
ID Description Score Start End Superfamily
1ss4B00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9264 4 148 3.10.180.10
1ss4B00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9202 4 148 3.10.180.10
af_Q5VMX8_15_124_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8737 12 146 3.10.180.10
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8613 93 150 3.30.720.110
af_Q5VMX8_15_124_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8589 12 146 3.10.180.10
ID Description Score Start End GO Terms
AF-B5I170-F1-model_v4 Glyoxalase/bleomycin resistance protein/dioxygenase 0.9694 93 148 GO:0051213
AF-A0A529P2B6-F1-model_v4 VOC family protein 0.9506 91 148
AF-A0A538M8Z4-F1-model_v4 VOC family protein 0.9399 5 148 GO:0004493
GO:0046491
AF-A0A1H0EA25-F1-model_v4 deleted 0.9398 5 148
AF-A0A435KQ53-F1-model_v4 deleted 0.9397 5 148

Map