F407940

General Info

Members Datasets Scaffolds Average Seq Length
325 229 316 319

Family's Representative Sequence

Representative Sequence 3300039453|Ga0436362_0159931|Ga0436362_0159931_147_1181
Length 344
Sequence MYFVGGDAALVAVHNGALSRLTGSAVSELNYTVELVLPDIEPYRAGNTGVEYVTTFEARQAGPHVLITALTHGNEICGAIALDRLFQAGVRPRRGRLTLAFNNVAAYHEFDARYPIASRYVDEDFNRLWSPATLDGPRQSTELARARALRPIVDAADLLLDLHSMQYATAPLMLAGLLPRSRDLARRVGIPELIMCDAGHAAGPRMRDYGGFGDPASSKTALLIECGQHWERRSAEVATDVMLRFLIAVGSVHPEDVAGIGGPDFNAHAKQRVIEVTEAVTISSDRFDFADDYRGLEVLPEKGSLIGHDGDRDVRTPYDNCVLIMPSRRLVRGQTAVRLGRFVD

Samples

Sample ID Description Type Environment
1 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
2 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
3 2738541300 Massilia sp. GV016 Isolate Unclassified
4 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
5 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
6 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
7 2738543018 Massilia sp. GV045 Isolate Unclassified
8 2738543030 Massilia sp. GV097 Isolate Unclassified
9 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
10 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
11 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
12 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
13 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
14 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
81 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
82 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
122 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
126 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
127 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
128 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
129 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
130 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
131 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
132 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
133 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
134 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
135 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
136 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
137 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
139 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
140 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
141 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
142 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
143 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
144 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
145 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
146 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
147 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
148 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
149 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
150 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
151 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
152 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
153 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
154 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
155 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
156 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
157 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
158 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
159 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
160 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
161 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
162 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
163 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
164 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
165 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
166 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
167 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
168 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
169 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
170 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
171 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
172 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
173 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
174 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
175 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
176 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
177 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
178 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
179 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
180 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
181 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
182 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
183 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
184 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
185 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
186 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
187 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
188 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
189 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
190 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
191 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
192 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
193 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
194 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
195 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
196 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
197 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
198 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
199 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
200 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
201 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
202 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
205 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
206 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
207 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
208 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
210 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
211 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
212 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
213 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
214 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
215 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
216 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
218 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
219 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
220 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
221 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
222 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
223 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
224 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
225 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
226 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
227 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
228 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
229 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane

Type Distribution

Type Percentage (%)
Metagenomes 97.23
Metatranscriptomes 0
Isolates 2.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.15
Nodule 0
Rhizoplane 2.46
Rhizosphere 87.69
Stem 0
Stem Tuber 0
Unclassified 7.69

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10001309 3300001979 Bacteria 11320
2 JGI24739J22299_10005316 3300001989 Bacteria 4905
3 JGI24735J21928_10001507 3300002067 Bacteria 8236
4 JGI25156J39149_1000642 3300002705 Bacteria 19182
5 JGI25165J46597_1000939 3300003214 Bacteria 19950
6 Ga0055533_1000611 3300003756 Bacteria 12060
7 Ga0070658_10043501 3300005327 Bacteria 3627
8 Ga0070658_10136945 3300005327 Bacteria 2043
9 Ga0070690_100052999 3300005330 Bacteria 2594
10 Ga0070690_100094990 3300005330 Bacteria 1968
11 Ga0070682_100310186 3300005337 Bacteria 1161
12 Ga0068868_100104091 3300005338 Bacteria 2300
13 Ga0070689_100003119 3300005340 Bacteria 10946
14 Ga0070689_100011263 3300005340 Bacteria 6403
15 Ga0070675_100087035 3300005354 Bacteria 2612
16 Ga0070671_100112495 3300005355 Bacteria 2287
17 Ga0070671_100560035 3300005355 Bacteria 986
18 Ga0070673_100127732 3300005364 Bacteria 2129
19 Ga0070709_10005080 3300005434 Bacteria 7110
20 Ga0070709_10256975 3300005434 Bacteria 1261
21 Ga0070714_100005133 3300005435 Bacteria 9963
22 Ga0070714_100100063 3300005435 Bacteria 2553
23 Ga0070713_100063370 3300005436 Bacteria 3099
24 Ga0070713_100204768 3300005436 Bacteria 1784
25 Ga0070710_10102760 3300005437 Bacteria 1705
26 Ga0070710_10152446 3300005437 Bacteria 1426
27 Ga0070711_100007316 3300005439 Bacteria 6715
28 Ga0070711_100012860 3300005439 Bacteria 5242
29 Ga0070711_100028802 3300005439 Bacteria 3658
30 Ga0070711_100303635 3300005439 Bacteria 1270
31 Ga0070708_100023965 3300005445 Bacteria 5195
32 Ga0070708_100288191 3300005445 Bacteria 1546
33 Ga0070663_100032949 3300005455 Bacteria 3576
34 Ga0070678_100074131 3300005456 Bacteria 2557
35 Ga0070681_10004261 3300005458 Bacteria 13564
36 Ga0068867_100205947 3300005459 Bacteria 1577
37 Ga0068867_100276364 3300005459 Bacteria 1376
38 Ga0070706_100028262 3300005467 Bacteria 5163
39 Ga0070706_100036683 3300005467 Bacteria 4529
40 Ga0070707_100001063 3300005468 Bacteria 27126
41 Ga0070698_100007772 3300005471 Bacteria 11604
42 Ga0070698_100042305 3300005471 Bacteria 4672
43 Ga0070698_100359446 3300005471 Unclassified 1388
44 Ga0070699_100006239 3300005518 Bacteria 10397
45 Ga0070699_100043870 3300005518 Bacteria 3871
46 Ga0070679_100046257 3300005530 Bacteria 4338
47 Ga0070679_100166720 3300005530 Bacteria 2176
48 Ga0070684_100345479 3300005535 Bacteria 1368
49 Ga0070697_100031652 3300005536 Bacteria 4256
50 Ga0068853_100055977 3300005539 Bacteria 3400
51 Ga0070696_100098241 3300005546 Bacteria 2094
52 Ga0070693_100000368 3300005547 Bacteria 20458
53 Ga0070665_100150283 3300005548 Bacteria 2332
54 Ga0070704_100033979 3300005549 Bacteria 3454
55 Ga0068855_100012890 3300005563 Bacteria 10087
56 Ga0068855_100016440 3300005563 Bacteria 8895
57 Ga0068855_100155365 3300005563 Bacteria 2600
58 Ga0068855_100738453 3300005563 Bacteria 1051
59 Ga0068856_100092844 3300005614 Bacteria 3004
60 Ga0068856_100123911 3300005614 Bacteria 2587
61 Ga0068852_100027542 3300005616 Bacteria 4633
62 Ga0068852_100130903 3300005616 Bacteria 2310
63 Ga0068852_100435226 3300005616 Bacteria 1296
64 Ga0068859_100013111 3300005617 Bacteria 8329
65 Ga0068859_100020433 3300005617 Bacteria 6646
66 Ga0068859_100120496 3300005617 Bacteria 2691
67 Ga0068851_10004300 3300005834 Bacteria 6415
68 Ga0068858_100003687 3300005842 Bacteria 15176
69 Ga0081540_1002692 3300005983 Bacteria 14453
70 Ga0070717_10000545 3300006028 Bacteria 23877
71 Ga0070717_10138896 3300006028 Unclassified 2095
72 Ga0075364_10042301 3300006051 Bacteria 2960
73 Ga0070712_100011652 3300006175 Bacteria 5584
74 Ga0070712_100078282 3300006175 Bacteria 2386
75 Ga0070712_100117804 3300006175 Bacteria 1994
76 Ga0075366_10001376 3300006195 Bacteria 12173
77 Ga0097621_100001896 3300006237 Bacteria 14279
78 Ga0097621_100005440 3300006237 Bacteria 8971
79 Ga0097621_100045277 3300006237 Bacteria 3553
80 Ga0068871_100011499 3300006358 Bacteria 6491
81 Ga0068871_100043733 3300006358 Bacteria 3599
82 Ga0068871_100077829 3300006358 Bacteria 2741
83 Ga0075434_100172788 3300006871 Bacteria 2181
84 Ga0075436_100002772 3300006914 Bacteria 12014
85 Ga0075436_100023867 3300006914 Bacteria 4203
86 Ga0097620_100013111 3300006931 Bacteria 8329
87 Ga0097620_100020433 3300006931 Bacteria 6646
88 Ga0097620_100120492 3300006931 Bacteria 2691
89 Ga0075435_100049385 3300007076 Bacteria 3384
90 Ga0099795_10009073 3300007788 Bacteria 2870
91 Ga0099795_10020368 3300007788 Bacteria 2159
92 Ga0105240_10164054 3300009093 Bacteria 2636
93 Ga0105240_10284591 3300009093 Bacteria 1898
94 Ga0111539_10007900 3300009094 Bacteria 13576
95 Ga0105245_10464847 3300009098 Bacteria 1276
96 Ga0105245_10467169 3300009098 Bacteria 1273
97 Ga0105243_10027789 3300009148 Bacteria 4338
98 Ga0105241_10005942 3300009174 Bacteria 8999
99 Ga0105242_10001487 3300009176 Bacteria 18449
100 Ga0105242_10021598 3300009176 Bacteria 5056
101 Ga0105242_10387572 3300009176 Bacteria 1300
102 Ga0105248_10005875 3300009177 Bacteria 13486
103 Ga0105248_10110759 3300009177 Bacteria 3096
104 Ga0105248_10270483 3300009177 Bacteria 1913
105 Ga0105248_10514444 3300009177 Bacteria 1350
106 Ga0105238_10018439 3300009551 Bacteria 7103
107 Ga0105238_10060582 3300009551 Bacteria 3789
108 Ga0105238_10311718 3300009551 Bacteria 1558
109 Ga0105249_10256956 3300009553 Bacteria 1734
110 Ga0157370_10012189 3300013104 Bacteria 8937
111 Ga0157369_10001148 3300013105 Bacteria 33050
112 Ga0157369_10172541 3300013105 Bacteria 2278
113 Ga0157374_10031733 3300013296 Bacteria 4805
114 Ga0163162_10283300 3300013306 Bacteria 1789
115 Ga0163162_10740944 3300013306 Bacteria 1102
116 Ga0157372_10000909 3300013307 Bacteria 32178
117 Ga0157372_10087240 3300013307 Bacteria 3540
118 Ga0157375_10120239 3300013308 Bacteria 2735
119 Ga0157375_10290008 3300013308 Bacteria 1799
120 Ga0182008_10042406 3300014497 Bacteria 2267
121 Ga0157379_10120416 3300014968 Bacteria 2361
122 Ga0213874_10051569 3300021377 Bacteria 1264
123 Ga0213875_10000152 3300021388 Bacteria 73219
124 Ga0213875_10001400 3300021388 Bacteria 15723
125 Ga0213875_10011701 3300021388 Unclassified 4355
126 Ga0207656_10001596 3300025321 Bacteria 7538
127 Ga0207692_10184009 3300025898 Bacteria 1219
128 Ga0207699_10077744 3300025906 Bacteria 2048
129 Ga0207699_10152915 3300025906 Bacteria 1529
130 Ga0207643_10038642 3300025908 Bacteria 2682
131 Ga0207705_10018034 3300025909 Bacteria 5047
132 Ga0207705_10077687 3300025909 Bacteria 2415
133 Ga0207684_10086774 3300025910 Bacteria 2665
134 Ga0207654_10005525 3300025911 Bacteria 6396
135 Ga0207695_10034379 3300025913 Bacteria 5513
136 Ga0207695_10077868 3300025913 Bacteria 3366
137 Ga0207695_10293713 3300025913 Bacteria 1517
138 Ga0207693_10000447 3300025915 Bacteria 37791
139 Ga0207693_10017582 3300025915 Bacteria 5701
140 Ga0207693_10018553 3300025915 Bacteria 5539
141 Ga0207693_10111710 3300025915 Bacteria 2144
142 Ga0207663_10010692 3300025916 Bacteria 4896
143 Ga0207660_10108842 3300025917 Bacteria 2082
144 Ga0207657_10218521 3300025919 Bacteria 1527
145 Ga0207652_10122013 3300025921 Bacteria 2319
146 Ga0207652_10173277 3300025921 Bacteria 1936
147 Ga0207652_10396137 3300025921 Bacteria 1246
148 Ga0207646_10015153 3300025922 Bacteria 7293
149 Ga0207694_10081946 3300025924 Bacteria 2535
150 Ga0207659_10022761 3300025926 Bacteria 4175
151 Ga0207687_10014951 3300025927 Bacteria 5083
152 Ga0207700_10018856 3300025928 Bacteria 4647
153 Ga0207664_10030634 3300025929 Bacteria 4110
154 Ga0207664_10064333 3300025929 Bacteria 2933
155 Ga0207690_10141486 3300025932 Bacteria 1773
156 Ga0207686_10005261 3300025934 Bacteria 6944
157 Ga0207686_10008214 3300025934 Bacteria 5632
158 Ga0207686_10100157 3300025934 Bacteria 1933
159 Ga0207709_10037884 3300025935 Bacteria 2867
160 Ga0207670_10010381 3300025936 Bacteria 5361
161 Ga0207670_10087959 3300025936 Bacteria 2190
162 Ga0207665_10024642 3300025939 Bacteria 3968
163 Ga0207691_10001638 3300025940 Bacteria 22242
164 Ga0207711_10005460 3300025941 Bacteria 10747
165 Ga0207689_10054776 3300025942 Bacteria 3283
166 Ga0207667_10003036 3300025949 Bacteria 20829
167 Ga0207667_10017499 3300025949 Bacteria 8065
168 Ga0207667_10065726 3300025949 Bacteria 3782
169 Ga0207651_10011881 3300025960 Bacteria 4895
170 Ga0207677_10003594 3300026023 Bacteria 8216
171 Ga0207703_10025096 3300026035 Bacteria 4688
172 Ga0207639_10037728 3300026041 Bacteria 3591
173 Ga0207678_10010832 3300026067 Bacteria 8012
174 Ga0207708_10052699 3300026075 Bacteria 3099
175 Ga0207702_10149423 3300026078 Bacteria 2124
176 Ga0207641_10338569 3300026088 Bacteria 1431
177 Ga0207648_10017807 3300026089 Bacteria 6448
178 Ga0207648_10254255 3300026089 Bacteria 1567
179 Ga0207675_100120601 3300026118 Bacteria 2481
180 Ga0207698_10009850 3300026142 Bacteria 6107
181 Ga0207698_10184813 3300026142 Bacteria 1850
182 Ga0209371_1001696 3300027312 Bacteria 13978
183 Ga0268264_10067316 3300028381 Bacteria 3023
184 Ga0268264_10397705 3300028381 Bacteria 1323
185 Ga0307412_10000002 3300031911 Bacteria 743446
186 Ga0307416_100014888 3300032002 Bacteria 5350
187 Ga0307416_100028050 3300032002 Bacteria 4181
188 Ga0373958_0019244 3300034819 Bacteria 1246
189 Ga0373934_0044038 3300035086 Bacteria 1764
190 Ga0373944_0012520 3300035089 Bacteria 2340
191 Ga0373953_0024531 3300035117 Bacteria 2293
192 Ga0373954_0024696 3300035118 Plasmid 2741
193 Ga0373956_0074073 3300035119 Bacteria 1556
194 Ga0373955_0014137 3300035172 Bacteria 3877
195 Ga0373961_0055105 3300035241 Bacteria 1190
196 Ga0373924_0083249 3300035410 Bacteria 1363
197 Ga0373931_0035364 3300035691 Bacteria 2597
198 Ga0373935_0031790 3300035692 Bacteria 3278
199 Ga0373935_0209964 3300035692 Bacteria 1349
200 Ga0373927_0106469 3300035695 Bacteria 1826
201 Ga0373937_0020617 3300036401 Bacteria 5909
202 Ga0373937_0047121 3300036401 Plasmid 3943
203 Ga0395899_0022729 3300037312 Bacteria 4750
204 Ga0395900_0000556 3300037418 Bacteria 51857
205 Ga0395900_0021105 3300037418 Bacteria 6655
206 Ga0395905_0004052 3300037471 Bacteria 15362
207 Ga0436364_0154218 3300037853 Bacteria 60339
208 Ga0436364_0268253 3300037853 Unclassified 1240
209 Ga0436364_0593069 3300037853 Bacteria 62407
210 Ga0436364_1103819 3300037853 Bacteria 1669
211 Ga0436364_1205096 3300037853 Bacteria 12956
212 Ga0395901_0052476 3300038443 Bacteria 4238
213 Ga0436365_0497732 3300039437 Bacteria 3873
214 Ga0436365_1223956 3300039437 Bacteria 2783
215 Ga0436361_0903361 3300039447 Bacteria 2152
216 Ga0436363_0897233 3300039450 Bacteria 3844
217 Ga0436363_1265031 3300039450 Unclassified 1652
218 Ga0436362_0159931 3300039453 Bacteria 1698
219 Ga0436362_0334414 3300039453 Bacteria 1710
220 Ga0451807_1733518 3300041486 Bacteria 1878
221 Ga0439441_001971 3300042001 Bacteria 2818
222 Ga0439455_0016952 3300042012 Bacteria 1691
223 Ga0466969_0050441 3300044656 Bacteria 2051
224 Ga0466966_0077326 3300044684 Bacteria 2077
225 Ga0466961_0000421 3300044693 Bacteria 27063
226 Ga0466963_0080694 3300044694 Bacteria 2203
227 Ga0466957_0089359 3300044842 Bacteria 1928
228 Ga0466959_0024615 3300045049 Bacteria 4460
229 Ga0466958_0009087 3300045836 Bacteria 5523
230 Ga0495590_0089097 3300046457 Bacteria 1090
231 Ga0495629_0074401 3300046459 Bacteria 2372
232 Ga0495638_0143984 3300046460 Bacteria 1388
233 Ga0495580_0218800 3300046472 Bacteria 1309
234 Ga0495584_0006675 3300046491 Bacteria 6031
235 Ga0495584_0025533 3300046491 Bacteria 2995
236 Ga0495585_0041978 3300046492 Bacteria 2564
237 Ga0495585_0199895 3300046492 Bacteria 1018
238 Ga0495594_0062346 3300046499 Bacteria 2065
239 Ga0495596_0000139 3300046500 Bacteria 49660
240 Ga0495607_0006438 3300046501 Bacteria 8267
241 Ga0495607_0031319 3300046501 Bacteria 3256
242 Ga0495607_0172913 3300046501 Bacteria 1089
243 Ga0495583_0000051 3300046506 Bacteria 212400
244 Ga0495583_0009672 3300046506 Bacteria 5729
245 Ga0495606_0035685 3300046507 Bacteria 3396
246 Ga0495610_0005481 3300046512 Bacteria 9005
247 Ga0495628_0445842 3300046516 Bacteria 940
248 Ga0495643_0101746 3300046522 Bacteria 1472
249 Ga0495644_0014122 3300046523 Bacteria 3060
250 Ga0495663_0019602 3300046525 Bacteria 1937
251 Ga0495598_0052948 3300046537 Bacteria 1228
252 Ga0495609_0000481 3300046538 Bacteria 32044
253 Ga0495621_0002058 3300046539 Bacteria 5323
254 Ga0495645_0016419 3300046543 Bacteria 5285
255 Ga0495633_0017040 3300046558 Bacteria 3726
256 Ga0495656_0007328 3300046615 Bacteria 3894
257 Ga0495668_0148954 3300046616 Bacteria 1281
258 Ga0495625_0068844 3300046660 Bacteria 2487
259 Ga0495659_0000003 3300046664 Bacteria 169166
260 Ga0495661_0015645 3300046665 Bacteria 5059
261 Ga0495661_0028771 3300046665 Bacteria 3553
262 Ga0495657_0214222 3300046675 Unclassified 1170
263 Ga0495599_0003077 3300046678 Bacteria 9711
264 Ga0495658_0044133 3300046683 Bacteria 2497
265 Ga0495669_0004862 3300046684 Bacteria 5574
266 Ga0495669_0009575 3300046684 Bacteria 4087
267 Ga0495670_0086196 3300046691 Bacteria 1603
268 Ga0495671_0000077 3300046692 Bacteria 93450
269 Ga0495649_0209065 3300046694 Bacteria 1011
270 Ga0495589_0039911 3300046794 Bacteria 2345
271 Ga0495660_0105889 3300046810 Bacteria 1441
272 Ga0495674_0053275 3300047319 Bacteria 3557
273 Ga0495672_0000023 3300047320 Bacteria 419080
274 Ga0495683_0059552 3300047323 Bacteria 1894
275 Ga0495687_019105 3300047443 Bacteria 3370
276 Ga0495687_085670 3300047443 Bacteria 1220
277 Ga0495677_0002528 3300047445 Bacteria 7152
278 Ga0495679_046113 3300047446 Bacteria 1328
279 Ga0495685_042218 3300047447 Bacteria 1556
280 Ga0495615_0003481 3300048090 Bacteria 2642
281 Ga0495615_0049857 3300048090 Bacteria 1074
282 Ga0496104_0161318 3300048907 Bacteria 2151
283 Ga0496105_0033639 3300048908 Bacteria 4212
284 Ga0496107_0031134 3300048910 Bacteria 3805
285 Ga0496110_0089244 3300048913 Bacteria 2755
286 Ga0496110_0197365 3300048913 Bacteria 1828
287 Ga0496111_0067665 3300048914 Bacteria 2595
288 Ga0496117_0060778 3300048920 Bacteria 2601
289 Ga0496123_0178195 3300048926 Bacteria 1113
290 Ga0496124_0006340 3300048927 Bacteria 12914
291 Ga0501047_0014518 3300049581 Bacteria 7491
292 Ga0501069_0001983 3300049585 Bacteria 10240
293 Ga0501070_0008442 3300049586 Bacteria 8699
294 Ga0501073_0000119 3300049589 Bacteria 50663
295 Ga0501074_0003541 3300049590 Bacteria 11073
296 Ga0501079_0004899 3300049741 Bacteria 9923
297 Ga0501080_0021019 3300049742 Bacteria 6039
298 Ga0501080_0117034 3300049742 Bacteria 2470
299 Ga0501080_0150462 3300049742 Bacteria 2151
300 Ga0501083_0000505 3300049744 Bacteria 24911
301 Ga0501035_0550198 3300049822 Bacteria 945
302 Ga0501044_0042611 3300049823 Bacteria 4720
303 nmdc:mga00v17_8649_c1 3300050491 Bacteria 5483
304 nmdc:mga0k408_153454_c1 3300050493 Bacteria 1372
305 nmdc:mga0k408_18687_c1 3300050493 Bacteria 3872
306 nmdc:mga08y16_1048_c1 3300050511 Bacteria 27140
307 nmdc:mga0n895_96204_c1 3300050512 Bacteria 2966
308 nmdc:mga0rr50_177616_c1 3300050513 Bacteria 1739
309 nmdc:mga08x19_116922_c1 3300050514 Bacteria 1783
310 nmdc:mga08x19_412_c1 3300050514 Bacteria 29897
311 nmdc:mga0a205_11290_c1 3300050515 Bacteria 8224
312 Ga0495601_0033239 3300053077 Bacteria 3213
313 Ga0495619_0017360 3300053085 Bacteria 4557
314 Ga0495619_0138895 3300053085 Bacteria 1672
315 Ga0501082_0033050 3300060353 Bacteria 4461
316 Ga0466962_0022240 3300061719 Bacteria 3046

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025919 Ga0207657_10218521 Ga0207657_102185211 263
2 3300046660 Ga0495625_0068844 Ga0495625_0068844_1668_2477 269
3 3300046457 Ga0495590_0089097 Ga0495590_0089097_227_1066 279
4 3300046491 Ga0495584_0025533 Ga0495584_0025533_42_881 279
5 3300046501 Ga0495607_0172913 Ga0495607_0172913_25_864 279
6 3300046516 Ga0495628_0445842 Ga0495628_0445842_57_926 289
7 3300048926 Ga0496123_0178195 Ga0496123_0178195_69_938 289
8 3300049822 Ga0501035_0550198 Ga0501035_0550198_40_924 290
9 3300005563 Ga0068855_100738453 Ga0068855_1007384531 293
10 3300026142 Ga0207698_10184813 Ga0207698_101848132 299
11 3300050511 nmdc:mga08y16_1048_c1 nmdc:mga08y16_1048_c1_16855_17931 299
12 3300005330 Ga0070690_100094990 Ga0070690_1000949902 306
13 3300005355 Ga0070671_100560035 Ga0070671_1005600351 306
14 3300006237 Ga0097621_100005440 Ga0097621_1000054407 306
15 3300006358 Ga0068871_100011499 Ga0068871_1000114995 306
16 3300025927 Ga0207687_10014951 Ga0207687_100149513 306
17 3300025934 Ga0207686_10005261 Ga0207686_100052611 306
18 3300050515 nmdc:mga0a205_11290_c1 nmdc:mga0a205_11290_c1_4570_5595 306
19 3300005338 Ga0068868_100104091 Ga0068868_1001040912 308
20 3300005436 Ga0070713_100063370 Ga0070713_1000633704 308
21 3300005459 Ga0068867_100205947 Ga0068867_1002059472 308
22 3300005616 Ga0068852_100027542 Ga0068852_1000275424 308
23 3300005834 Ga0068851_10004300 Ga0068851_100043005 308
24 3300006237 Ga0097621_100045277 Ga0097621_1000452772 308
25 3300006358 Ga0068871_100043733 Ga0068871_1000437334 308
26 3300009093 Ga0105240_10164054 Ga0105240_101640542 308
27 3300009176 Ga0105242_10387572 Ga0105242_103875722 308
28 3300009177 Ga0105248_10270483 Ga0105248_102704832 308
29 3300009551 Ga0105238_10311718 Ga0105238_103117182 308
30 3300025321 Ga0207656_10001596 Ga0207656_100015962 308
31 3300026023 Ga0207677_10003594 Ga0207677_100035942 308
32 3300026142 Ga0207698_10009850 Ga0207698_100098502 308
33 3300048913 Ga0496110_0089244 Ga0496110_0089244_1366_2370 308
34 3300005327 Ga0070658_10043501 Ga0070658_100435012 309
35 3300005340 Ga0070689_100003119 Ga0070689_1000031195 309
36 3300005340 Ga0070689_100011263 Ga0070689_1000112635 309
37 3300005354 Ga0070675_100087035 Ga0070675_1000870353 309
38 3300005355 Ga0070671_100112495 Ga0070671_1001124953 309
39 3300005364 Ga0070673_100127732 Ga0070673_1001277322 309
40 3300005458 Ga0070681_10004261 Ga0070681_100042616 309
41 3300005530 Ga0070679_100046257 Ga0070679_1000462573 309
42 3300005535 Ga0070684_100345479 Ga0070684_1003454791 309
43 3300005539 Ga0068853_100055977 Ga0068853_1000559773 309
44 3300005547 Ga0070693_100000368 Ga0070693_1000003684 309
45 3300005548 Ga0070665_100150283 Ga0070665_1001502832 309
46 3300005563 Ga0068855_100012890 Ga0068855_1000128909 309
47 3300005563 Ga0068855_100016440 Ga0068855_1000164404 309
48 3300005563 Ga0068855_100155365 Ga0068855_1001553651 309
49 3300005614 Ga0068856_100092844 Ga0068856_1000928442 309
50 3300005614 Ga0068856_100123911 Ga0068856_1001239112 309
51 3300005616 Ga0068852_100130903 Ga0068852_1001309032 309
52 3300005616 Ga0068852_100435226 Ga0068852_1004352262 309
53 3300005617 Ga0068859_100020433 Ga0068859_1000204332 309
54 3300005617 Ga0068859_100120496 Ga0068859_1001204962 309
55 3300006051 Ga0075364_10042301 Ga0075364_100423012 309
56 3300006195 Ga0075366_10001376 Ga0075366_100013765 309
57 3300006237 Ga0097621_100001896 Ga0097621_1000018963 309
58 3300006358 Ga0068871_100077829 Ga0068871_1000778292 309
59 3300006914 Ga0075436_100002772 Ga0075436_1000027726 309
60 3300006931 Ga0097620_100020433 Ga0097620_1000204332 309
61 3300006931 Ga0097620_100120492 Ga0097620_1001204922 309
62 3300009098 Ga0105245_10464847 Ga0105245_104648471 309
63 3300009098 Ga0105245_10467169 Ga0105245_104671691 309
64 3300009174 Ga0105241_10005942 Ga0105241_100059427 309
65 3300009176 Ga0105242_10021598 Ga0105242_100215984 309
66 3300009177 Ga0105248_10005875 Ga0105248_100058756 309
67 3300009177 Ga0105248_10514444 Ga0105248_105144442 309
68 3300009551 Ga0105238_10018439 Ga0105238_100184392 309
69 3300009551 Ga0105238_10060582 Ga0105238_100605823 309
70 3300013104 Ga0157370_10012189 Ga0157370_100121893 309
71 3300013105 Ga0157369_10001148 Ga0157369_1000114811 309
72 3300013105 Ga0157369_10172541 Ga0157369_101725412 309
73 3300013296 Ga0157374_10031733 Ga0157374_100317333 309
74 3300013306 Ga0163162_10283300 Ga0163162_102833001 309
75 3300013306 Ga0163162_10740944 Ga0163162_107409442 309
76 3300013307 Ga0157372_10000909 Ga0157372_100009095 309
77 3300013307 Ga0157372_10087240 Ga0157372_100872403 309
78 3300013308 Ga0157375_10120239 Ga0157375_101202392 309
79 3300013308 Ga0157375_10290008 Ga0157375_102900082 309
80 3300014968 Ga0157379_10120416 Ga0157379_101204162 309
81 3300025908 Ga0207643_10038642 Ga0207643_100386422 309
82 3300025909 Ga0207705_10077687 Ga0207705_100776873 309
83 3300025911 Ga0207654_10005525 Ga0207654_100055252 309
84 3300025913 Ga0207695_10034379 Ga0207695_100343793 309
85 3300025913 Ga0207695_10293713 Ga0207695_102937132 309
86 3300025921 Ga0207652_10173277 Ga0207652_101732772 309
87 3300025924 Ga0207694_10081946 Ga0207694_100819462 309
88 3300025926 Ga0207659_10022761 Ga0207659_100227613 309
89 3300025929 Ga0207664_10064333 Ga0207664_100643333 309
90 3300025932 Ga0207690_10141486 Ga0207690_101414862 309
91 3300025934 Ga0207686_10100157 Ga0207686_101001572 309
92 3300025936 Ga0207670_10010381 Ga0207670_100103815 309
93 3300025940 Ga0207691_10001638 Ga0207691_1000163812 309
94 3300025941 Ga0207711_10005460 Ga0207711_100054603 309
95 3300025942 Ga0207689_10054776 Ga0207689_100547762 309
96 3300025949 Ga0207667_10003036 Ga0207667_1000303613 309
97 3300025949 Ga0207667_10017499 Ga0207667_100174995 309
98 3300025949 Ga0207667_10065726 Ga0207667_100657261 309
99 3300025960 Ga0207651_10011881 Ga0207651_100118813 309
100 3300026041 Ga0207639_10037728 Ga0207639_100377283 309
101 3300026078 Ga0207702_10149423 Ga0207702_101494232 309
102 3300026088 Ga0207641_10338569 Ga0207641_103385692 309
103 3300026089 Ga0207648_10254255 Ga0207648_102542551 309
104 3300028381 Ga0268264_10397705 Ga0268264_103977051 309
105 3300034819 Ga0373958_0019244 Ga0373958_0019244_218_1174 309
106 3300035410 Ga0373924_0083249 Ga0373924_0083249_119_1066 309
107 3300041486 Ga0451807_1733518 Ga0451807_1733518_900_1847 309
108 3300044684 Ga0466966_0077326 Ga0466966_0077326_878_1828 309
109 3300044842 Ga0466957_0089359 Ga0466957_0089359_167_1117 309
110 3300045836 Ga0466958_0009087 Ga0466958_0009087_2713_3663 309
111 3300046543 Ga0495645_0016419 Ga0495645_0016419_4300_5247 309
112 3300046678 Ga0495599_0003077 Ga0495599_0003077_4630_5577 309
113 3300046683 Ga0495658_0044133 Ga0495658_0044133_935_1885 309
114 3300049581 Ga0501047_0014518 Ga0501047_0014518_165_1271 309
115 3300049585 Ga0501069_0001983 Ga0501069_0001983_3326_4429 309
116 3300049586 Ga0501070_0008442 Ga0501070_0008442_6423_7529 309
117 3300049589 Ga0501073_0000119 Ga0501073_0000119_37852_38802 309
118 3300049590 Ga0501074_0003541 Ga0501074_0003541_5076_6026 309
119 3300049741 Ga0501079_0004899 Ga0501079_0004899_3347_4453 309
120 3300049742 Ga0501080_0021019 Ga0501080_0021019_4925_5875 309
121 3300049742 Ga0501080_0117034 Ga0501080_0117034_1181_2131 309
122 3300049744 Ga0501083_0000505 Ga0501083_0000505_4306_5412 309
123 3300049823 Ga0501044_0042611 Ga0501044_0042611_709_1659 309
124 3300050491 nmdc:mga00v17_8649_c1 nmdc:mga00v17_8649_c1_1621_2577 309
125 3300050493 nmdc:mga0k408_153454_c1 nmdc:mga0k408_153454_c1_144_1100 309
126 3300050493 nmdc:mga0k408_18687_c1 nmdc:mga0k408_18687_c1_786_1736 309
127 3300050512 nmdc:mga0n895_96204_c1 nmdc:mga0n895_96204_c1_113_1129 309
128 3300050514 nmdc:mga08x19_116922_c1 nmdc:mga08x19_116922_c1_327_1274 309
129 3300050514 nmdc:mga08x19_412_c1 nmdc:mga08x19_412_c1_16199_17212 309
130 3300053085 Ga0495619_0017360 Ga0495619_0017360_1916_2863 309
131 3300060353 Ga0501082_0033050 Ga0501082_0033050_1115_2065 309
132 3300061719 Ga0466962_0022240 Ga0466962_0022240_248_1198 309
133 3300005330 Ga0070690_100052999 Ga0070690_1000529992 310
134 3300005434 Ga0070709_10256975 Ga0070709_102569752 310
135 3300005456 Ga0070678_100074131 Ga0070678_1000741312 310
136 3300005518 Ga0070699_100043870 Ga0070699_1000438704 310
137 3300005530 Ga0070679_100166720 Ga0070679_1001667202 310
138 3300005546 Ga0070696_100098241 Ga0070696_1000982412 310
139 3300005549 Ga0070704_100033979 Ga0070704_1000339791 310
140 3300005617 Ga0068859_100013111 Ga0068859_1000131113 310
141 3300006931 Ga0097620_100013111 Ga0097620_1000131113 310
142 3300009093 Ga0105240_10284591 Ga0105240_102845912 310
143 3300009094 Ga0111539_10007900 Ga0111539_100079001 310
144 3300009553 Ga0105249_10256956 Ga0105249_102569562 310
145 3300025906 Ga0207699_10152915 Ga0207699_101529152 310
146 3300025909 Ga0207705_10018034 Ga0207705_100180344 310
147 3300025917 Ga0207660_10108842 Ga0207660_101088421 310
148 3300025921 Ga0207652_10122013 Ga0207652_101220132 310
149 3300028381 Ga0268264_10067316 Ga0268264_100673162 310
150 3300035692 Ga0373935_0209964 Ga0373935_0209964_55_1008 310
151 3300037418 Ga0395900_0021105 Ga0395900_0021105_1351_2304 310
152 3300037471 Ga0395905_0004052 Ga0395905_0004052_8604_9557 310
153 3300038443 Ga0395901_0052476 Ga0395901_0052476_2075_3028 310
154 3300042001 Ga0439441_001971 Ga0439441_001971_1834_2802 310
155 3300046537 Ga0495598_0052948 Ga0495598_0052948_256_1209 310
156 3300046539 Ga0495621_0002058 Ga0495621_0002058_814_1845 310
157 3300005459 Ga0068867_100276364 Ga0068867_1002763642 311
158 3300005842 Ga0068858_100003687 Ga0068858_1000036875 311
159 3300009148 Ga0105243_10027789 Ga0105243_100277892 311
160 3300009176 Ga0105242_10001487 Ga0105242_1000148715 311
161 3300009177 Ga0105248_10110759 Ga0105248_101107593 311
162 3300025934 Ga0207686_10008214 Ga0207686_100082145 311
163 3300025935 Ga0207709_10037884 Ga0207709_100378843 311
164 3300025936 Ga0207670_10087959 Ga0207670_100879592 311
165 3300026035 Ga0207703_10025096 Ga0207703_100250965 311
166 3300026118 Ga0207675_100120601 Ga0207675_1001206012 311
167 3300032002 Ga0307416_100014888 Ga0307416_1000148884 311
168 3300032002 Ga0307416_100028050 Ga0307416_1000280503 311
169 3300039447 Ga0436361_0903361 Ga0436361_0903361_356_1297 311
170 3300046492 Ga0495585_0041978 Ga0495585_0041978_1354_2325 311
171 3300048908 Ga0496105_0033639 Ga0496105_0033639_2697_3773 311
172 3300048914 Ga0496111_0067665 Ga0496111_0067665_223_1299 311
173 3300026089 Ga0207648_10017807 Ga0207648_100178075 312
174 3300049742 Ga0501080_0150462 Ga0501080_0150462_850_1812 313
175 3300005337 Ga0070682_100310186 Ga0070682_1003101861 315
176 3300005434 Ga0070709_10005080 Ga0070709_100050805 315
177 3300005435 Ga0070714_100005133 Ga0070714_1000051338 315
178 3300005435 Ga0070714_100100063 Ga0070714_1001000632 315
179 3300005436 Ga0070713_100204768 Ga0070713_1002047682 315
180 3300005437 Ga0070710_10102760 Ga0070710_101027602 315
181 3300005437 Ga0070710_10152446 Ga0070710_101524461 315
182 3300005439 Ga0070711_100007316 Ga0070711_1000073167 315
183 3300005439 Ga0070711_100012860 Ga0070711_1000128605 315
184 3300005439 Ga0070711_100028802 Ga0070711_1000288022 315
185 3300005439 Ga0070711_100303635 Ga0070711_1003036351 315
186 3300005445 Ga0070708_100023965 Ga0070708_1000239652 315
187 3300005445 Ga0070708_100288191 Ga0070708_1002881912 315
188 3300005467 Ga0070706_100028262 Ga0070706_1000282623 315
189 3300005467 Ga0070706_100036683 Ga0070706_1000366832 315
190 3300005468 Ga0070707_100001063 Ga0070707_10000106323 315
191 3300005471 Ga0070698_100007772 Ga0070698_1000077723 315
192 3300005471 Ga0070698_100042305 Ga0070698_1000423053 315
193 3300005471 Ga0070698_100359446 Ga0070698_1003594462 315
194 3300005518 Ga0070699_100006239 Ga0070699_1000062396 315
195 3300005536 Ga0070697_100031652 Ga0070697_1000316522 315
196 3300005983 Ga0081540_1002692 Ga0081540_10026927 315
197 3300006028 Ga0070717_10000545 Ga0070717_1000054519 315
198 3300006028 Ga0070717_10138896 Ga0070717_101388963 315
199 3300006175 Ga0070712_100011652 Ga0070712_1000116526 315
200 3300006175 Ga0070712_100078282 Ga0070712_1000782822 315
201 3300006175 Ga0070712_100117804 Ga0070712_1001178042 315
202 3300006871 Ga0075434_100172788 Ga0075434_1001727882 315
203 3300006914 Ga0075436_100023867 Ga0075436_1000238672 315
204 3300007076 Ga0075435_100049385 Ga0075435_1000493852 315
205 3300007788 Ga0099795_10009073 Ga0099795_100090732 315
206 3300007788 Ga0099795_10020368 Ga0099795_100203684 315
207 3300021377 Ga0213874_10051569 Ga0213874_100515691 315
208 3300021388 Ga0213875_10000152 Ga0213875_1000015228 315
209 3300021388 Ga0213875_10001400 Ga0213875_1000140016 315
210 3300021388 Ga0213875_10011701 Ga0213875_100117014 315
211 3300025898 Ga0207692_10184009 Ga0207692_101840092 315
212 3300025906 Ga0207699_10077744 Ga0207699_100777442 315
213 3300025910 Ga0207684_10086774 Ga0207684_100867742 315
214 3300025915 Ga0207693_10000447 Ga0207693_1000044719 315
215 3300025915 Ga0207693_10017582 Ga0207693_100175823 315
216 3300025915 Ga0207693_10018553 Ga0207693_100185536 315
217 3300025915 Ga0207693_10111710 Ga0207693_101117102 315
218 3300025916 Ga0207663_10010692 Ga0207663_100106923 315
219 3300025921 Ga0207652_10396137 Ga0207652_103961371 315
220 3300025922 Ga0207646_10015153 Ga0207646_100151533 315
221 3300025928 Ga0207700_10018856 Ga0207700_100188563 315
222 3300025929 Ga0207664_10030634 Ga0207664_100306342 315
223 3300025939 Ga0207665_10024642 Ga0207665_100246425 315
224 3300035086 Ga0373934_0044038 Ga0373934_0044038_85_1056 315
225 3300035089 Ga0373944_0012520 Ga0373944_0012520_246_1205 315
226 3300035117 Ga0373953_0024531 Ga0373953_0024531_541_1512 315
227 3300035118 Ga0373954_0024696 Ga0373954_0024696_1556_2527 315
228 3300035119 Ga0373956_0074073 Ga0373956_0074073_464_1435 315
229 3300035172 Ga0373955_0014137 Ga0373955_0014137_1308_2279 315
230 3300035241 Ga0373961_0055105 Ga0373961_0055105_72_1031 315
231 3300035691 Ga0373931_0035364 Ga0373931_0035364_261_1220 315
232 3300035692 Ga0373935_0031790 Ga0373935_0031790_887_1846 315
233 3300035695 Ga0373927_0106469 Ga0373927_0106469_498_1457 315
234 3300036401 Ga0373937_0020617 Ga0373937_0020617_2448_3407 315
235 3300036401 Ga0373937_0047121 Ga0373937_0047121_1023_1994 315
236 3300037853 Ga0436364_0154218 Ga0436364_0154218_14521_15480 315
237 3300037853 Ga0436364_0268253 Ga0436364_0268253_213_1172 315
238 3300037853 Ga0436364_0593069 Ga0436364_0593069_15528_16487 315
239 3300037853 Ga0436364_1103819 Ga0436364_1103819_59_1018 315
240 3300037853 Ga0436364_1205096 Ga0436364_1205096_10462_11421 315
241 3300039437 Ga0436365_0497732 Ga0436365_0497732_2616_3575 315
242 3300039437 Ga0436365_1223956 Ga0436365_1223956_183_1205 315
243 3300039450 Ga0436363_0897233 Ga0436363_0897233_283_1242 315
244 3300039450 Ga0436363_1265031 Ga0436363_1265031_668_1627 315
245 3300039453 Ga0436362_0159931 Ga0436362_0159931_147_1181 315
246 3300039453 Ga0436362_0334414 Ga0436362_0334414_110_1069 315
247 3300044694 Ga0466963_0080694 Ga0466963_0080694_337_1296 315
248 3300046459 Ga0495629_0074401 Ga0495629_0074401_184_1143 315
249 3300046472 Ga0495580_0218800 Ga0495580_0218800_19_978 315
250 3300046499 Ga0495594_0062346 Ga0495594_0062346_1035_1994 315
251 3300046675 Ga0495657_0214222 Ga0495657_0214222_59_1018 315
252 3300048907 Ga0496104_0161318 Ga0496104_0161318_650_1609 315
253 3300050513 nmdc:mga0rr50_177616_c1 nmdc:mga0rr50_177616_c1_205_1164 315
254 3300053077 Ga0495601_0033239 Ga0495601_0033239_1929_2900 315
255 3300053085 Ga0495619_0138895 Ga0495619_0138895_392_1363 315
256 iso_pu_bacteria 2738541300 2738841878 315
257 iso_pu_bacteria 2738543018 2739272737 315
258 iso_pu_bacteria 2738543030 2739341781 315
259 3300044656 Ga0466969_0050441 Ga0466969_0050441_228_1205 316
260 3300044693 Ga0466961_0000421 Ga0466961_0000421_257_1234 316
261 3300045049 Ga0466959_0024615 Ga0466959_0024615_937_1914 316
262 3300046460 Ga0495638_0143984 Ga0495638_0143984_44_1003 316
263 3300046491 Ga0495584_0006675 Ga0495584_0006675_1910_2869 316
264 3300046492 Ga0495585_0199895 Ga0495585_0199895_22_984 316
265 3300046500 Ga0495596_0000139 Ga0495596_0000139_7169_8131 316
266 3300046501 Ga0495607_0006438 Ga0495607_0006438_104_1063 316
267 3300046501 Ga0495607_0031319 Ga0495607_0031319_101_1060 316
268 3300046506 Ga0495583_0000051 Ga0495583_0000051_92960_93922 316
269 3300046506 Ga0495583_0009672 Ga0495583_0009672_1301_2260 316
270 3300046507 Ga0495606_0035685 Ga0495606_0035685_1432_2391 316
271 3300046523 Ga0495644_0014122 Ga0495644_0014122_1653_2615 316
272 3300046525 Ga0495663_0019602 Ga0495663_0019602_558_1520 316
273 3300046538 Ga0495609_0000481 Ga0495609_0000481_7304_8263 316
274 3300046558 Ga0495633_0017040 Ga0495633_0017040_2257_3219 316
275 3300046615 Ga0495656_0007328 Ga0495656_0007328_609_1571 316
276 3300046616 Ga0495668_0148954 Ga0495668_0148954_38_997 316
277 3300046664 Ga0495659_0000003 Ga0495659_0000003_150826_151785 316
278 3300046665 Ga0495661_0015645 Ga0495661_0015645_4010_4969 316
279 3300046665 Ga0495661_0028771 Ga0495661_0028771_2435_3397 316
280 3300046684 Ga0495669_0004862 Ga0495669_0004862_3457_4419 316
281 3300046684 Ga0495669_0009575 Ga0495669_0009575_3052_4011 316
282 3300046691 Ga0495670_0086196 Ga0495670_0086196_46_1008 316
283 3300046692 Ga0495671_0000077 Ga0495671_0000077_17743_18702 316
284 3300046694 Ga0495649_0209065 Ga0495649_0209065_34_993 316
285 3300046794 Ga0495589_0039911 Ga0495589_0039911_237_1199 316
286 3300046810 Ga0495660_0105889 Ga0495660_0105889_37_996 316
287 3300047320 Ga0495672_0000023 Ga0495672_0000023_163212_164171 316
288 3300047443 Ga0495687_085670 Ga0495687_085670_211_1170 316
289 3300047445 Ga0495677_0002528 Ga0495677_0002528_1163_2122 316
290 3300047446 Ga0495679_046113 Ga0495679_046113_10_969 316
291 3300047447 Ga0495685_042218 Ga0495685_042218_313_1272 316
292 3300048090 Ga0495615_0003481 Ga0495615_0003481_1539_2501 316
293 3300048090 Ga0495615_0049857 Ga0495615_0049857_66_1028 316
294 3300005327 Ga0070658_10136945 Ga0070658_101369452 317
295 3300026075 Ga0207708_10052699 Ga0207708_100526992 317
296 3300037312 Ga0395899_0022729 Ga0395899_0022729_2599_3567 317
297 3300037418 Ga0395900_0000556 Ga0395900_0000556_20496_21464 317
298 3300042012 Ga0439455_0016952 Ga0439455_0016952_300_1268 317
299 3300048910 Ga0496107_0031134 Ga0496107_0031134_2342_3310 317
300 3300048927 Ga0496124_0006340 Ga0496124_0006340_10119_11087 317
301 3300048913 Ga0496110_0197365 Ga0496110_0197365_335_1312 323
302 iso_pu_bacteria 2738541296 2738824237 323
303 iso_pu_bacteria 2738541298 2738836646 323
304 iso_pu_bacteria 2738541306 2738878177 323
305 iso_pu_bacteria 2738543002 2739189869 323
306 iso_pu_bacteria 2738543008 2739224771 323
307 iso_pu_bacteria 641736151 642423423 323
308 3300047319 Ga0495674_0053275 Ga0495674_0053275_1993_2982 325
309 3300027312 Ga0209371_1001696 Ga0209371_10016962 326
310 3300001979 JGI24740J21852_10001309 JGI24740J21852_100013095 327
311 3300001989 JGI24739J22299_10005316 JGI24739J22299_100053166 327
312 3300002067 JGI24735J21928_10001507 JGI24735J21928_100015075 327
313 3300002705 JGI25156J39149_1000642 JGI25156J39149_100064216 327
314 3300003214 JGI25165J46597_1000939 JGI25165J46597_10009399 327
315 3300003756 Ga0055533_1000611 Ga0055533_10006112 327
316 3300005455 Ga0070663_100032949 Ga0070663_1000329492 327
317 3300014497 Ga0182008_10042406 Ga0182008_100424063 327
318 3300025913 Ga0207695_10077868 Ga0207695_100778682 327
319 3300026067 Ga0207678_10010832 Ga0207678_100108325 327
320 3300031911 Ga0307412_10000002 Ga0307412_10000002636 327
321 3300046512 Ga0495610_0005481 Ga0495610_0005481_395_1378 327
322 3300046522 Ga0495643_0101746 Ga0495643_0101746_412_1395 327
323 3300047323 Ga0495683_0059552 Ga0495683_0059552_16_999 327
324 3300047443 Ga0495687_019105 Ga0495687_019105_549_1532 327
325 3300048920 Ga0496117_0060778 Ga0496117_0060778_256_1239 327

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF24827

61

246

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
3cdx-assembly1.cif.gz_A crystal structure of succinylglutamatedesuccinylase/aspartoacylase from rhodobacter sphaeroides 0.7352 26 317
2qj8-assembly1.cif.gz_A crystal structure of an aspartoacylase family protein (mlr6093) from mesorhizobium loti maff303099 at 2.00 a resolution 0.7258 26 317
3cdx-assembly1.cif.gz_E crystal structure of succinylglutamatedesuccinylase/aspartoacylase from rhodobacter sphaeroides 0.7226 26 315
3cdx-assembly1.cif.gz_B crystal structure of succinylglutamatedesuccinylase/aspartoacylase from rhodobacter sphaeroides 0.7211 26 317
3cdx-assembly1.cif.gz_C crystal structure of succinylglutamatedesuccinylase/aspartoacylase from rhodobacter sphaeroides 0.7183 26 315
ID Description Score Start End Superfamily
2bcoA02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.8244 249 310 2.40.50.630
2bcoA02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.7902 249 310 2.40.50.630
2qj8A00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.7352 26 317 3.40.630.10
3na6A00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.721 26 316 3.40.630.10
3cdxD00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Zn peptidases 0.7149 26 315 3.40.630.10
ID Description Score Start End GO Terms
AF-A0A7W8T850-F1-model_v4 Putative deacylase 0.9879 107 249
AF-A0A3N5F145-F1-model_v4 Succinylglutamate desuccinylase 0.9874 2 199 GO:0005829
GO:0016788
GO:0046872
AF-A0A158D793-F1-model_v4 Succinylglutamate desuccinylase / aspartoacylase family protein 0.9872 1 322 GO:0005829
GO:0016788
GO:0046872
AF-A0A356HK33-F1-model_v4 deleted 0.9865 253 317
AF-A0A158D793-F1-model_v4 Succinylglutamate desuccinylase / aspartoacylase family protein 0.9841 1 322 GO:0005829
GO:0016788
GO:0046872

Feature Viewer

pLDDT pTM Quality
92.61 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map