F407924

General Info

Members Datasets Scaffolds Average Seq Length
325 199 650 133

Family's Representative Sequence

Representative Sequence 3300037068|Ga0373925_0095497|Ga0373925_0095497_562_1023
Length 153
Sequence MCEANRLARRWWSNPFRQELAMAVIPENFHDLLEQKKAFAHLATIMKDGSPQVTPVWFDYTGGMIRVNTAKGRVKARNLREGAPVALSILDPDNPYRYIQIRGTVKRCVEEGADQHIDSLAKKYLGKDKYPFAQPGEVRVMYEIEPRAANAMG

Samples

Sample ID Description Type Environment
1 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
2 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
3 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
4 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
5 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
6 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
35 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
38 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
39 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
50 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
72 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
75 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
76 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
77 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
78 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
79 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
106 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
107 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
109 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
110 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
111 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
112 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
113 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
114 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
115 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
116 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
117 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
118 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
119 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
120 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
121 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
122 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
123 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
124 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
125 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
126 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
127 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
128 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
129 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
130 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
131 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
132 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
133 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
134 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
135 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
136 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
137 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
138 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
139 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
140 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
141 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
142 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
143 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
144 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
145 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
146 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
147 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
148 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
149 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
150 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
151 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
152 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
153 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
154 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
155 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
156 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
157 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
158 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
159 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
160 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
161 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
162 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
165 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
166 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
167 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
168 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
173 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
174 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
175 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
176 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
177 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
178 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
179 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
180 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
181 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
182 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
183 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
184 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
185 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
186 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
187 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
188 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
189 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
190 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
191 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
192 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
193 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
194 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
195 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
196 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
197 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
198 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
199 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.08
Metatranscriptomes 0.92
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.46
Nodule 0
Rhizoplane 1.54
Rhizosphere 78.77
Stem 0
Stem Tuber 0
Unclassified 16.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373925_0095497 3300037068 Bacteria 2277
2 Ga0070677_10080497 3300005333 Bacteria 1392
3 Ga0070680_100531823 3300005336 Bacteria 1007
4 Ga0070668_100973687 3300005347 Bacteria 761
5 Ga0070669_101445848 3300005353 Bacteria 597
6 Ga0070671_100119825 3300005355 Bacteria 2214
7 Ga0070659_101191726 3300005366 Bacteria 673
8 Ga0070667_100208132 3300005367 Unclassified 1738
9 Ga0070709_10031512 3300005434 Bacteria 3189
10 Ga0070709_10423351 3300005434 Bacteria 998
11 Ga0070709_10477067 3300005434 Bacteria 944
12 Ga0070714_100392534 3300005435 Bacteria 1310
13 Ga0070714_100587450 3300005435 Unclassified 1069
14 Ga0070714_101000103 3300005435 Unclassified 814
15 Ga0070713_100071558 3300005436 Bacteria 2931
16 Ga0070713_100129684 3300005436 Bacteria 2222
17 Ga0070713_100256595 3300005436 Unclassified 1597
18 Ga0070713_100702141 3300005436 Unclassified 966
19 Ga0070710_10979925 3300005437 Bacteria 615
20 Ga0070711_100168580 3300005439 Bacteria 1667
21 Ga0070705_100069405 3300005440 Bacteria 2124
22 Ga0070705_100444810 3300005440 Bacteria 971
23 Ga0070700_101453626 3300005441 Unclassified 581
24 Ga0070694_100232607 3300005444 Bacteria 1387
25 Ga0070694_101459141 3300005444 Bacteria 578
26 Ga0070708_100323178 3300005445 Bacteria 1454
27 Ga0070678_100070597 3300005456 Bacteria 2612
28 Ga0070706_100051622 3300005467 Bacteria 3795
29 Ga0070706_100546474 3300005467 Unclassified 1077
30 Ga0070707_100010568 3300005468 Bacteria 8598
31 Ga0070707_101319956 3300005468 Unclassified 688
32 Ga0070679_100015130 3300005530 Bacteria 7414
33 Ga0070697_100513201 3300005536 Bacteria 1049
34 Ga0070697_100694906 3300005536 Bacteria 897
35 Ga0070695_101058076 3300005545 Bacteria 662
36 Ga0068855_102038814 3300005563 Archaea 579
37 Ga0070664_100311154 3300005564 Archaea 1425
38 Ga0068856_100121596 3300005614 Bacteria 2612
39 Ga0070702_101380097 3300005615 Unclassified 575
40 Ga0068852_100583210 3300005616 Bacteria 1121
41 Ga0068859_101645765 3300005617 Unclassified 709
42 Ga0068864_100859993 3300005618 Archaea 894
43 Ga0068864_101842361 3300005618 Unclassified 610
44 Ga0068864_102511528 3300005618 Bacteria 521
45 Ga0068863_100407169 3300005841 Bacteria 1331
46 Ga0068863_100603627 3300005841 Bacteria 1086
47 Ga0068860_100381817 3300005843 Unclassified 1391
48 Ga0070717_10088118 3300006028 Unclassified 2615
49 Ga0070717_10797436 3300006028 Bacteria 859
50 Ga0070717_10851403 3300006028 Bacteria 830
51 Ga0075365_10050947 3300006038 Bacteria 2733
52 Ga0075365_10546313 3300006038 Bacteria 819
53 Ga0075368_10189747 3300006042 Bacteria 868
54 Ga0075364_10266921 3300006051 Bacteria 1164
55 Ga0070716_100050283 3300006173 Bacteria 2365
56 Ga0070716_100473932 3300006173 Bacteria 918
57 Ga0070712_100065350 3300006175 Bacteria 2582
58 Ga0070712_100470188 3300006175 Bacteria 1050
59 Ga0075362_10051323 3300006177 Bacteria 1846
60 Ga0075362_10116665 3300006177 Bacteria 1261
61 Ga0075362_10203322 3300006177 Bacteria 965
62 Ga0075367_10055196 3300006178 Bacteria 2357
63 Ga0068871_100161616 3300006358 Bacteria 1916
64 Ga0068871_101912081 3300006358 Unclassified 564
65 Ga0075433_10142958 3300006852 Bacteria 2127
66 Ga0075434_100084063 3300006871 Bacteria 3181
67 Ga0075434_100169095 3300006871 Bacteria 2206
68 Ga0075434_102265274 3300006871 Bacteria 546
69 Ga0075429_100263074 3300006880 Bacteria 1510
70 Ga0068865_100200147 3300006881 Bacteria 1550
71 Ga0075436_100020463 3300006914 Unclassified 4542
72 Ga0075436_100032498 3300006914 Bacteria 3597
73 Ga0075436_100054737 3300006914 Bacteria 2755
74 Ga0097620_101646141 3300006931 Unclassified 709
75 Ga0075435_100111659 3300007076 Bacteria 2274
76 Ga0075435_100161576 3300007076 Unclassified 1887
77 Ga0075435_100413245 3300007076 Bacteria 1161
78 Ga0099794_10116188 3300007265 Bacteria 1343
79 Ga0099795_10214632 3300007788 Bacteria 817
80 Ga0105240_10049062 3300009093 Bacteria 5332
81 Ga0105240_10415847 3300009093 Bacteria 1512
82 Ga0105240_10472212 3300009093 Bacteria 1400
83 Ga0111539_10001031 3300009094 Bacteria 36498
84 Ga0105247_10253089 3300009101 Bacteria 1205
85 Ga0114129_10272271 3300009147 Bacteria 2265
86 Ga0105243_10418475 3300009148 Unclassified 1249
87 Ga0105248_10074710 3300009177 Bacteria 3810
88 Ga0105238_11913149 3300009551 Unclassified 626
89 Ga0099796_10009816 3300010159 Bacteria 2606
90 Ga0105239_10197478 3300010375 Bacteria 2253
91 Ga0105239_11000839 3300010375 Bacteria 961
92 Ga0105246_10737199 3300011119 Bacteria 868
93 Ga0105246_11361729 3300011119 Unclassified 660
94 Ga0157373_11544794 3300013100 Bacteria 507
95 Ga0157371_10860817 3300013102 Archaea 686
96 Ga0157374_10035719 3300013296 Bacteria 4548
97 Ga0157378_10671054 3300013297 Bacteria 1054
98 Ga0163162_10168181 3300013306 Bacteria 2316
99 Ga0163162_10273947 3300013306 Bacteria 1819
100 Ga0163162_11805709 3300013306 Bacteria 699
101 Ga0163163_10179003 3300014325 Bacteria 2167
102 Ga0157380_10209741 3300014326 Bacteria 1735
103 Ga0182008_10067167 3300014497 Bacteria 1764
104 Ga0157379_11830149 3300014968 Bacteria 597
105 Ga0157376_10136902 3300014969 Unclassified 2192
106 Ga0182005_1035840 3300015265 Archaea 1349
107 Ga0197907_10310257 3300020069 Bacteria 1235
108 Ga0206349_1565952 3300020075 Archaea 524
109 Ga0206355_1043257 3300020076 Bacteria 708
110 Ga0213873_10002036 3300021358 Bacteria 3457
111 Ga0213873_10003996 3300021358 Bacteria 2709
112 Ga0213874_10018632 3300021377 Bacteria 1878
113 Ga0213874_10058265 3300021377 Bacteria 1203
114 Ga0213876_10004540 3300021384 Bacteria 7752
115 Ga0213876_10025030 3300021384 Bacteria 3151
116 Ga0213876_10117518 3300021384 Bacteria 1411
117 Ga0213876_10213250 3300021384 Bacteria 1026
118 Ga0213876_10297262 3300021384 Bacteria 858
119 Ga0213876_10389115 3300021384 Unclassified 741
120 Ga0213876_10614881 3300021384 Bacteria 578
121 Ga0213875_10020041 3300021388 Bacteria 3210
122 Ga0213875_10042029 3300021388 Bacteria 2149
123 Ga0213875_10108717 3300021388 Bacteria 1294
124 Ga0213875_10224061 3300021388 Bacteria 886
125 Ga0213875_10445245 3300021388 Bacteria 620
126 Ga0213871_10011423 3300021441 Bacteria 2040
127 Ga0207699_10006943 3300025906 Bacteria 5514
128 Ga0207695_10004736 3300025913 Bacteria 18412
129 Ga0207695_10251354 3300025913 Bacteria 1667
130 Ga0207693_10025995 3300025915 Bacteria 4636
131 Ga0207693_10402144 3300025915 Bacteria 1071
132 Ga0207663_10419408 3300025916 Bacteria 1027
133 Ga0207660_11686049 3300025917 Unclassified 510
134 Ga0207662_10718949 3300025918 Unclassified 701
135 Ga0207652_10302155 3300025921 Bacteria 1444
136 Ga0207646_10006156 3300025922 Bacteria 12472
137 Ga0207646_10115031 3300025922 Bacteria 2416
138 Ga0207700_10020830 3300025928 Bacteria 4463
139 Ga0207700_10182943 3300025928 Bacteria 1756
140 Ga0207700_10354219 3300025928 Bacteria 1279
141 Ga0207700_10451436 3300025928 Bacteria 1133
142 Ga0207700_10638968 3300025928 Bacteria 949
143 Ga0207700_10731823 3300025928 Bacteria 884
144 Ga0207664_10042630 3300025929 Bacteria 3543
145 Ga0207664_11165471 3300025929 Bacteria 688
146 Ga0207664_11165611 3300025929 Unclassified 688
147 Ga0207686_10217907 3300025934 Bacteria 1376
148 Ga0207704_10151294 3300025938 Bacteria 1638
149 Ga0207665_10027994 3300025939 Bacteria 3723
150 Ga0207665_10424666 3300025939 Unclassified 1016
151 Ga0207711_10040546 3300025941 Bacteria 3961
152 Ga0207711_10382110 3300025941 Bacteria 1307
153 Ga0207679_10563190 3300025945 Archaea 1024
154 Ga0207667_11062454 3300025949 Bacteria 794
155 Ga0207668_11343245 3300025972 Unclassified 644
156 Ga0207658_10375267 3300025986 Bacteria 1244
157 Ga0207658_10877174 3300025986 Unclassified 816
158 Ga0207677_10548607 3300026023 Unclassified 1007
159 Ga0207708_10393072 3300026075 Bacteria 1145
160 Ga0207702_10024417 3300026078 Bacteria 5016
161 Ga0207702_10279161 3300026078 Bacteria 1578
162 Ga0207641_10278894 3300026088 Bacteria 1571
163 Ga0207648_10220108 3300026089 Bacteria 1687
164 Ga0207676_10135991 3300026095 Unclassified 2097
165 Ga0207676_12021109 3300026095 Archaea 575
166 Ga0207683_10117409 3300026121 Bacteria 2386
167 Ga0209813_10206914 3300027866 Bacteria 729
168 Ga0207428_10000027 3300027907 Bacteria 250186
169 Ga0268264_10599520 3300028381 Bacteria 1085
170 Ga0265337_1002592 3300028556 Bacteria 8185
171 Ga0265326_10000056 3300028558 Bacteria 64840
172 Ga0265319_1219475 3300028563 Unclassified 581
173 Ga0265322_10000017 3300028654 Bacteria 114833
174 Ga0265336_10018926 3300028666 Bacteria 2225
175 Ga0265324_10001639 3300029957 Bacteria 12385
176 Ga0265332_10326300 3300031238 Unclassified 633
177 Ga0265328_10000258 3300031239 Bacteria 24453
178 Ga0265320_10000068 3300031240 Bacteria 91884
179 Ga0265329_10040264 3300031242 Bacteria 1499
180 Ga0265331_10005995 3300031250 Bacteria 7252
181 Ga0265327_10000317 3300031251 Bacteria 92215
182 Ga0265314_10000973 3300031711 Bacteria 33669
183 Ga0373950_0040659 3300034818 Bacteria 889
184 Ga0373959_0047544 3300034820 Bacteria 918
185 Ga0373926_0013203 3300035083 Bacteria 2799
186 Ga0373929_0018063 3300035085 Bacteria 1398
187 Ga0373940_0005777 3300035088 Bacteria 2703
188 Ga0373944_0055665 3300035089 Bacteria 1257
189 Ga0373932_0043961 3300035112 Bacteria 1301
190 Ga0373939_0004804 3300035114 Bacteria 3203
191 Ga0373939_0024631 3300035114 Bacteria 1678
192 Ga0373960_0102275 3300035121 Unclassified 930
193 Ga0373943_0185476 3300035170 Bacteria 1145
194 Ga0373942_0096310 3300035207 Unclassified 899
195 Ga0373961_0009783 3300035241 Bacteria 2349
196 Ga0373962_0001988 3300035242 Bacteria 4877
197 Ga0373924_0276277 3300035410 Unclassified 745
198 Ga0373927_0064619 3300035695 Bacteria 2367
199 Ga0373927_0102696 3300035695 Bacteria 1860
200 Ga0373927_0102988 3300035695 Bacteria 1857
201 Ga0373927_0291594 3300035695 Unclassified 1074
202 Ga0373927_0347746 3300035695 Bacteria 977
203 Ga0373947_0431821 3300035725 Bacteria 891
204 Ga0373925_0292771 3300037068 Unclassified 1313
205 Ga0373925_0548368 3300037068 Unclassified 951
206 Ga0373925_0796085 3300037068 Unclassified 779
207 Ga0395898_0764596 3300037466 Bacteria 907
208 Ga0436364_0024456 3300037853 Unclassified 826
209 Ga0436364_0033538 3300037853 Bacteria 4040
210 Ga0436364_0153181 3300037853 Bacteria 2602
211 Ga0436364_0161451 3300037853 Unclassified 1021
212 Ga0436364_0231649 3300037853 Bacteria 7650
213 Ga0436364_0401916 3300037853 Unclassified 744
214 Ga0436364_0634019 3300037853 Bacteria 3088
215 Ga0436364_0712529 3300037853 Bacteria 22342
216 Ga0436364_0873797 3300037853 Bacteria 919
217 Ga0436364_0879264 3300037853 Bacteria 1931
218 Ga0436364_1060235 3300037853 Bacteria 878
219 Ga0436364_1168514 3300037853 Bacteria 10945
220 Ga0395901_0783437 3300038443 Bacteria 944
221 Ga0436365_0022108 3300039437 Bacteria 7252
222 Ga0436365_0278751 3300039437 Unclassified 1817
223 Ga0436365_0429509 3300039437 Bacteria 1535
224 Ga0436365_0652237 3300039437 Bacteria 4517
225 Ga0436365_0818276 3300039437 Bacteria 4131
226 Ga0436365_0823300 3300039437 Bacteria 7865
227 Ga0436365_0920157 3300039437 Bacteria 634
228 Ga0436365_0923976 3300039437 Bacteria 742
229 Ga0436365_0949173 3300039437 Bacteria 4317
230 Ga0436365_1059220 3300039437 Bacteria 1529
231 Ga0436365_1627437 3300039437 Bacteria 4788
232 Ga0436360_0451758 3300039438 Bacteria 789
233 Ga0436360_0513895 3300039438 Bacteria 5090
234 Ga0436360_0586663 3300039438 Bacteria 1571
235 Ga0436360_1288706 3300039438 Bacteria 923
236 Ga0436363_0067205 3300039450 Bacteria 999
237 Ga0436363_0124533 3300039450 Bacteria 3486
238 Ga0436363_0260104 3300039450 Bacteria 1330
239 Ga0436363_0835176 3300039450 Bacteria 1099
240 Ga0436363_1034070 3300039450 Unclassified 895
241 Ga0436363_1452919 3300039450 Bacteria 1136
242 Ga0436362_0096453 3300039453 Bacteria 782
243 Ga0436362_0280723 3300039453 Bacteria 5049
244 Ga0436362_0505982 3300039453 Unclassified 707
245 Ga0436362_1301629 3300039453 Bacteria 2125
246 Ga0436362_1303115 3300039453 Bacteria 1849
247 Ga0439439_0083359 3300041406 Bacteria 867
248 Ga0451577_0436026 3300042876 Bacteria 1190
249 Ga0466965_0535169 3300044683 Unclassified 660
250 Ga0466966_0097367 3300044684 Bacteria 1822
251 Ga0466966_0495199 3300044684 Unclassified 735
252 Ga0466966_0601695 3300044684 Bacteria 662
253 Ga0466966_0777408 3300044684 Bacteria 577
254 Ga0466963_0000534 3300044694 Bacteria 17867
255 Ga0466963_0003489 3300044694 Bacteria 9020
256 Ga0466971_0019495 3300044719 Bacteria 3013
257 Ga0466968_0725140 3300044735 Unclassified 509
258 Ga0466970_0055753 3300044765 Bacteria 2111
259 Ga0466959_0001221 3300045049 Bacteria 15515
260 Ga0466959_0070391 3300045049 Bacteria 2534
261 Ga0466959_0318942 3300045049 Bacteria 1062
262 Ga0466959_0694113 3300045049 Bacteria 682
263 Ga0451576_0180719 3300045051 Bacteria 2202
264 Ga0451576_0841875 3300045051 Archaea 963
265 Ga0451576_0965357 3300045051 Bacteria 893
266 Ga0451576_1852092 3300045051 Bacteria 623
267 Ga0466958_0198461 3300045836 Bacteria 1276
268 Ga0466958_0230189 3300045836 Bacteria 1183
269 Ga0466967_0005687 3300045976 Bacteria 8692
270 Ga0466967_0134105 3300045976 Bacteria 2302
271 Ga0495580_0000885 3300046472 Bacteria 25998
272 Ga0495580_0293768 3300046472 Bacteria 1107
273 Ga0495584_0087111 3300046491 Bacteria 1574
274 Ga0495642_0118712 3300046528 Bacteria 1134
275 Ga0495667_0342973 3300046559 Unclassified 944
276 Ga0495659_0143742 3300046664 Archaea 954
277 Ga0495588_0725974 3300046674 Archaea 519
278 Ga0495680_0770705 3300047322 Unclassified 630
279 Ga0496104_0093688 3300048907 Bacteria 2873
280 Ga0496108_0041601 3300048911 Bacteria 3837
281 Ga0496109_0342291 3300048912 Archaea 1412
282 Ga0496110_0131046 3300048913 Bacteria 2264
283 Ga0496112_0036137 3300048915 Bacteria 4817
284 Ga0501031_0534689 3300049568 Bacteria 755
285 Ga0501036_0328943 3300049572 Bacteria 1277
286 Ga0501039_0460700 3300049575 Bacteria 998
287 Ga0501046_0543563 3300049580 Unclassified 829
288 Ga0501072_0045395 3300049588 Bacteria 3455
289 Ga0501075_0078524 3300049591 Bacteria 2498
290 Ga0501076_0742614 3300049592 Unclassified 810
291 Ga0501077_0087442 3300049593 Bacteria 1975
292 Ga0501079_0061448 3300049741 Bacteria 2898
293 Ga0501045_0096943 3300049824 Bacteria 2182
294 nmdc:mga03683_131022_c1 3300050489 Bacteria 1122
295 nmdc:mga03683_586018_c1 3300050489 Bacteria 545
296 nmdc:mga00v17_290539_c1 3300050491 Bacteria 1061
297 nmdc:mga0yw44_25074_c1 3300050492 Bacteria 3384
298 nmdc:mga06z11_142937_c1 3300050494 Bacteria 1354
299 nmdc:mga06z11_428606_c1 3300050494 Unclassified 798
300 nmdc:mga04h51_252826_c1 3300050495 Bacteria 707
301 nmdc:mga07m45_273440_c1 3300050496 Bacteria 983
302 nmdc:mga05p37_80228_c1 3300050507 Bacteria 4020
303 nmdc:mga09592_30504_c1 3300050508 Bacteria 4487
304 nmdc:mga06r32_29514_c1 3300050510 Bacteria 5142
305 nmdc:mga08y16_1721_c1 3300050511 Bacteria 22214
306 nmdc:mga0n895_162321_c1 3300050512 Bacteria 2266
307 nmdc:mga0n895_49068_c1 3300050512 Bacteria 4134
308 nmdc:mga0n895_87130_c1 3300050512 Bacteria 3120
309 nmdc:mga0rr50_26651_c1 3300050513 Bacteria 4036
310 nmdc:mga0rr50_434702_c1 3300050513 Bacteria 1111
311 nmdc:mga0rr50_63215_c1 3300050513 Bacteria 2795
312 nmdc:mga08x19_1272856_c1 3300050514 Bacteria 521
313 nmdc:mga08x19_33377_c1 3300050514 Bacteria 3249
314 nmdc:mga08x19_55576_c1 3300050514 Bacteria 2552
315 nmdc:mga0a205_39769_c1 3300050515 Bacteria 4526
316 nmdc:mga0a205_825322_c1 3300050515 Bacteria 775
317 nmdc:mga0sz30_89646_c1 3300050516 Bacteria 1337
318 Ga0495595_0514587 3300053084 Bacteria 610
319 Ga0500651_0650069 3300053093 Bacteria 568
320 Ga0500641_0121364 3300053096 Bacteria 1126
321 Ga0500642_0135771 3300053130 Bacteria 1153
322 Ga0501082_0324646 3300060353 Bacteria 1341
323 Ga0466962_0017623 3300061719 Bacteria 3439
324 Ga0466962_0077761 3300061719 Bacteria 1586
325 Ga0530510_0504205 3300061734 Bacteria 917
326 Ga0373925_0095497
327 Ga0070677_10080497
328 Ga0070680_100531823
329 Ga0070668_100973687
330 Ga0070669_101445848
331 Ga0070671_100119825
332 Ga0070659_101191726
333 Ga0070667_100208132
334 Ga0070709_10031512
335 Ga0070709_10423351
336 Ga0070709_10477067
337 Ga0070714_100392534
338 Ga0070714_100587450
339 Ga0070714_101000103
340 Ga0070713_100071558
341 Ga0070713_100129684
342 Ga0070713_100256595
343 Ga0070713_100702141
344 Ga0070710_10979925
345 Ga0070711_100168580
346 Ga0070705_100069405
347 Ga0070705_100444810
348 Ga0070700_101453626
349 Ga0070694_100232607
350 Ga0070694_101459141
351 Ga0070708_100323178
352 Ga0070678_100070597
353 Ga0070706_100051622
354 Ga0070706_100546474
355 Ga0070707_100010568
356 Ga0070707_101319956
357 Ga0070679_100015130
358 Ga0070697_100513201
359 Ga0070697_100694906
360 Ga0070695_101058076
361 Ga0068855_102038814
362 Ga0070664_100311154
363 Ga0068856_100121596
364 Ga0070702_101380097
365 Ga0068852_100583210
366 Ga0068859_101645765
367 Ga0068864_100859993
368 Ga0068864_101842361
369 Ga0068864_102511528
370 Ga0068863_100407169
371 Ga0068863_100603627
372 Ga0068860_100381817
373 Ga0070717_10088118
374 Ga0070717_10797436
375 Ga0070717_10851403
376 Ga0075365_10050947
377 Ga0075365_10546313
378 Ga0075368_10189747
379 Ga0075364_10266921
380 Ga0070716_100050283
381 Ga0070716_100473932
382 Ga0070712_100065350
383 Ga0070712_100470188
384 Ga0075362_10051323
385 Ga0075362_10116665
386 Ga0075362_10203322
387 Ga0075367_10055196
388 Ga0068871_100161616
389 Ga0068871_101912081
390 Ga0075433_10142958
391 Ga0075434_100084063
392 Ga0075434_100169095
393 Ga0075434_102265274
394 Ga0075429_100263074
395 Ga0068865_100200147
396 Ga0075436_100020463
397 Ga0075436_100032498
398 Ga0075436_100054737
399 Ga0097620_101646141
400 Ga0075435_100111659
401 Ga0075435_100161576
402 Ga0075435_100413245
403 Ga0099794_10116188
404 Ga0099795_10214632
405 Ga0105240_10049062
406 Ga0105240_10415847
407 Ga0105240_10472212
408 Ga0111539_10001031
409 Ga0105247_10253089
410 Ga0114129_10272271
411 Ga0105243_10418475
412 Ga0105248_10074710
413 Ga0105238_11913149
414 Ga0099796_10009816
415 Ga0105239_10197478
416 Ga0105239_11000839
417 Ga0105246_10737199
418 Ga0105246_11361729
419 Ga0157373_11544794
420 Ga0157371_10860817
421 Ga0157374_10035719
422 Ga0157378_10671054
423 Ga0163162_10168181
424 Ga0163162_10273947
425 Ga0163162_11805709
426 Ga0163163_10179003
427 Ga0157380_10209741
428 Ga0182008_10067167
429 Ga0157379_11830149
430 Ga0157376_10136902
431 Ga0182005_1035840
432 Ga0197907_10310257
433 Ga0206349_1565952
434 Ga0206355_1043257
435 Ga0213873_10002036
436 Ga0213873_10003996
437 Ga0213874_10018632
438 Ga0213874_10058265
439 Ga0213876_10004540
440 Ga0213876_10025030
441 Ga0213876_10117518
442 Ga0213876_10213250
443 Ga0213876_10297262
444 Ga0213876_10389115
445 Ga0213876_10614881
446 Ga0213875_10020041
447 Ga0213875_10042029
448 Ga0213875_10108717
449 Ga0213875_10224061
450 Ga0213875_10445245
451 Ga0213871_10011423
452 Ga0207699_10006943
453 Ga0207695_10004736
454 Ga0207695_10251354
455 Ga0207693_10025995
456 Ga0207693_10402144
457 Ga0207663_10419408
458 Ga0207660_11686049
459 Ga0207662_10718949
460 Ga0207652_10302155
461 Ga0207646_10006156
462 Ga0207646_10115031
463 Ga0207700_10020830
464 Ga0207700_10182943
465 Ga0207700_10354219
466 Ga0207700_10451436
467 Ga0207700_10638968
468 Ga0207700_10731823
469 Ga0207664_10042630
470 Ga0207664_11165471
471 Ga0207664_11165611
472 Ga0207686_10217907
473 Ga0207704_10151294
474 Ga0207665_10027994
475 Ga0207665_10424666
476 Ga0207711_10040546
477 Ga0207711_10382110
478 Ga0207679_10563190
479 Ga0207667_11062454
480 Ga0207668_11343245
481 Ga0207658_10375267
482 Ga0207658_10877174
483 Ga0207677_10548607
484 Ga0207708_10393072
485 Ga0207702_10024417
486 Ga0207702_10279161
487 Ga0207641_10278894
488 Ga0207648_10220108
489 Ga0207676_10135991
490 Ga0207676_12021109
491 Ga0207683_10117409
492 Ga0209813_10206914
493 Ga0207428_10000027
494 Ga0268264_10599520
495 Ga0265337_1002592
496 Ga0265326_10000056
497 Ga0265319_1219475
498 Ga0265322_10000017
499 Ga0265336_10018926
500 Ga0265324_10001639
501 Ga0265332_10326300
502 Ga0265328_10000258
503 Ga0265320_10000068
504 Ga0265329_10040264
505 Ga0265331_10005995
506 Ga0265327_10000317
507 Ga0265314_10000973
508 Ga0373950_0040659
509 Ga0373959_0047544
510 Ga0373926_0013203
511 Ga0373929_0018063
512 Ga0373940_0005777
513 Ga0373944_0055665
514 Ga0373932_0043961
515 Ga0373939_0004804
516 Ga0373939_0024631
517 Ga0373960_0102275
518 Ga0373943_0185476
519 Ga0373942_0096310
520 Ga0373961_0009783
521 Ga0373962_0001988
522 Ga0373924_0276277
523 Ga0373927_0064619
524 Ga0373927_0102696
525 Ga0373927_0102988
526 Ga0373927_0291594
527 Ga0373927_0347746
528 Ga0373947_0431821
529 Ga0373925_0292771
530 Ga0373925_0548368
531 Ga0373925_0796085
532 Ga0395898_0764596
533 Ga0436364_0024456
534 Ga0436364_0033538
535 Ga0436364_0153181
536 Ga0436364_0161451
537 Ga0436364_0231649
538 Ga0436364_0401916
539 Ga0436364_0634019
540 Ga0436364_0712529
541 Ga0436364_0873797
542 Ga0436364_0879264
543 Ga0436364_1060235
544 Ga0436364_1168514
545 Ga0395901_0783437
546 Ga0436365_0022108
547 Ga0436365_0278751
548 Ga0436365_0429509
549 Ga0436365_0652237
550 Ga0436365_0818276
551 Ga0436365_0823300
552 Ga0436365_0920157
553 Ga0436365_0923976
554 Ga0436365_0949173
555 Ga0436365_1059220
556 Ga0436365_1627437
557 Ga0436360_0451758
558 Ga0436360_0513895
559 Ga0436360_0586663
560 Ga0436360_1288706
561 Ga0436363_0067205
562 Ga0436363_0124533
563 Ga0436363_0260104
564 Ga0436363_0835176
565 Ga0436363_1034070
566 Ga0436363_1452919
567 Ga0436362_0096453
568 Ga0436362_0280723
569 Ga0436362_0505982
570 Ga0436362_1301629
571 Ga0436362_1303115
572 Ga0439439_0083359
573 Ga0451577_0436026
574 Ga0466965_0535169
575 Ga0466966_0097367
576 Ga0466966_0495199
577 Ga0466966_0601695
578 Ga0466966_0777408
579 Ga0466963_0000534
580 Ga0466963_0003489
581 Ga0466971_0019495
582 Ga0466968_0725140
583 Ga0466970_0055753
584 Ga0466959_0001221
585 Ga0466959_0070391
586 Ga0466959_0318942
587 Ga0466959_0694113
588 Ga0451576_0180719
589 Ga0451576_0841875
590 Ga0451576_0965357
591 Ga0451576_1852092
592 Ga0466958_0198461
593 Ga0466958_0230189
594 Ga0466967_0005687
595 Ga0466967_0134105
596 Ga0495580_0000885
597 Ga0495580_0293768
598 Ga0495584_0087111
599 Ga0495642_0118712
600 Ga0495667_0342973
601 Ga0495659_0143742
602 Ga0495588_0725974
603 Ga0495680_0770705
604 Ga0496104_0093688
605 Ga0496108_0041601
606 Ga0496109_0342291
607 Ga0496110_0131046
608 Ga0496112_0036137
609 Ga0501031_0534689
610 Ga0501036_0328943
611 Ga0501039_0460700
612 Ga0501046_0543563
613 Ga0501072_0045395
614 Ga0501075_0078524
615 Ga0501076_0742614
616 Ga0501077_0087442
617 Ga0501079_0061448
618 Ga0501045_0096943
619 nmdc:mga03683_131022_c1
620 nmdc:mga03683_586018_c1
621 nmdc:mga00v17_290539_c1
622 nmdc:mga0yw44_25074_c1
623 nmdc:mga06z11_142937_c1
624 nmdc:mga06z11_428606_c1
625 nmdc:mga04h51_252826_c1
626 nmdc:mga07m45_273440_c1
627 nmdc:mga05p37_80228_c1
628 nmdc:mga09592_30504_c1
629 nmdc:mga06r32_29514_c1
630 nmdc:mga08y16_1721_c1
631 nmdc:mga0n895_162321_c1
632 nmdc:mga0n895_49068_c1
633 nmdc:mga0n895_87130_c1
634 nmdc:mga0rr50_26651_c1
635 nmdc:mga0rr50_434702_c1
636 nmdc:mga0rr50_63215_c1
637 nmdc:mga08x19_1272856_c1
638 nmdc:mga08x19_33377_c1
639 nmdc:mga08x19_55576_c1
640 nmdc:mga0a205_39769_c1
641 nmdc:mga0a205_825322_c1
642 nmdc:mga0sz30_89646_c1
643 Ga0495595_0514587
644 Ga0500651_0650069
645 Ga0500641_0121364
646 Ga0500642_0135771
647 Ga0501082_0324646
648 Ga0466962_0017623
649 Ga0466962_0077761
650 Ga0530510_0504205

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01243

Putative_PNPOx

Pyridoxamine 5'-phosphate oxidase

25

112

0.88

PF12900

Pyridox_ox_2

Pyridoxamine 5'-phosphate oxidase

26

152

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f7e-assembly1.cif.gz_B msmeg_3380 f420 reductase 0.8592 4 130
3f7e-assembly1.cif.gz_B msmeg_3380 f420 reductase 0.8403 4 130
6ymh-assembly1.cif.gz_AAA x-ray structure of the k72i, y129f, r133l, h199a quadruple mutant of pnp-oxidase from e. coli in complex with plp 0.8198 16 131
1wv4-assembly1.cif.gz_B x-ray structure of escherichia coli pyridoxine 5'-phosphate oxidase in tetragonal crystal form 0.8166 16 131
5jab-assembly1.cif.gz_B structure of the biliverdin reductase rv2074 from mycobacterium tuberculosis in complex with f420 0.8071 3 133
ID Description Score Start End Superfamily
3f7eB00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8559 4 130 2.30.110.10
3f7eB00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8369 4 130 2.30.110.10
1wv4B00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.8166 16 131 2.30.110.10
1rfeA01 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.796 4 133 2.30.110.10
2asfA00 Mainly Beta;Roll;Pnp Oxidase; Chain A;Electron Transport, Fmn-binding Protein; Chain A 0.79 5 133 2.30.110.10
ID Description Score Start End GO Terms
AF-A0A512N7F1-F1-model_v4 Putative pyridoxamine 5'-phosphate oxidase 0.9997 1 133 GO:0005829
GO:0016627
GO:0070967
AF-A0A534Z8M1-F1-model_v4 PPOX class F420-dependent oxidoreductase 0.9819 3 133 GO:0005829
GO:0016627
GO:0070967
AF-A0A355B1Y1-F1-model_v4 PPOX class F420-dependent oxidoreductase 0.9721 2 133 GO:0005829
GO:0016627
GO:0070967
AF-A0A3M1F6Z3-F1-model_v4 PPOX class F420-dependent oxidoreductase 0.9698 1 133 GO:0005829
GO:0016627
GO:0070967
AF-A0A533V4L8-F1-model_v4 PPOX class F420-dependent oxidoreductase 0.969 14 133 GO:0005829
GO:0016627
GO:0070967

Map