F407893

General Info

Members Datasets Scaffolds Average Seq Length
325 223 650 129

Family's Representative Sequence

Representative Sequence 3300031712|Ga0265342_10090792|Ga0265342_100907923
Length 144
Sequence LGKGHLETIMDREWNDNQPIYRQLRDRVVAMILDGVLKEGDPLPSVRNVAAEYRVNHLTVLKGYQQLVDEQLVESKRGRGMFINVGARSLLLQGERQKFLAEEWPRVQATIQRLGLKAEELLNGANVRAPLRAPSTDAEQEPKS

Samples

Sample ID Description Type Environment
1 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
83 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300012480 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.yng.040610 Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
108 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
110 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
159 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
160 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
162 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
163 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
164 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
165 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
166 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
167 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
168 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
171 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
172 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
173 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
174 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
175 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
176 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
177 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
178 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
179 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
180 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
181 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
182 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
183 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
184 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
185 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
186 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
187 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
188 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
191 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
192 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
193 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
194 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
195 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
196 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
197 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
198 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
199 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
200 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
201 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
202 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
203 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
204 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
205 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
206 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
207 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
208 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
209 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
210 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
211 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
212 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.77
Metatranscriptomes 5.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.15
Nodule 0
Rhizoplane 4.62
Rhizosphere 88.31
Stem 0
Stem Tuber 0
Unclassified 11.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265342_10090792 3300031712 Bacteria 1751
2 MRS1b_contig_6087602 2162886011 Bacteria 917
3 LJNas_1000580 3300000546 Bacteria 6309
4 Ga0058861_10020104 3300004800 Bacteria 1221
5 Ga0070683_100278192 3300005329 Bacteria 1592
6 Ga0070690_100041778 3300005330 Bacteria 2903
7 Ga0070690_100148698 3300005330 Bacteria 1596
8 Ga0068869_100160666 3300005334 Bacteria 1749
9 Ga0068869_100169665 3300005334 Bacteria 1704
10 Ga0068869_100472695 3300005334 Bacteria 1043
11 Ga0070666_10599281 3300005335 Bacteria 804
12 Ga0070680_100182116 3300005336 Bacteria 1769
13 Ga0070680_100267344 3300005336 Bacteria 1448
14 Ga0070682_100184317 3300005337 Bacteria 1461
15 Ga0068868_100060738 3300005338 Bacteria 2993
16 Ga0070689_100383091 3300005340 Bacteria 1185
17 Ga0070692_10363354 3300005345 Bacteria 903
18 Ga0070668_100661567 3300005347 Bacteria 918
19 Ga0070669_100289315 3300005353 Bacteria 1315
20 Ga0070675_100077186 3300005354 Bacteria 2772
21 Ga0070671_101131052 3300005355 Bacteria 688
22 Ga0070671_102044739 3300005355 Bacteria 510
23 Ga0070674_100019761 3300005356 Bacteria 4286
24 Ga0070673_101732201 3300005364 Bacteria 591
25 Ga0070688_100021339 3300005365 Bacteria 3783
26 Ga0070667_100314168 3300005367 Bacteria 1413
27 Ga0070709_10570982 3300005434 Bacteria 868
28 Ga0070714_100063714 3300005435 Bacteria 3171
29 Ga0070714_100083357 3300005435 Bacteria 2787
30 Ga0070714_100850550 3300005435 Bacteria 885
31 Ga0070713_100046423 3300005436 Bacteria 3564
32 Ga0070713_100122745 3300005436 Bacteria 2280
33 Ga0070710_10297734 3300005437 Bacteria 1052
34 Ga0070701_10124999 3300005438 Bacteria 1454
35 Ga0070700_100210480 3300005441 Bacteria 1371
36 Ga0070694_100542826 3300005444 Bacteria 930
37 Ga0070708_100000141 3300005445 Bacteria 49530
38 Ga0070708_100015280 3300005445 Bacteria 6335
39 Ga0070708_100095018 3300005445 Bacteria 2720
40 Ga0070708_100140104 3300005445 Bacteria 2242
41 Ga0070708_100325687 3300005445 Bacteria 1447
42 Ga0070708_101225771 3300005445 Unclassified 701
43 Ga0070708_101672247 3300005445 Bacteria 592
44 Ga0070663_100007425 3300005455 Bacteria 6669
45 Ga0070678_100404452 3300005456 Bacteria 1187
46 Ga0070678_101021563 3300005456 Unclassified 761
47 Ga0070662_100109055 3300005457 Bacteria 2106
48 Ga0070662_100238020 3300005457 Bacteria 1459
49 Ga0068867_100090010 3300005459 Bacteria 2327
50 Ga0070685_10014327 3300005466 Bacteria 4198
51 Ga0070706_100002181 3300005467 Bacteria 19915
52 Ga0070706_101604285 3300005467 Unclassified 593
53 Ga0070707_100029188 3300005468 Bacteria 5251
54 Ga0070707_100058646 3300005468 Bacteria 3691
55 Ga0070707_100127729 3300005468 Bacteria 2470
56 Ga0070707_100260719 3300005468 Bacteria 1686
57 Ga0070707_100272782 3300005468 Bacteria 1644
58 Ga0070707_100519823 3300005468 Bacteria 1152
59 Ga0070707_100862810 3300005468 Bacteria 869
60 Ga0070707_101925939 3300005468 Unclassified 558
61 Ga0070707_101925940 3300005468 Bacteria 558
62 Ga0070698_100004304 3300005471 Bacteria 15663
63 Ga0070698_100007686 3300005471 Bacteria 11658
64 Ga0070699_100000132 3300005518 Bacteria 69186
65 Ga0070699_100016700 3300005518 Bacteria 6302
66 Ga0070699_100080516 3300005518 Bacteria 2838
67 Ga0070699_100168466 3300005518 Unclassified 1940
68 Ga0070699_100476525 3300005518 Bacteria 1132
69 Ga0070679_100056266 3300005530 Bacteria 3919
70 Ga0070679_100350311 3300005530 Bacteria 1424
71 Ga0070684_100402379 3300005535 Bacteria 1262
72 Ga0070697_100004122 3300005536 Bacteria 11137
73 Ga0070697_100009066 3300005536 Bacteria 7772
74 Ga0070697_100043974 3300005536 Bacteria 3617
75 Ga0070697_100210134 3300005536 Bacteria 1657
76 Ga0068853_101332967 3300005539 Bacteria 694
77 Ga0070672_101160212 3300005543 Unclassified 687
78 Ga0070686_100067275 3300005544 Bacteria 2333
79 Ga0070695_100753253 3300005545 Bacteria 777
80 Ga0070693_100289122 3300005547 Unclassified 1101
81 Ga0070704_100139957 3300005549 Bacteria 1888
82 Ga0070704_100951690 3300005549 Bacteria 775
83 Ga0068855_100348324 3300005563 Bacteria 1632
84 Ga0070664_100097303 3300005564 Bacteria 2555
85 Ga0068857_100117437 3300005577 Unclassified 2394
86 Ga0068857_100693900 3300005577 Bacteria 967
87 Ga0068856_100280612 3300005614 Bacteria 1683
88 Ga0068856_100369809 3300005614 Unclassified 1452
89 Ga0070702_100008326 3300005615 Bacteria 5016
90 Ga0068852_100350231 3300005616 Bacteria 1442
91 Ga0068859_100182180 3300005617 Bacteria 2183
92 Ga0068864_100136172 3300005618 Bacteria 2211
93 Ga0068864_100877699 3300005618 Bacteria 885
94 Ga0068864_100898044 3300005618 Bacteria 875
95 Ga0068861_100034798 3300005719 Bacteria 3726
96 Ga0068861_101105932 3300005719 Bacteria 762
97 Ga0068863_100031769 3300005841 Bacteria 5037
98 Ga0068863_100073377 3300005841 Bacteria 3237
99 Ga0068858_100124329 3300005842 Bacteria 2415
100 Ga0068858_100194982 3300005842 Bacteria 1914
101 Ga0068860_100268491 3300005843 Bacteria 1664
102 Ga0070717_10017017 3300006028 Bacteria 5647
103 Ga0070717_10385160 3300006028 Bacteria 1258
104 Ga0070717_10418162 3300006028 Bacteria 1206
105 Ga0070717_10506751 3300006028 Bacteria 1091
106 Ga0075365_10038193 3300006038 Bacteria 3119
107 Ga0075368_10056694 3300006042 Bacteria 1563
108 Ga0075363_100016596 3300006048 Bacteria 3640
109 Ga0075364_10066193 3300006051 Bacteria 2373
110 Ga0075364_10349592 3300006051 Bacteria 1008
111 Ga0070715_10135845 3300006163 Bacteria 1189
112 Ga0070715_10351642 3300006163 Unclassified 805
113 Ga0070716_100716950 3300006173 Bacteria 766
114 Ga0070716_100924422 3300006173 Bacteria 685
115 Ga0070716_101313992 3300006173 Unclassified 585
116 Ga0075362_10006966 3300006177 Bacteria 4244
117 Ga0075367_10000890 3300006178 Bacteria 12010
118 Ga0075369_10077631 3300006186 Bacteria 1469
119 Ga0075366_10001386 3300006195 Bacteria 12136
120 Ga0097621_100833843 3300006237 Bacteria 856
121 Ga0075370_10867986 3300006353 Bacteria 551
122 Ga0068871_100180955 3300006358 Unclassified 1811
123 Ga0075428_100285912 3300006844 Bacteria 1774
124 Ga0075430_100062455 3300006846 Bacteria 3129
125 Ga0075430_100249151 3300006846 Bacteria 1472
126 Ga0075431_100583944 3300006847 Bacteria 1102
127 Ga0075434_100345978 3300006871 Bacteria 1508
128 Ga0075434_100452807 3300006871 Bacteria 1305
129 Ga0075429_100111370 3300006880 Bacteria 2392
130 Ga0068865_100014619 3300006881 Bacteria 4991
131 Ga0075436_100024194 3300006914 Unclassified 4175
132 Ga0097620_100182160 3300006931 Bacteria 2183
133 Ga0099794_10345288 3300007265 Bacteria 774
134 Ga0099795_10162406 3300007788 Unclassified 923
135 Ga0105240_10020123 3300009093 Bacteria 8909
136 Ga0105240_10258310 3300009093 Bacteria 2011
137 Ga0111539_10001691 3300009094 Bacteria 29431
138 Ga0105245_10000206 3300009098 Bacteria 56107
139 Ga0105245_10163357 3300009098 Bacteria 2115
140 Ga0105245_10460036 3300009098 Bacteria 1282
141 Ga0114129_10528942 3300009147 Bacteria 1536
142 Ga0105243_10070705 3300009148 Bacteria 2819
143 Ga0105241_10094075 3300009174 Bacteria 2369
144 Ga0105241_10693857 3300009174 Unclassified 929
145 Ga0105241_10967826 3300009174 Bacteria 794
146 Ga0105242_10229101 3300009176 Bacteria 1664
147 Ga0105248_10079358 3300009177 Bacteria 3689
148 Ga0105248_10635162 3300009177 Unclassified 1205
149 Ga0105248_10640184 3300009177 Bacteria 1200
150 Ga0105237_10056332 3300009545 Bacteria 3935
151 Ga0105237_10414017 3300009545 Bacteria 1353
152 Ga0105237_11129021 3300009545 Bacteria 790
153 Ga0105238_10265584 3300009551 Bacteria 1696
154 Ga0105249_10051216 3300009553 Bacteria 3765
155 Ga0105249_11639001 3300009553 Bacteria 716
156 Ga0099796_10397316 3300010159 Bacteria 604
157 Ga0105239_10384188 3300010375 Bacteria 1588
158 Ga0105246_10335233 3300011119 Bacteria 1234
159 Ga0157346_1033943 3300012480 Unclassified 510
160 Ga0157373_10078581 3300013100 Bacteria 2327
161 Ga0157370_10885297 3300013104 Unclassified 811
162 Ga0157369_10093844 3300013105 Bacteria 3203
163 Ga0157369_10156587 3300013105 Bacteria 2406
164 Ga0163162_10014853 3300013306 Bacteria 7605
165 Ga0163162_11008447 3300013306 Bacteria 941
166 Ga0157372_10415107 3300013307 Bacteria 1568
167 Ga0157372_10680285 3300013307 Bacteria 1198
168 Ga0157375_10194223 3300013308 Bacteria 2185
169 Ga0163163_10007085 3300014325 Bacteria 9858
170 Ga0163163_10044303 3300014325 Bacteria 4365
171 Ga0163163_10089084 3300014325 Bacteria 3097
172 Ga0157377_10000112 3300014745 Bacteria 55540
173 Ga0154015_1014600 3300020610 Bacteria 558
174 Ga0224712_10602897 3300022467 Unclassified 536
175 Ga0224569_100163 3300022732 Bacteria 5198
176 Ga0207653_10047440 3300025885 Bacteria 1422
177 Ga0207692_10270203 3300025898 Archaea 1025
178 Ga0207680_10907471 3300025903 Bacteria 631
179 Ga0207685_10371954 3300025905 Bacteria 726
180 Ga0207699_10024305 3300025906 Bacteria 3312
181 Ga0207645_10450001 3300025907 Bacteria 869
182 Ga0207643_10050329 3300025908 Bacteria 2362
183 Ga0207684_10001765 3300025910 Bacteria 22848
184 Ga0207684_10002772 3300025910 Bacteria 17450
185 Ga0207684_10306814 3300025910 Bacteria 1368
186 Ga0207654_10423714 3300025911 Unclassified 929
187 Ga0207654_10692402 3300025911 Bacteria 732
188 Ga0207695_10621259 3300025913 Bacteria 962
189 Ga0207671_11435811 3300025914 Unclassified 534
190 Ga0207660_10046550 3300025917 Bacteria 3061
191 Ga0207660_10912297 3300025917 Bacteria 717
192 Ga0207662_10001864 3300025918 Bacteria 10370
193 Ga0207652_10088905 3300025921 Bacteria 2711
194 Ga0207652_11691697 3300025921 Unclassified 537
195 Ga0207646_10000194 3300025922 Bacteria 82991
196 Ga0207646_10002266 3300025922 Bacteria 22890
197 Ga0207646_10228649 3300025922 Bacteria 1680
198 Ga0207646_10332954 3300025922 Bacteria 1372
199 Ga0207646_10421897 3300025922 Bacteria 1204
200 Ga0207681_10125272 3300025923 Bacteria 1891
201 Ga0207650_10208240 3300025925 Bacteria 1570
202 Ga0207687_10004071 3300025927 Bacteria 9799
203 Ga0207700_10160269 3300025928 Bacteria 1868
204 Ga0207700_10814051 3300025928 Bacteria 836
205 Ga0207664_10102437 3300025929 Bacteria 2367
206 Ga0207664_10244196 3300025929 Bacteria 1565
207 Ga0207664_11151649 3300025929 Bacteria 692
208 Ga0207644_10119616 3300025931 Bacteria 2004
209 Ga0207644_11167987 3300025931 Bacteria 647
210 Ga0207690_10248900 3300025932 Bacteria 1372
211 Ga0207706_10152985 3300025933 Bacteria 2029
212 Ga0207686_10166795 3300025934 Bacteria 1549
213 Ga0207709_11451893 3300025935 Unclassified 569
214 Ga0207670_10384000 3300025936 Bacteria 1119
215 Ga0207669_10651945 3300025937 Bacteria 861
216 Ga0207665_10724133 3300025939 Bacteria 783
217 Ga0207665_10805789 3300025939 Bacteria 742
218 Ga0207691_10067711 3300025940 Bacteria 3228
219 Ga0207711_10064910 3300025941 Bacteria 3154
220 Ga0207711_10493700 3300025941 Bacteria 1141
221 Ga0207711_10574936 3300025941 Bacteria 1051
222 Ga0207711_12005907 3300025941 Bacteria 521
223 Ga0207689_10177962 3300025942 Bacteria 1754
224 Ga0207689_10378008 3300025942 Bacteria 1179
225 Ga0207661_10472439 3300025944 Unclassified 1144
226 Ga0207661_10942282 3300025944 Bacteria 795
227 Ga0207679_11818940 3300025945 Bacteria 556
228 Ga0207651_10139731 3300025960 Bacteria 1869
229 Ga0207658_10222429 3300025986 Bacteria 1589
230 Ga0207658_11702559 3300025986 Bacteria 576
231 Ga0207677_10277871 3300026023 Bacteria 1373
232 Ga0207703_10340919 3300026035 Bacteria 1377
233 Ga0207639_11501472 3300026041 Bacteria 632
234 Ga0207678_10011376 3300026067 Bacteria 7810
235 Ga0207702_11067406 3300026078 Unclassified 801
236 Ga0207641_10118952 3300026088 Unclassified 2354
237 Ga0207648_10002455 3300026089 Bacteria 19928
238 Ga0207676_10327867 3300026095 Bacteria 1408
239 Ga0207674_10115587 3300026116 Bacteria 2655
240 Ga0207674_10203551 3300026116 Bacteria 1929
241 Ga0207674_10320107 3300026116 Unclassified 1500
242 Ga0207675_100069872 3300026118 Bacteria 3282
243 Ga0207683_10432352 3300026121 Bacteria 1213
244 Ga0207698_11393210 3300026142 Bacteria 716
245 Ga0209588_1095870 3300027671 Bacteria 956
246 Ga0209588_1106733 3300027671 Bacteria 900
247 Ga0209813_10075044 3300027866 Bacteria 1107
248 Ga0207428_10000171 3300027907 Bacteria 90460
249 Ga0265770_1037495 3300030878 Bacteria 837
250 Ga0265760_10059753 3300031090 Bacteria 1157
251 Ga0373944_0006623 3300035089 Bacteria 3077
252 Ga0373951_0112432 3300035091 Unclassified 734
253 Ga0373951_0248238 3300035091 Bacteria 534
254 Ga0373955_0129413 3300035172 Bacteria 1473
255 Ga0373924_0000247 3300035410 Bacteria 16559
256 Ga0373933_0647519 3300035724 Bacteria 694
257 Ga0373933_0987270 3300035724 Bacteria 555
258 Ga0373947_0056649 3300035725 Bacteria 2370
259 Ga0373937_0919152 3300036401 Bacteria 824
260 Ga0373925_0206695 3300037068 Bacteria 1563
261 Ga0373925_0625016 3300037068 Unclassified 887
262 Ga0395898_0005859 3300037466 Bacteria 13218
263 Ga0395905_0542609 3300037471 Bacteria 1064
264 Ga0395901_1388212 3300038443 Unclassified 661
265 Ga0436365_1579373 3300039437 Bacteria 526
266 Ga0436361_0332437 3300039447 Unclassified 559
267 Ga0436363_0222482 3300039450 Bacteria 580
268 Ga0436363_0589233 3300039450 Bacteria 626
269 Ga0453684_0043132 3300044712 Bacteria 6069
270 Ga0451576_0688431 3300045051 Bacteria 1074
271 Ga0451576_1305942 3300045051 Bacteria 756
272 Ga0495629_0485427 3300046459 Bacteria 834
273 Ga0495651_0021921 3300046462 Bacteria 4968
274 Ga0495643_0000187 3300046522 Bacteria 99364
275 Ga0495647_0378891 3300046681 Bacteria 647
276 Ga0495658_0520062 3300046683 Bacteria 762
277 Ga0495604_0130614 3300047317 Bacteria 1806
278 Ga0495676_0326641 3300047321 Bacteria 1030
279 Ga0495602_0284611 3300048088 Bacteria 1216
280 Ga0496100_0193655 3300048903 Bacteria 1477
281 Ga0496104_0165922 3300048907 Bacteria 2118
282 Ga0496104_0546895 3300048907 Bacteria 1069
283 Ga0496105_0183261 3300048908 Bacteria 1714
284 Ga0496105_0245770 3300048908 Bacteria 1451
285 Ga0496109_0136975 3300048912 Unclassified 2288
286 Ga0496109_0500689 3300048912 Bacteria 1147
287 Ga0496110_0022443 3300048913 Bacteria 5360
288 Ga0496110_0297991 3300048913 Bacteria 1469
289 Ga0496111_0933998 3300048914 Unclassified 624
290 Ga0496112_0005825 3300048915 Bacteria 10725
291 Ga0496112_0515205 3300048915 Bacteria 1131
292 Ga0496113_0004710 3300048916 Bacteria 8419
293 Ga0496113_0079391 3300048916 Bacteria 2512
294 Ga0496115_0362063 3300048918 Bacteria 1182
295 Ga0501291_016651 3300049514 Bacteria 1125
296 nmdc:mga03n38_6499_c1 3300050490 Bacteria 4066
297 nmdc:mga00v17_30295_c1 3300050491 Bacteria 3183
298 nmdc:mga00v17_310385_c1 3300050491 Bacteria 1024
299 nmdc:mga0yw44_134180_c1 3300050492 Bacteria 1605
300 nmdc:mga0k408_598_c1 3300050493 Bacteria 19914
301 nmdc:mga06z11_1142_c1 3300050494 Bacteria 9691
302 nmdc:mga04h51_27192_c1 3300050495 Bacteria 1775
303 nmdc:mga07m45_23860_c1 3300050496 Bacteria 3345
304 nmdc:mga05p37_852973_c1 3300050507 Bacteria 989
305 nmdc:mga09592_326225_c1 3300050508 Bacteria 1330
306 nmdc:mga0qj67_256417_c1 3300050509 Bacteria 1419
307 nmdc:mga06r32_493485_c1 3300050510 Bacteria 1202
308 nmdc:mga08y16_695_c1 3300050511 Bacteria 31921
309 nmdc:mga0n895_275292_c1 3300050512 Bacteria 1707
310 nmdc:mga0sz30_249613_c1 3300050516 Bacteria 790
311 Ga0495601_0093710 3300053077 Bacteria 1935
312 Ga0495601_0182379 3300053077 Bacteria 1372
313 Ga0590077_059638 3300059426 Bacteria 864
314 Ga0587066_005350 3300059490 Bacteria 1639
315 Ga0587070_001266 3300059491 Bacteria 2560
316 Ga0587073_0001733 3300059492 Bacteria 2638
317 Ga0587077_001396 3300059493 Bacteria 2580
318 Ga0587082_033668 3300059504 Bacteria 907
319 Ga0587092_035737 3300059512 Bacteria 844
320 Ga0587094_000971 3300059513 Bacteria 2531
321 Ga0587062_009119 3300059639 Unclassified 1201
322 Ga0587067_101097 3300059640 Unclassified 668
323 Ga0587076_147091 3300059645 Unclassified 569
324 Ga0587107_062250 3300059652 Bacteria 661
325 Ga0587071_047645 3300060344 Bacteria 878
326 Ga0265342_10090792
327 MRS1b_contig_6087602
328 LJNas_1000580
329 Ga0058861_10020104
330 Ga0070683_100278192
331 Ga0070690_100041778
332 Ga0070690_100148698
333 Ga0068869_100160666
334 Ga0068869_100169665
335 Ga0068869_100472695
336 Ga0070666_10599281
337 Ga0070680_100182116
338 Ga0070680_100267344
339 Ga0070682_100184317
340 Ga0068868_100060738
341 Ga0070689_100383091
342 Ga0070692_10363354
343 Ga0070668_100661567
344 Ga0070669_100289315
345 Ga0070675_100077186
346 Ga0070671_101131052
347 Ga0070671_102044739
348 Ga0070674_100019761
349 Ga0070673_101732201
350 Ga0070688_100021339
351 Ga0070667_100314168
352 Ga0070709_10570982
353 Ga0070714_100063714
354 Ga0070714_100083357
355 Ga0070714_100850550
356 Ga0070713_100046423
357 Ga0070713_100122745
358 Ga0070710_10297734
359 Ga0070701_10124999
360 Ga0070700_100210480
361 Ga0070694_100542826
362 Ga0070708_100000141
363 Ga0070708_100015280
364 Ga0070708_100095018
365 Ga0070708_100140104
366 Ga0070708_100325687
367 Ga0070708_101225771
368 Ga0070708_101672247
369 Ga0070663_100007425
370 Ga0070678_100404452
371 Ga0070678_101021563
372 Ga0070662_100109055
373 Ga0070662_100238020
374 Ga0068867_100090010
375 Ga0070685_10014327
376 Ga0070706_100002181
377 Ga0070706_101604285
378 Ga0070707_100029188
379 Ga0070707_100058646
380 Ga0070707_100127729
381 Ga0070707_100260719
382 Ga0070707_100272782
383 Ga0070707_100519823
384 Ga0070707_100862810
385 Ga0070707_101925939
386 Ga0070707_101925940
387 Ga0070698_100004304
388 Ga0070698_100007686
389 Ga0070699_100000132
390 Ga0070699_100016700
391 Ga0070699_100080516
392 Ga0070699_100168466
393 Ga0070699_100476525
394 Ga0070679_100056266
395 Ga0070679_100350311
396 Ga0070684_100402379
397 Ga0070697_100004122
398 Ga0070697_100009066
399 Ga0070697_100043974
400 Ga0070697_100210134
401 Ga0068853_101332967
402 Ga0070672_101160212
403 Ga0070686_100067275
404 Ga0070695_100753253
405 Ga0070693_100289122
406 Ga0070704_100139957
407 Ga0070704_100951690
408 Ga0068855_100348324
409 Ga0070664_100097303
410 Ga0068857_100117437
411 Ga0068857_100693900
412 Ga0068856_100280612
413 Ga0068856_100369809
414 Ga0070702_100008326
415 Ga0068852_100350231
416 Ga0068859_100182180
417 Ga0068864_100136172
418 Ga0068864_100877699
419 Ga0068864_100898044
420 Ga0068861_100034798
421 Ga0068861_101105932
422 Ga0068863_100031769
423 Ga0068863_100073377
424 Ga0068858_100124329
425 Ga0068858_100194982
426 Ga0068860_100268491
427 Ga0070717_10017017
428 Ga0070717_10385160
429 Ga0070717_10418162
430 Ga0070717_10506751
431 Ga0075365_10038193
432 Ga0075368_10056694
433 Ga0075363_100016596
434 Ga0075364_10066193
435 Ga0075364_10349592
436 Ga0070715_10135845
437 Ga0070715_10351642
438 Ga0070716_100716950
439 Ga0070716_100924422
440 Ga0070716_101313992
441 Ga0075362_10006966
442 Ga0075367_10000890
443 Ga0075369_10077631
444 Ga0075366_10001386
445 Ga0097621_100833843
446 Ga0075370_10867986
447 Ga0068871_100180955
448 Ga0075428_100285912
449 Ga0075430_100062455
450 Ga0075430_100249151
451 Ga0075431_100583944
452 Ga0075434_100345978
453 Ga0075434_100452807
454 Ga0075429_100111370
455 Ga0068865_100014619
456 Ga0075436_100024194
457 Ga0097620_100182160
458 Ga0099794_10345288
459 Ga0099795_10162406
460 Ga0105240_10020123
461 Ga0105240_10258310
462 Ga0111539_10001691
463 Ga0105245_10000206
464 Ga0105245_10163357
465 Ga0105245_10460036
466 Ga0114129_10528942
467 Ga0105243_10070705
468 Ga0105241_10094075
469 Ga0105241_10693857
470 Ga0105241_10967826
471 Ga0105242_10229101
472 Ga0105248_10079358
473 Ga0105248_10635162
474 Ga0105248_10640184
475 Ga0105237_10056332
476 Ga0105237_10414017
477 Ga0105237_11129021
478 Ga0105238_10265584
479 Ga0105249_10051216
480 Ga0105249_11639001
481 Ga0099796_10397316
482 Ga0105239_10384188
483 Ga0105246_10335233
484 Ga0157346_1033943
485 Ga0157373_10078581
486 Ga0157370_10885297
487 Ga0157369_10093844
488 Ga0157369_10156587
489 Ga0163162_10014853
490 Ga0163162_11008447
491 Ga0157372_10415107
492 Ga0157372_10680285
493 Ga0157375_10194223
494 Ga0163163_10007085
495 Ga0163163_10044303
496 Ga0163163_10089084
497 Ga0157377_10000112
498 Ga0154015_1014600
499 Ga0224712_10602897
500 Ga0224569_100163
501 Ga0207653_10047440
502 Ga0207692_10270203
503 Ga0207680_10907471
504 Ga0207685_10371954
505 Ga0207699_10024305
506 Ga0207645_10450001
507 Ga0207643_10050329
508 Ga0207684_10001765
509 Ga0207684_10002772
510 Ga0207684_10306814
511 Ga0207654_10423714
512 Ga0207654_10692402
513 Ga0207695_10621259
514 Ga0207671_11435811
515 Ga0207660_10046550
516 Ga0207660_10912297
517 Ga0207662_10001864
518 Ga0207652_10088905
519 Ga0207652_11691697
520 Ga0207646_10000194
521 Ga0207646_10002266
522 Ga0207646_10228649
523 Ga0207646_10332954
524 Ga0207646_10421897
525 Ga0207681_10125272
526 Ga0207650_10208240
527 Ga0207687_10004071
528 Ga0207700_10160269
529 Ga0207700_10814051
530 Ga0207664_10102437
531 Ga0207664_10244196
532 Ga0207664_11151649
533 Ga0207644_10119616
534 Ga0207644_11167987
535 Ga0207690_10248900
536 Ga0207706_10152985
537 Ga0207686_10166795
538 Ga0207709_11451893
539 Ga0207670_10384000
540 Ga0207669_10651945
541 Ga0207665_10724133
542 Ga0207665_10805789
543 Ga0207691_10067711
544 Ga0207711_10064910
545 Ga0207711_10493700
546 Ga0207711_10574936
547 Ga0207711_12005907
548 Ga0207689_10177962
549 Ga0207689_10378008
550 Ga0207661_10472439
551 Ga0207661_10942282
552 Ga0207679_11818940
553 Ga0207651_10139731
554 Ga0207658_10222429
555 Ga0207658_11702559
556 Ga0207677_10277871
557 Ga0207703_10340919
558 Ga0207639_11501472
559 Ga0207678_10011376
560 Ga0207702_11067406
561 Ga0207641_10118952
562 Ga0207648_10002455
563 Ga0207676_10327867
564 Ga0207674_10115587
565 Ga0207674_10203551
566 Ga0207674_10320107
567 Ga0207675_100069872
568 Ga0207683_10432352
569 Ga0207698_11393210
570 Ga0209588_1095870
571 Ga0209588_1106733
572 Ga0209813_10075044
573 Ga0207428_10000171
574 Ga0265770_1037495
575 Ga0265760_10059753
576 Ga0373944_0006623
577 Ga0373951_0112432
578 Ga0373951_0248238
579 Ga0373955_0129413
580 Ga0373924_0000247
581 Ga0373933_0647519
582 Ga0373933_0987270
583 Ga0373947_0056649
584 Ga0373937_0919152
585 Ga0373925_0206695
586 Ga0373925_0625016
587 Ga0395898_0005859
588 Ga0395905_0542609
589 Ga0395901_1388212
590 Ga0436365_1579373
591 Ga0436361_0332437
592 Ga0436363_0222482
593 Ga0436363_0589233
594 Ga0453684_0043132
595 Ga0451576_0688431
596 Ga0451576_1305942
597 Ga0495629_0485427
598 Ga0495651_0021921
599 Ga0495643_0000187
600 Ga0495647_0378891
601 Ga0495658_0520062
602 Ga0495604_0130614
603 Ga0495676_0326641
604 Ga0495602_0284611
605 Ga0496100_0193655
606 Ga0496104_0165922
607 Ga0496104_0546895
608 Ga0496105_0183261
609 Ga0496105_0245770
610 Ga0496109_0136975
611 Ga0496109_0500689
612 Ga0496110_0022443
613 Ga0496110_0297991
614 Ga0496111_0933998
615 Ga0496112_0005825
616 Ga0496112_0515205
617 Ga0496113_0004710
618 Ga0496113_0079391
619 Ga0496115_0362063
620 Ga0501291_016651
621 nmdc:mga03n38_6499_c1
622 nmdc:mga00v17_30295_c1
623 nmdc:mga00v17_310385_c1
624 nmdc:mga0yw44_134180_c1
625 nmdc:mga0k408_598_c1
626 nmdc:mga06z11_1142_c1
627 nmdc:mga04h51_27192_c1
628 nmdc:mga07m45_23860_c1
629 nmdc:mga05p37_852973_c1
630 nmdc:mga09592_326225_c1
631 nmdc:mga0qj67_256417_c1
632 nmdc:mga06r32_493485_c1
633 nmdc:mga08y16_695_c1
634 nmdc:mga0n895_275292_c1
635 nmdc:mga0sz30_249613_c1
636 Ga0495601_0093710
637 Ga0495601_0182379
638 Ga0590077_059638
639 Ga0587066_005350
640 Ga0587070_001266
641 Ga0587073_0001733
642 Ga0587077_001396
643 Ga0587082_033668
644 Ga0587092_035737
645 Ga0587094_000971
646 Ga0587062_009119
647 Ga0587067_101097
648 Ga0587076_147091
649 Ga0587107_062250
650 Ga0587071_047645

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00392

GntR

Bacterial regulatory proteins, gntR family

20

83

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3eet-assembly1.cif.gz_A-2 crystal structure of putative gntr-family transcriptional regulator 0.9602 8 75
5d4r-assembly1.cif.gz_A crystal structure of arar(dbd) in complex with operator ore1 0.9404 9 74
2wv0-assembly5.cif.gz_I crystal structure of the gntr-hutc family member yvoa from bacillus subtilis 0.9342 1 75
3eet-assembly2.cif.gz_B-3 crystal structure of putative gntr-family transcriptional regulator 0.9262 10 75
2wv0-assembly6.cif.gz_J-3 crystal structure of the gntr-hutc family member yvoa from bacillus subtilis 0.9194 6 74
ID Description Score Start End Superfamily
2wv0I01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9819 9 75 1.10.10.10
2wv0D01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9718 9 75 1.10.10.10
2wv0J01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9663 9 74 1.10.10.10
2wv0E01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9648 9 75 1.10.10.10
af_P39389_1_70_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9639 9 75 1.10.10.10
ID Description Score Start End GO Terms
AF-Z9JUA5-F1-model_v4 HTH gntR-type domain-containing protein 0.9816 12 82 GO:0003677
GO:0003700
GO:0045892
AF-A0A6P2C375-F1-model_v4 GntR family transcriptional regulator 0.9796 3 84 GO:0003677
GO:0003700
AF-A0A534FE81-F1-model_v4 GntR family transcriptional regulator 0.9792 1 88 GO:0003677
GO:0003700
AF-A0A2V5ZN81-F1-model_v4 HTH gntR-type domain-containing protein 0.9765 1 86 GO:0003677
GO:0003700
AF-A0A2V6G3V2-F1-model_v4 GntR family transcriptional regulator 0.9743 1 91 GO:0003677
GO:0003700

Map