F407889

General Info

Members Datasets Scaffolds Average Seq Length
325 216 650 319

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10036060|Ga0265338_100360604
Length 381
Sequence MESADLCMEMLLSAARLDRMKRELFHKKRGNAMATDYIPVHLDGVSHRYIETNSLRIHLAEQGTGPLLLLCHGFPELWYSWRKQISVLAEAGYHVVALDMRGYGQTDQPAEQEAYTLLHLVGDLVGVLEALGESQATLIGHDWGSNVCWQAALMRPDLFPVLVTMSAPYIPRRSLQGGKGTLRPTQSWQQRFKGQFFYQLYFQESGVAEVALERDVATTMRRFLCGASGDASASERWHPVLSQQTDDPLAHVELPASLPSWLTEIDLAYYSQEFSRTGFTGGLNWYRNTDRNWELLAAYSNARITQPTLFLCGGRDPVFELVGPDTWIEQMRLWVPAIQTKVLPDCGHWIQQERAEEVNAALLTFLQEQTKARDVHAERQE

Samples

Sample ID Description Type Environment
1 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
9 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
39 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
69 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
107 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
108 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
109 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
110 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
111 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
112 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
113 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
114 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
115 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
116 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
117 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
118 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
119 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
120 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
121 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
122 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
123 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
124 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
125 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
126 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
127 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
128 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
129 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
130 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
131 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
132 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
133 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
134 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
135 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
136 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
137 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
138 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
139 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
140 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
141 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
142 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
143 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
144 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
145 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
146 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
147 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
148 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
149 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
150 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
151 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
152 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
153 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
154 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
155 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
156 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
157 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
158 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
159 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
160 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
161 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
162 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
163 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
164 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
165 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
166 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
167 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
168 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
169 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
170 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
171 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
172 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
173 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
182 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
183 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
184 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
185 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
186 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
187 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
188 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
189 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
191 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
192 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
193 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
194 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
195 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
196 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
197 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
198 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
199 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
200 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
201 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
202 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
203 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
204 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
205 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
206 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
207 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
208 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
209 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
210 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
211 2922554459 Rhodococcus sp. 66b Isolate Unclassified
212 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
213 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
214 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
215 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
216 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.46
Metatranscriptomes 0.92
Isolates 4.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.85
Nodule 0.92
Rhizoplane 8
Rhizosphere 83.08
Stem 0
Stem Tuber 0
Unclassified 1.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265338_10036060 3300028800 Bacteria 4741
2 SwRhRL2b_contig_2959121 2162886007 Bacteria 2202
3 Ga0065704_10083057 3300005289 Bacteria 3514
4 Ga0065707_10091841 3300005295 Bacteria 3871
5 Ga0068868_100064264 3300005338 Bacteria 2913
6 Ga0070669_100107186 3300005353 Bacteria 2116
7 Ga0070671_100018961 3300005355 Bacteria 5594
8 Ga0070674_100195472 3300005356 Bacteria 1558
9 Ga0070673_100242130 3300005364 Bacteria 1569
10 Ga0070659_100086578 3300005366 Bacteria 2507
11 Ga0070709_10045911 3300005434 Bacteria 2714
12 Ga0070709_10092856 3300005434 Bacteria 1994
13 Ga0070709_10160008 3300005434 Bacteria 1565
14 Ga0070709_10225047 3300005434 Bacteria 1339
15 Ga0070714_100011789 3300005435 Bacteria 6947
16 Ga0070714_100082377 3300005435 Bacteria 2803
17 Ga0070714_100448071 3300005435 Bacteria 1226
18 Ga0070713_100013018 3300005436 Bacteria 6125
19 Ga0070713_100036926 3300005436 Bacteria 3947
20 Ga0070713_100074968 3300005436 Unclassified 2868
21 Ga0070710_10043921 3300005437 Bacteria 2477
22 Ga0070710_10051099 3300005437 Bacteria 2320
23 Ga0070710_10114924 3300005437 Bacteria 1622
24 Ga0070701_10076526 3300005438 Bacteria 1802
25 Ga0070711_100021736 3300005439 Bacteria 4152
26 Ga0070711_100155536 3300005439 Bacteria 1728
27 Ga0070711_100182521 3300005439 Bacteria 1607
28 Ga0070708_100160855 3300005445 Bacteria 2092
29 Ga0070663_100017433 3300005455 Bacteria 4687
30 Ga0070681_10000330 3300005458 Bacteria 38500
31 Ga0070681_10047316 3300005458 Bacteria 4299
32 Ga0070685_10074965 3300005466 Bacteria 2014
33 Ga0070706_100264137 3300005467 Bacteria 1606
34 Ga0070707_100054475 3300005468 Bacteria 3835
35 Ga0070707_100190243 3300005468 Bacteria 2001
36 Ga0070698_100027291 3300005471 Bacteria 5940
37 Ga0070699_100151618 3300005518 Bacteria 2050
38 Ga0070699_100152001 3300005518 Bacteria 2048
39 Ga0070699_100165298 3300005518 Bacteria 1960
40 Ga0070679_100003766 3300005530 Bacteria 13912
41 Ga0070697_100082570 3300005536 Bacteria 2649
42 Ga0070686_100033915 3300005544 Bacteria 3140
43 Ga0068855_100260981 3300005563 Bacteria 1930
44 Ga0070664_100166098 3300005564 Bacteria 1956
45 Ga0068854_100050782 3300005578 Bacteria 2969
46 Ga0068854_100233761 3300005578 Bacteria 1460
47 Ga0068856_100027071 3300005614 Bacteria 5593
48 Ga0068856_100249403 3300005614 Bacteria 1790
49 Ga0068856_100402889 3300005614 Bacteria 1388
50 Ga0070702_100008021 3300005615 Bacteria 5093
51 Ga0068852_100080478 3300005616 Bacteria 2888
52 Ga0068859_100092627 3300005617 Bacteria 3073
53 Ga0068859_100139732 3300005617 Bacteria 2496
54 Ga0068870_10141123 3300005840 Bacteria 1410
55 Ga0068858_100000071 3300005842 Bacteria 105192
56 Ga0068858_100033628 3300005842 Bacteria 4756
57 Ga0068858_100232830 3300005842 Bacteria 1746
58 Ga0081455_10058831 3300005937 Bacteria 3249
59 Ga0081538_10000610 3300005981 Bacteria 39608
60 Ga0081538_10001281 3300005981 Bacteria 26128
61 Ga0070717_10012179 3300006028 Bacteria 6557
62 Ga0075365_10111320 3300006038 Bacteria 1882
63 Ga0075363_100158541 3300006048 Bacteria 1280
64 Ga0075364_10084035 3300006051 Bacteria 2107
65 Ga0070716_100052624 3300006173 Bacteria 2318
66 Ga0070712_100044357 3300006175 Bacteria 3066
67 Ga0070712_100070321 3300006175 Bacteria 2500
68 Ga0070712_100091549 3300006175 Bacteria 2228
69 Ga0070712_100164961 3300006175 Bacteria 1714
70 Ga0070712_100189878 3300006175 Bacteria 1607
71 Ga0075370_10166898 3300006353 Bacteria 1293
72 Ga0075428_100000658 3300006844 Bacteria 35511
73 Ga0075428_100001862 3300006844 Bacteria 22599
74 Ga0075428_100156565 3300006844 Bacteria 2475
75 Ga0075428_100310757 3300006844 Bacteria 1694
76 Ga0075430_100000408 3300006846 Bacteria 31936
77 Ga0075430_100004221 3300006846 Bacteria 12126
78 Ga0075430_100102759 3300006846 Bacteria 2386
79 Ga0075431_100000386 3300006847 Bacteria 35302
80 Ga0075431_100106874 3300006847 Bacteria 2887
81 Ga0075434_100154448 3300006871 Bacteria 2315
82 Ga0075429_100000115 3300006880 Bacteria 46097
83 Ga0075429_100121869 3300006880 Bacteria 2279
84 Ga0075436_100114181 3300006914 Bacteria 1886
85 Ga0097620_100092629 3300006931 Bacteria 3073
86 Ga0097620_100139725 3300006931 Bacteria 2496
87 Ga0105240_10240771 3300009093 Bacteria 2097
88 Ga0105240_10268133 3300009093 Bacteria 1967
89 Ga0111539_10024211 3300009094 Bacteria 7455
90 Ga0111539_10040928 3300009094 Bacteria 5575
91 Ga0111539_10101196 3300009094 Bacteria 3383
92 Ga0105245_10127059 3300009098 Bacteria 2388
93 Ga0105245_10265621 3300009098 Bacteria 1671
94 Ga0114129_10000014 3300009147 Bacteria 130267
95 Ga0114129_10018758 3300009147 Bacteria 9854
96 Ga0105243_10025004 3300009148 Bacteria 4560
97 Ga0105241_10131572 3300009174 Bacteria 2026
98 Ga0105248_10000450 3300009177 Bacteria 46809
99 Ga0105248_10083125 3300009177 Bacteria 3602
100 Ga0105248_10250348 3300009177 Unclassified 1994
101 Ga0105237_10000570 3300009545 Bacteria 51568
102 Ga0105237_10259146 3300009545 Bacteria 1741
103 Ga0105237_10443138 3300009545 Bacteria 1304
104 Ga0105238_10000418 3300009551 Bacteria 44883
105 Ga0105238_10375194 3300009551 Bacteria 1413
106 Ga0105238_10517773 3300009551 Bacteria 1195
107 Ga0105249_10163615 3300009553 Bacteria 2152
108 Ga0105148_100436 3300009978 Bacteria 4105
109 Ga0105239_10043301 3300010375 Bacteria 4934
110 Ga0105239_10233536 3300010375 Bacteria 2064
111 Ga0105239_10301296 3300010375 Bacteria 1805
112 Ga0157369_10100334 3300013105 Bacteria 3086
113 Ga0157374_10086892 3300013296 Bacteria 2976
114 Ga0157374_10421429 3300013296 Bacteria 1334
115 Ga0163162_10019124 3300013306 Bacteria 6718
116 Ga0157375_10033766 3300013308 Bacteria 4866
117 Ga0163163_10046784 3300014325 Bacteria 4250
118 Ga0157379_10000015 3300014968 Bacteria 104289
119 Ga0157379_10153577 3300014968 Bacteria 2076
120 Ga0157376_10015219 3300014969 Bacteria 5803
121 Ga0206356_10864726 3300020070 Bacteria 1714
122 Ga0206353_11120836 3300020082 Bacteria 19200
123 Ga0224712_10028298 3300022467 Bacteria 2002
124 Ga0207692_10019330 3300025898 Bacteria 3076
125 Ga0207692_10121288 3300025898 Bacteria 1464
126 Ga0207642_10035281 3300025899 Bacteria 2135
127 Ga0207688_10031000 3300025901 Bacteria 2950
128 Ga0207699_10151945 3300025906 Unclassified 1533
129 Ga0207643_10066476 3300025908 Bacteria 2067
130 Ga0207705_10111325 3300025909 Bacteria 2023
131 Ga0207707_10004520 3300025912 Bacteria 12228
132 Ga0207707_10280307 3300025912 Bacteria 1444
133 Ga0207671_10017346 3300025914 Bacteria 5554
134 Ga0207693_10063188 3300025915 Bacteria 2901
135 Ga0207693_10112563 3300025915 Bacteria 2135
136 Ga0207693_10141389 3300025915 Bacteria 1892
137 Ga0207660_10001512 3300025917 Bacteria 15658
138 Ga0207662_10039003 3300025918 Bacteria 2785
139 Ga0207652_10001414 3300025921 Bacteria 21291
140 Ga0207646_10047304 3300025922 Bacteria 3858
141 Ga0207681_10032414 3300025923 Bacteria 3421
142 Ga0207694_10000233 3300025924 Bacteria 53570
143 Ga0207694_10140661 3300025924 Bacteria 1941
144 Ga0207694_10318899 3300025924 Bacteria 1282
145 Ga0207687_10206205 3300025927 Bacteria 1539
146 Ga0207700_10105983 3300025928 Bacteria 2252
147 Ga0207700_10290927 3300025928 Bacteria 1408
148 Ga0207664_10067025 3300025929 Unclassified 2879
149 Ga0207711_10001827 3300025941 Bacteria 19417
150 Ga0207667_10355011 3300025949 Bacteria 1495
151 Ga0207703_10000094 3300026035 Bacteria 104297
152 Ga0207639_10035773 3300026041 Bacteria 3676
153 Ga0207678_10000340 3300026067 Bacteria 42133
154 Ga0207708_10026027 3300026075 Bacteria 4426
155 Ga0207702_10442495 3300026078 Bacteria 1260
156 Ga0207641_10135666 3300026088 Bacteria 2215
157 Ga0207676_10052579 3300026095 Bacteria 3185
158 Ga0207675_100035658 3300026118 Bacteria 4640
159 Ga0207675_100224133 3300026118 Bacteria 1812
160 Ga0207428_10089297 3300027907 Bacteria 2395
161 Ga0268266_10018940 3300028379 Bacteria 5864
162 Ga0268266_10211367 3300028379 Bacteria 1779
163 Ga0268265_10313383 3300028380 Unclassified 1418
164 Ga0265320_10025228 3300031240 Bacteria 3129
165 Ga0307513_10047859 3300031456 Bacteria 4647
166 Ga0316576_10223153 3300031727 Bacteria 1417
167 Ga0316577_10006916 3300031733 Bacteria 6027
168 Ga0307411_10041976 3300032005 Bacteria 2915
169 Ga0307507_10057869 3300033179 Bacteria 3645
170 Ga0373926_0022991 3300035083 Bacteria 2163
171 Ga0373954_0102149 3300035118 Bacteria 1384
172 Ga0316574_0176305 3300035398 Bacteria 1376
173 Ga0373927_0001671 3300035695 Bacteria 16580
174 Ga0373927_0011698 3300035695 Bacteria 5840
175 Ga0316582_0245185 3300036647 Bacteria 1228
176 Ga0316584_0180187 3300036712 Bacteria 1564
177 Ga0395899_0083752 3300037312 Bacteria 2319
178 Ga0395899_0185690 3300037312 Bacteria 1457
179 Ga0395905_0219642 3300037471 Bacteria 1779
180 Ga0436364_0558998 3300037853 Bacteria 2985
181 Ga0395901_0344811 3300038443 Bacteria 1538
182 Ga0436365_1792462 3300039437 Bacteria 4364
183 Ga0436365_1875952 3300039437 Bacteria 53998
184 Ga0436362_1053631 3300039453 Unclassified 1523
185 Ga0436362_1173420 3300039453 Bacteria 6036
186 Ga0466973_0088869 3300044659 Bacteria 2670
187 Ga0466966_0010293 3300044684 Bacteria 6206
188 Ga0466966_0012026 3300044684 Bacteria 5736
189 Ga0466966_0038262 3300044684 Bacteria 3092
190 Ga0466961_0001952 3300044693 Bacteria 12852
191 Ga0466968_0011440 3300044735 Bacteria 3456
192 Ga0466970_0006519 3300044765 Bacteria 5833
193 Ga0466970_0086590 3300044765 Bacteria 1698
194 Ga0466959_0007508 3300045049 Bacteria 7656
195 Ga0466959_0108192 3300045049 Bacteria 1986
196 Ga0466959_0118318 3300045049 Bacteria 1886
197 Ga0466958_0000642 3300045836 Bacteria 15039
198 Ga0466967_0037162 3300045976 Bacteria 4164
199 Ga0466967_0175737 3300045976 Bacteria 2017
200 Ga0466967_0492986 3300045976 Bacteria 1201
201 Ga0495592_0032233 3300046454 Bacteria 3955
202 Ga0495651_0007029 3300046462 Bacteria 8611
203 Ga0495653_0112912 3300046463 Bacteria 1949
204 Ga0495580_0013133 3300046472 Bacteria 6340
205 Ga0495582_0191783 3300046473 Bacteria 1166
206 Ga0495608_0044534 3300046511 Bacteria 2961
207 Ga0495652_0050250 3300046529 Bacteria 3565
208 Ga0495665_0054416 3300046531 Bacteria 2114
209 Ga0495665_0099986 3300046531 Bacteria 1522
210 Ga0495640_0062036 3300046533 Bacteria 2537
211 Ga0495587_0069808 3300046536 Bacteria 2045
212 Ga0495645_0042041 3300046543 Bacteria 3332
213 Ga0495667_0040539 3300046559 Bacteria 3091
214 Ga0495656_0066763 3300046615 Bacteria 1586
215 Ga0495668_0000649 3300046616 Bacteria 41701
216 Ga0495599_0017289 3300046678 Bacteria 4483
217 Ga0495658_0066305 3300046683 Bacteria 2085
218 Ga0495600_0256767 3300046809 Bacteria 1111
219 Ga0495604_0020816 3300047317 Bacteria 5236
220 Ga0495674_0109621 3300047319 Bacteria 2341
221 Ga0495674_0160129 3300047319 Bacteria 1884
222 Ga0495680_0016757 3300047322 Bacteria 6282
223 Ga0495675_0094440 3300047444 Bacteria 1875
224 Ga0495684_0034816 3300047471 Bacteria 3864
225 Ga0495684_0052321 3300047471 Bacteria 3116
226 Ga0495684_0086414 3300047471 Bacteria 2377
227 Ga0496100_0001874 3300048903 Bacteria 10543
228 Ga0496102_0015484 3300048905 Bacteria 6644
229 Ga0496102_0036495 3300048905 Bacteria 4428
230 Ga0496102_0183767 3300048905 Bacteria 1970
231 Ga0496103_0017883 3300048906 Bacteria 4248
232 Ga0496104_0014623 3300048907 Bacteria 7090
233 Ga0496104_0019506 3300048907 Bacteria 6206
234 Ga0496105_0062440 3300048908 Bacteria 3074
235 Ga0496106_0218791 3300048909 Bacteria 1518
236 Ga0496108_0011196 3300048911 Bacteria 7289
237 Ga0496108_0018300 3300048911 Bacteria 5737
238 Ga0496108_0059695 3300048911 Bacteria 3207
239 Ga0496108_0107781 3300048911 Bacteria 2379
240 Ga0496109_0008534 3300048912 Bacteria 8714
241 Ga0496109_0095754 3300048912 Bacteria 2749
242 Ga0496110_0032014 3300048913 Bacteria 4539
243 Ga0496110_0193550 3300048913 Bacteria 1846
244 Ga0496111_0028053 3300048914 Bacteria 3988
245 Ga0496111_0149075 3300048914 Bacteria 1735
246 Ga0496112_0093278 3300048915 Bacteria 2981
247 Ga0496113_0024423 3300048916 Bacteria 4296
248 Ga0496113_0025423 3300048916 Bacteria 4220
249 Ga0496115_0000051 3300048918 Bacteria 107411
250 Ga0496115_0000249 3300048918 Bacteria 48011
251 Ga0496115_0210818 3300048918 Bacteria 1605
252 Ga0496115_0294062 3300048918 Bacteria 1331
253 Ga0496117_0015750 3300048920 Bacteria 6421
254 Ga0496118_0000160 3300048921 Bacteria 120349
255 Ga0496118_0026616 3300048921 Bacteria 4921
256 Ga0496122_0112742 3300048925 Bacteria 1780
257 Ga0496125_0043414 3300048928 Bacteria 3816
258 Ga0496125_0124265 3300048928 Bacteria 1832
259 Ga0496126_0001013 3300048929 Bacteria 47866
260 Ga0501290_015286 3300049513 Bacteria 1015
261 Ga0501032_0002631 3300049569 Bacteria 14022
262 Ga0501032_0005718 3300049569 Bacteria 9206
263 Ga0501032_0024697 3300049569 Bacteria 4147
264 Ga0501034_0002040 3300049571 Bacteria 25367
265 Ga0501034_0029412 3300049571 Bacteria 5583
266 Ga0501036_0039641 3300049572 Bacteria 3986
267 Ga0501037_0079036 3300049573 Bacteria 2387
268 Ga0501043_0024881 3300049579 Bacteria 4697
269 Ga0501046_0010749 3300049580 Bacteria 7850
270 Ga0501047_0000699 3300049581 Bacteria 34953
271 Ga0501047_0004486 3300049581 Bacteria 13134
272 Ga0501047_0104860 3300049581 Bacteria 2707
273 Ga0501048_0051425 3300049582 Bacteria 2933
274 Ga0501048_0071866 3300049582 Bacteria 2442
275 Ga0501069_0000025 3300049585 Bacteria 109731
276 Ga0501070_0000026 3300049586 Bacteria 150349
277 Ga0501070_0000535 3300049586 Bacteria 34837
278 Ga0501071_0025554 3300049587 Bacteria 4138
279 Ga0501073_0080743 3300049589 Bacteria 2262
280 Ga0501211_001496 3300049658 Bacteria 2502
281 Ga0501235_002116 3300049669 Bacteria 4269
282 Ga0501225_0013222 3300049705 Bacteria 2313
283 Ga0501080_0000610 3300049742 Bacteria 28306
284 Ga0501035_0002056 3300049822 Bacteria 20044
285 Ga0501035_0004606 3300049822 Bacteria 13077
286 Ga0501044_0000388 3300049823 Bacteria 54487
287 Ga0501044_0001846 3300049823 Bacteria 24638
288 Ga0501044_0053740 3300049823 Bacteria 4143
289 nmdc:mga07m45_158184_c1 3300050496 Bacteria 1315
290 nmdc:mga05p37_253987_c1 3300050507 Bacteria 2107
291 nmdc:mga05p37_554_c1 3300050507 Bacteria 41106
292 nmdc:mga05p37_669797_c1 3300050507 Bacteria 1158
293 nmdc:mga05p37_87615_c1 3300050507 Bacteria 3837
294 nmdc:mga09592_1950_c1 3300050508 Bacteria 16610
295 nmdc:mga09592_5542_c1 3300050508 Bacteria 10273
296 nmdc:mga0qj67_100705_c1 3300050509 Bacteria 2329
297 nmdc:mga0qj67_25897_c1 3300050509 Bacteria 4537
298 nmdc:mga0qj67_26113_c1 3300050509 Bacteria 4521
299 nmdc:mga06r32_1339_c1 3300050510 Bacteria 22226
300 nmdc:mga06r32_267378_c1 3300050510 Bacteria 1697
301 nmdc:mga06r32_4036_c1 3300050510 Bacteria 13163
302 nmdc:mga06r32_42521_c1 3300050510 Bacteria 4321
303 nmdc:mga08y16_34831_c1 3300050511 Bacteria 5290
304 nmdc:mga0n895_245440_c1 3300050512 Bacteria 1817
305 nmdc:mga0rr50_187125_c1 3300050513 Bacteria 1695
306 nmdc:mga0rr50_318729_c1 3300050513 Bacteria 1303
307 Ga0495601_0026285 3300053077 Bacteria 3593
308 Ga0495601_0131688 3300053077 Bacteria 1629
309 Ga0495619_0107753 3300053085 Bacteria 1901
310 Ga0500595_007121 3300053119 Bacteria 4674
311 2566992969 2565956761 Bacteria 6601618
312 2694634088 2693429783 Bacteria 7019804
313 2694638411 2693429784 Bacteria 7241525
314 2738891807 2738541308 Bacteria 7020677
315 2739205915 2738543005 Bacteria 5278128
316 2791923942 2791354903 Bacteria 4937680
317 2842136441 2842134933 Bacteria 5847019
318 2876385233 2876377896 Bacteria 6565995
319 2904536453 2904535858 Bacteria 6308016
320 2922558389 2922554459 Bacteria 6683962
321 2928143660 2928142448 Bacteria 5288925
322 2929218157 2929212328 Bacteria 7708288
323 2938017375 2938014810 Bacteria 6700592
324 2939746998 2939743619 Bacteria 5762299
325 8057104864 8057101203 Bacteria 5034064
326 Ga0265338_10036060
327 SwRhRL2b_contig_2959121
328 Ga0065704_10083057
329 Ga0065707_10091841
330 Ga0068868_100064264
331 Ga0070669_100107186
332 Ga0070671_100018961
333 Ga0070674_100195472
334 Ga0070673_100242130
335 Ga0070659_100086578
336 Ga0070709_10045911
337 Ga0070709_10092856
338 Ga0070709_10160008
339 Ga0070709_10225047
340 Ga0070714_100011789
341 Ga0070714_100082377
342 Ga0070714_100448071
343 Ga0070713_100013018
344 Ga0070713_100036926
345 Ga0070713_100074968
346 Ga0070710_10043921
347 Ga0070710_10051099
348 Ga0070710_10114924
349 Ga0070701_10076526
350 Ga0070711_100021736
351 Ga0070711_100155536
352 Ga0070711_100182521
353 Ga0070708_100160855
354 Ga0070663_100017433
355 Ga0070681_10000330
356 Ga0070681_10047316
357 Ga0070685_10074965
358 Ga0070706_100264137
359 Ga0070707_100054475
360 Ga0070707_100190243
361 Ga0070698_100027291
362 Ga0070699_100151618
363 Ga0070699_100152001
364 Ga0070699_100165298
365 Ga0070679_100003766
366 Ga0070697_100082570
367 Ga0070686_100033915
368 Ga0068855_100260981
369 Ga0070664_100166098
370 Ga0068854_100050782
371 Ga0068854_100233761
372 Ga0068856_100027071
373 Ga0068856_100249403
374 Ga0068856_100402889
375 Ga0070702_100008021
376 Ga0068852_100080478
377 Ga0068859_100092627
378 Ga0068859_100139732
379 Ga0068870_10141123
380 Ga0068858_100000071
381 Ga0068858_100033628
382 Ga0068858_100232830
383 Ga0081455_10058831
384 Ga0081538_10000610
385 Ga0081538_10001281
386 Ga0070717_10012179
387 Ga0075365_10111320
388 Ga0075363_100158541
389 Ga0075364_10084035
390 Ga0070716_100052624
391 Ga0070712_100044357
392 Ga0070712_100070321
393 Ga0070712_100091549
394 Ga0070712_100164961
395 Ga0070712_100189878
396 Ga0075370_10166898
397 Ga0075428_100000658
398 Ga0075428_100001862
399 Ga0075428_100156565
400 Ga0075428_100310757
401 Ga0075430_100000408
402 Ga0075430_100004221
403 Ga0075430_100102759
404 Ga0075431_100000386
405 Ga0075431_100106874
406 Ga0075434_100154448
407 Ga0075429_100000115
408 Ga0075429_100121869
409 Ga0075436_100114181
410 Ga0097620_100092629
411 Ga0097620_100139725
412 Ga0105240_10240771
413 Ga0105240_10268133
414 Ga0111539_10024211
415 Ga0111539_10040928
416 Ga0111539_10101196
417 Ga0105245_10127059
418 Ga0105245_10265621
419 Ga0114129_10000014
420 Ga0114129_10018758
421 Ga0105243_10025004
422 Ga0105241_10131572
423 Ga0105248_10000450
424 Ga0105248_10083125
425 Ga0105248_10250348
426 Ga0105237_10000570
427 Ga0105237_10259146
428 Ga0105237_10443138
429 Ga0105238_10000418
430 Ga0105238_10375194
431 Ga0105238_10517773
432 Ga0105249_10163615
433 Ga0105148_100436
434 Ga0105239_10043301
435 Ga0105239_10233536
436 Ga0105239_10301296
437 Ga0157369_10100334
438 Ga0157374_10086892
439 Ga0157374_10421429
440 Ga0163162_10019124
441 Ga0157375_10033766
442 Ga0163163_10046784
443 Ga0157379_10000015
444 Ga0157379_10153577
445 Ga0157376_10015219
446 Ga0206356_10864726
447 Ga0206353_11120836
448 Ga0224712_10028298
449 Ga0207692_10019330
450 Ga0207692_10121288
451 Ga0207642_10035281
452 Ga0207688_10031000
453 Ga0207699_10151945
454 Ga0207643_10066476
455 Ga0207705_10111325
456 Ga0207707_10004520
457 Ga0207707_10280307
458 Ga0207671_10017346
459 Ga0207693_10063188
460 Ga0207693_10112563
461 Ga0207693_10141389
462 Ga0207660_10001512
463 Ga0207662_10039003
464 Ga0207652_10001414
465 Ga0207646_10047304
466 Ga0207681_10032414
467 Ga0207694_10000233
468 Ga0207694_10140661
469 Ga0207694_10318899
470 Ga0207687_10206205
471 Ga0207700_10105983
472 Ga0207700_10290927
473 Ga0207664_10067025
474 Ga0207711_10001827
475 Ga0207667_10355011
476 Ga0207703_10000094
477 Ga0207639_10035773
478 Ga0207678_10000340
479 Ga0207708_10026027
480 Ga0207702_10442495
481 Ga0207641_10135666
482 Ga0207676_10052579
483 Ga0207675_100035658
484 Ga0207675_100224133
485 Ga0207428_10089297
486 Ga0268266_10018940
487 Ga0268266_10211367
488 Ga0268265_10313383
489 Ga0265320_10025228
490 Ga0307513_10047859
491 Ga0316576_10223153
492 Ga0316577_10006916
493 Ga0307411_10041976
494 Ga0307507_10057869
495 Ga0373926_0022991
496 Ga0373954_0102149
497 Ga0316574_0176305
498 Ga0373927_0001671
499 Ga0373927_0011698
500 Ga0316582_0245185
501 Ga0316584_0180187
502 Ga0395899_0083752
503 Ga0395899_0185690
504 Ga0395905_0219642
505 Ga0436364_0558998
506 Ga0395901_0344811
507 Ga0436365_1792462
508 Ga0436365_1875952
509 Ga0436362_1053631
510 Ga0436362_1173420
511 Ga0466973_0088869
512 Ga0466966_0010293
513 Ga0466966_0012026
514 Ga0466966_0038262
515 Ga0466961_0001952
516 Ga0466968_0011440
517 Ga0466970_0006519
518 Ga0466970_0086590
519 Ga0466959_0007508
520 Ga0466959_0108192
521 Ga0466959_0118318
522 Ga0466958_0000642
523 Ga0466967_0037162
524 Ga0466967_0175737
525 Ga0466967_0492986
526 Ga0495592_0032233
527 Ga0495651_0007029
528 Ga0495653_0112912
529 Ga0495580_0013133
530 Ga0495582_0191783
531 Ga0495608_0044534
532 Ga0495652_0050250
533 Ga0495665_0054416
534 Ga0495665_0099986
535 Ga0495640_0062036
536 Ga0495587_0069808
537 Ga0495645_0042041
538 Ga0495667_0040539
539 Ga0495656_0066763
540 Ga0495668_0000649
541 Ga0495599_0017289
542 Ga0495658_0066305
543 Ga0495600_0256767
544 Ga0495604_0020816
545 Ga0495674_0109621
546 Ga0495674_0160129
547 Ga0495680_0016757
548 Ga0495675_0094440
549 Ga0495684_0034816
550 Ga0495684_0052321
551 Ga0495684_0086414
552 Ga0496100_0001874
553 Ga0496102_0015484
554 Ga0496102_0036495
555 Ga0496102_0183767
556 Ga0496103_0017883
557 Ga0496104_0014623
558 Ga0496104_0019506
559 Ga0496105_0062440
560 Ga0496106_0218791
561 Ga0496108_0011196
562 Ga0496108_0018300
563 Ga0496108_0059695
564 Ga0496108_0107781
565 Ga0496109_0008534
566 Ga0496109_0095754
567 Ga0496110_0032014
568 Ga0496110_0193550
569 Ga0496111_0028053
570 Ga0496111_0149075
571 Ga0496112_0093278
572 Ga0496113_0024423
573 Ga0496113_0025423
574 Ga0496115_0000051
575 Ga0496115_0000249
576 Ga0496115_0210818
577 Ga0496115_0294062
578 Ga0496117_0015750
579 Ga0496118_0000160
580 Ga0496118_0026616
581 Ga0496122_0112742
582 Ga0496125_0043414
583 Ga0496125_0124265
584 Ga0496126_0001013
585 Ga0501290_015286
586 Ga0501032_0002631
587 Ga0501032_0005718
588 Ga0501032_0024697
589 Ga0501034_0002040
590 Ga0501034_0029412
591 Ga0501036_0039641
592 Ga0501037_0079036
593 Ga0501043_0024881
594 Ga0501046_0010749
595 Ga0501047_0000699
596 Ga0501047_0004486
597 Ga0501047_0104860
598 Ga0501048_0051425
599 Ga0501048_0071866
600 Ga0501069_0000025
601 Ga0501070_0000026
602 Ga0501070_0000535
603 Ga0501071_0025554
604 Ga0501073_0080743
605 Ga0501211_001496
606 Ga0501235_002116
607 Ga0501225_0013222
608 Ga0501080_0000610
609 Ga0501035_0002056
610 Ga0501035_0004606
611 Ga0501044_0000388
612 Ga0501044_0001846
613 Ga0501044_0053740
614 nmdc:mga07m45_158184_c1
615 nmdc:mga05p37_253987_c1
616 nmdc:mga05p37_554_c1
617 nmdc:mga05p37_669797_c1
618 nmdc:mga05p37_87615_c1
619 nmdc:mga09592_1950_c1
620 nmdc:mga09592_5542_c1
621 nmdc:mga0qj67_100705_c1
622 nmdc:mga0qj67_25897_c1
623 nmdc:mga0qj67_26113_c1
624 nmdc:mga06r32_1339_c1
625 nmdc:mga06r32_267378_c1
626 nmdc:mga06r32_4036_c1
627 nmdc:mga06r32_42521_c1
628 nmdc:mga08y16_34831_c1
629 nmdc:mga0n895_245440_c1
630 nmdc:mga0rr50_187125_c1
631 nmdc:mga0rr50_318729_c1
632 Ga0495601_0026285
633 Ga0495601_0131688
634 Ga0495619_0107753
635 Ga0500595_007121
636 2566992969
637 2694634088
638 2694638411
639 2738891807
640 2739205915
641 2791923942
642 2842136441
643 2876385233
644 2904536453
645 2922558389
646 2928143660
647 2929218157
648 2938017375
649 2939746998
650 8057104864

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12146

Hydrolase_4

Serine aminopeptidase, S33

64

265

0.85

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

66

355

0.77

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

68

361

0.54

Structural Annotation

Top 5 Hits

ID Description Score Start End
6unw-assembly1.cif.gz_A epoxide hydrolase from an endophytic streptomyces 0.9395 2 309
5cw2-assembly4.cif.gz_D crystal structure of epoxide hydrolase a from mycobacterium thermoresistibile 0.931 3 305
6unw-assembly1.cif.gz_A epoxide hydrolase from an endophytic streptomyces 0.9191 2 309
2e3j-assembly1.cif.gz_A the crystal structure of epoxide hydrolase b (rv1938) from mycobacterium tuberculosis at 2.1 angstrom 0.9148 2 305
7p4k-assembly1.cif.gz_A soluble epoxide hydrolase in complex with fl217 0.9104 2 305
ID Description Score Start End Superfamily
af_A0A0R0KMM0_1_93_3.40.50.12270 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9854 2 77 3.40.50.12270
5cw2A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.935 3 304 3.40.50.1820
2zjfA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9187 2 305 3.40.50.1820
af_B6SUW2_10_323_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9139 2 306 3.40.50.1820
2zjfA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8933 2 305 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A7W4W3W8-F1-model_v4 Pimeloyl-ACP methyl ester carboxylesterase 0.9886 2 307 GO:0003824
AF-A0A7Y1ZKB4-F1-model_v4 Alpha/beta fold hydrolase 0.9877 20 310 GO:0016787
AF-A0A6P1DC47-F1-model_v4 Alpha/beta hydrolase 0.986 2 308 GO:0016787
AF-A0A1G8AHT3-F1-model_v4 Pimeloyl-ACP methyl ester carboxylesterase 0.9851 2 309 GO:0003824
AF-A0A841P685-F1-model_v4 deleted 0.9834 2 311

Map