F407737

General Info

Members Datasets Scaffolds Average Seq Length
325 211 285 544

Family's Representative Sequence

Representative Sequence 3300005841|Ga0068863_100055337|Ga0068863_1000553372
Length 587
Sequence MKGLSPLDIVIFVIYFILVAGYGYWVYSKKKKAAISASHDYFLAEGSLTWWAIGASLIASNISAEQFIGMSGNGYFVGVSVAAYEWIAALALIIIAVWFMPVYLKNKIYTMPQFLKTRYNETVSLIMAIFWLLLYVFVNLTSILYLGAIAISGLIGPEYLHTVLIALAIFSLIITLGGMKVIGYTDVIQVAVLIIGGFATIYFALTIVSKEFGLGSDAIAGFKMLMTQAPDHFHMILQKPVAGVTSQEDVNKYLILPGIAMYFAGQWIVNLNYWGCNQYITQRALGADLQTARKGILFAGFLKLLMPIIVMLPGIAAYVLHKNGSLTGLRGMDDAYSAILGFLPSGLKGLAIAALTAXXXXSLAGKLNSIGTIFTLDIYLKYFRKKKSPADGTNADVLTTVEKEAHREGEEKNMVWVGRMAALCAIIIAVLFEWKDLLGINAKGGFTFIQEYTGFISPGVFAMFILGMFWKRTTGTAAVAGLVTGLAMSVFFKNFAVPLLGHETILYTAFQTLNDKGELVWQIPFLINMGWAFFFTMVVMIGISLGGPKINPKAFMLDKEMFKVKPSVIAMIVTTLLILVALYVKFW

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231000 Chryseobacterium populi CF314 Isolate Rhizosphere
3 2582581281 Chryseobacterium sp. CF284 Isolate Rhizosphere
4 2582581282 Chryseobacterium sp. CF299 Isolate Rhizosphere
5 2585428187 Chryseobacterium sp. YR460 Isolate Rhizosphere
6 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
7 2738541279 Flavobacterium sp. GV069 Isolate Unclassified
8 2738541285 Flavobacterium sp. GV030 Isolate Unclassified
9 2738543007 Flavobacterium sp. GV063 Isolate Unclassified
10 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
11 2816332188 Chryseobacterium aquifrigidense 110 (version 2) Isolate Unclassified
12 2818991457 Xanthomonas translucens 569 Isolate Unclassified
13 2818991460 Chitinophaga polysaccharea 1209 Isolate Unclassified
14 2821136567 Chitinophaga sancti 1232 Isolate Unclassified
15 2842903701 Olivibacter sp. R-72191 Isolate Unclassified
16 2884791551 Chitinophaga oryzae 1310 Isolate Unclassified
17 2889290771 Chryseobacterium sp. PvR013 Isolate Rhizosphere
18 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
19 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
20 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
21 2914759650 Rhizosphaericola mali Isolate Rhizosphere
22 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
23 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
24 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
25 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
26 2929177148 Chitinophaga sp. R-72269 Hybrid assembly Isolate Unclassified
27 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
28 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
29 2945977869 Chitinophaga sp. W2I13 Isolate Rhizosphere
30 2946013367 Chitinophaga sp. W3I9 Isolate Rhizosphere
31 2958512119 Flavobacterium sp. Sd200 Isolate Rhizosphere
32 2965320100 Flavobacterium agri MAH-1 Isolate Rhizosphere
33 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
34 2993372514 Chryseobacterium sp. SLBN-27 Isolate Rhizosphere
35 3003233435 Sphingobacterium shayense CrR18 Isolate Unclassified
36 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
37 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
38 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
39 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
40 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
41 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
42 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
43 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
44 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
45 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
46 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
47 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
48 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
49 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
50 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
51 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
52 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
53 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
54 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
55 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
56 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
57 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
58 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
59 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
72 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
73 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
79 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
106 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
107 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
108 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
109 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
110 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
112 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
142 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
143 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
144 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
145 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
146 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
147 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
148 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
149 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
150 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
153 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
154 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
155 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
158 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
159 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
160 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
161 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
162 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
163 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
164 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
165 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
166 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
167 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
168 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
169 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
170 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
171 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
172 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
173 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
174 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
175 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
176 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
177 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
178 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
179 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
180 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
181 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
182 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
183 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
184 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
185 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
186 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
187 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
188 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
189 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
193 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
194 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
195 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
196 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
197 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
198 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
199 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
200 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
201 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
202 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
205 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
206 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
207 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
208 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
209 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
210 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
211 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 87.69
Metatranscriptomes 0
Isolates 12.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.85
Nodule 0
Rhizoplane 1.23
Rhizosphere 74.15
Stem 0
Stem Tuber 0
Unclassified 18.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3662940 2162886007 Bacteria 8183
2 SwRhRL2b_contig_3769461 2162886007 Bacteria 8173
3 JGI25154J39366_1000028 3300002738 Bacteria 195818
4 rootH1_10027139 3300003316 Bacteria 2539
5 rootH1_10031920 3300003316 Bacteria 1885
6 rootH1_10064502 3300003316 Bacteria 6615
7 rootH1_10138708 3300003316 Bacteria 4982
8 rootH2_10001545 3300003320 Bacteria 30757
9 rootH2_10002269 3300003320 Bacteria 20277
10 rootH2_10074946 3300003320 Bacteria 19018
11 rootH1_10005542 3300003323 Bacteria 32769
12 rootH1_10014911 3300003323 Bacteria 25576
13 JGI25160J50197_1004696 3300003354 Bacteria 5852
14 Ga0058692_1000138 3300003856 Bacteria 46346
15 Ga0065714_10064574 3300005288 Bacteria 33091
16 Ga0065704_10000319 3300005289 Bacteria 45335
17 Ga0065704_10070507 3300005289 Bacteria 22172
18 Ga0065704_10078494 3300005289 Bacteria 4372
19 Ga0065704_10082765 3300005289 Bacteria 3552
20 Ga0065704_10114659 3300005289 Bacteria 1887
21 Ga0065712_10008890 3300005290 Bacteria 3292
22 Ga0065715_10015605 3300005293 Bacteria 2382
23 Ga0065707_10103755 3300005295 Bacteria 2731
24 Ga0070676_10014223 3300005328 Bacteria 4372
25 Ga0070690_100021843 3300005330 Bacteria 3912
26 Ga0070670_100005836 3300005331 Bacteria 10408
27 Ga0070670_100039896 3300005331 Bacteria 4038
28 Ga0070670_100079953 3300005331 Bacteria 2810
29 Ga0070670_100130106 3300005331 Bacteria 2173
30 Ga0070677_10012015 3300005333 Bacteria 2996
31 Ga0068869_100080830 3300005334 Bacteria 2426
32 Ga0070666_10000042 3300005335 Bacteria 112296
33 Ga0070666_10023572 3300005335 Bacteria 4007
34 Ga0070666_10049196 3300005335 Bacteria 2832
35 Ga0068868_100012496 3300005338 Bacteria 6209
36 Ga0070669_100008056 3300005353 Bacteria 7524
37 Ga0070669_100084944 3300005353 Bacteria 2363
38 Ga0070675_100027544 3300005354 Bacteria 4567
39 Ga0070675_100028815 3300005354 Bacteria 4472
40 Ga0070667_100088523 3300005367 Bacteria 2658
41 Ga0070662_100067241 3300005457 Bacteria 2631
42 Ga0070681_10060078 3300005458 Bacteria 3780
43 Ga0068867_100032180 3300005459 Bacteria 3791
44 Ga0070684_100004717 3300005535 Bacteria 10412
45 Ga0068853_100003813 3300005539 Bacteria 11550
46 Ga0068853_100042799 3300005539 Bacteria 3874
47 Ga0070672_100044396 3300005543 Bacteria 3432
48 Ga0070665_100038263 3300005548 Bacteria 4822
49 Ga0068855_100000019 3300005563 Bacteria 205963
50 Ga0068855_100001312 3300005563 Bacteria 30806
51 Ga0068857_100110413 3300005577 Bacteria 2471
52 Ga0068856_100004414 3300005614 Bacteria 14023
53 Ga0068856_100011906 3300005614 Bacteria 8421
54 Ga0068852_100002932 3300005616 Bacteria 11850
55 Ga0068859_100000130 3300005617 Bacteria 71018
56 Ga0068859_100015097 3300005617 Bacteria 7754
57 Ga0068859_100019617 3300005617 Bacteria 6792
58 Ga0068859_100023842 3300005617 Bacteria 6143
59 Ga0068864_100017753 3300005618 Bacteria 5935
60 Ga0068864_100072037 3300005618 Bacteria 3011
61 Ga0068863_100013700 3300005841 Bacteria 7819
62 Ga0068863_100017915 3300005841 Bacteria 6778
63 Ga0068863_100055337 3300005841 Bacteria 3757
64 Ga0068858_100009083 3300005842 Bacteria 9507
65 Ga0068860_100010705 3300005843 Bacteria 9059
66 Ga0068860_100012309 3300005843 Bacteria 8428
67 Ga0075363_100037125 3300006048 Bacteria 2558
68 Ga0075366_10043344 3300006195 Bacteria 2665
69 Ga0097621_100042555 3300006237 Bacteria 3659
70 Ga0068865_100003179 3300006881 Bacteria 9842
71 Ga0097620_100000130 3300006931 Bacteria 71018
72 Ga0097620_100015097 3300006931 Bacteria 7754
73 Ga0097620_100019618 3300006931 Bacteria 6792
74 Ga0097620_100023841 3300006931 Bacteria 6143
75 Ga0105251_10004062 3300009011 Bacteria 10285
76 Ga0105244_10000054 3300009036 Bacteria 133715
77 Ga0105240_10000306 3300009093 Bacteria 94696
78 Ga0111539_10002802 3300009094 Bacteria 23149
79 Ga0105247_10002407 3300009101 Bacteria 12727
80 Ga0105243_10000007 3300009148 Bacteria 445042
81 Ga0105243_10018684 3300009148 Bacteria 5252
82 Ga0105241_10002423 3300009174 Bacteria 13992
83 Ga0105241_10012290 3300009174 Bacteria 6279
84 Ga0105241_10146242 3300009174 Bacteria 1929
85 Ga0105242_10033483 3300009176 Bacteria 4114
86 Ga0105237_10000437 3300009545 Bacteria 59394
87 Ga0105237_10001556 3300009545 Bacteria 29902
88 Ga0105237_10012394 3300009545 Bacteria 8987
89 Ga0105237_10014052 3300009545 Bacteria 8376
90 Ga0105237_10020674 3300009545 Bacteria 6778
91 Ga0105237_10022459 3300009545 Bacteria 6473
92 Ga0105237_10092232 3300009545 Bacteria 3019
93 Ga0105238_10007627 3300009551 Bacteria 10841
94 Ga0105238_10081606 3300009551 Bacteria 3223
95 Ga0105249_10034967 3300009553 Bacteria 4555
96 Ga0105249_10035843 3300009553 Bacteria 4499
97 Ga0105239_10000036 3300010375 Bacteria 212090
98 Ga0105239_10002520 3300010375 Bacteria 23269
99 Ga0105239_10021791 3300010375 Bacteria 7063
100 Ga0105246_10027811 3300011119 Bacteria 3710
101 Ga0157371_10000037 3300013102 Bacteria 214866
102 Ga0157371_10007706 3300013102 Bacteria 8662
103 Ga0157370_10003225 3300013104 Bacteria 19260
104 Ga0157370_10003823 3300013104 Bacteria 17554
105 Ga0157370_10021807 3300013104 Bacteria 6380
106 Ga0157370_10053096 3300013104 Bacteria 3866
107 Ga0157369_10000403 3300013105 Bacteria 57592
108 Ga0157369_10012614 3300013105 Bacteria 9584
109 Ga0157369_10047946 3300013105 Bacteria 4637
110 Ga0157374_10000001 3300013296 Bacteria 1077351
111 Ga0157378_10037322 3300013297 Bacteria 4303
112 Ga0157378_10074478 3300013297 Bacteria 3055
113 Ga0163162_10000445 3300013306 Bacteria 38232
114 Ga0163162_10001068 3300013306 Bacteria 25464
115 Ga0163162_10002617 3300013306 Bacteria 17074
116 Ga0157372_10059398 3300013307 Bacteria 4277
117 Ga0157372_10131401 3300013307 Bacteria 2881
118 Ga0157375_10000052 3300013308 Bacteria 130032
119 Ga0157375_10050996 3300013308 Bacteria 4061
120 Ga0182008_10000471 3300014497 Bacteria 30819
121 Ga0157377_10002506 3300014745 Bacteria 8132
122 Ga0157379_10004592 3300014968 Bacteria 11847
123 Ga0157376_10052872 3300014969 Bacteria 3379
124 Ga0182006_1000048 3300015261 Bacteria 184700
125 Ga0182006_1000134 3300015261 Bacteria 80259
126 Ga0163161_10000091 3300017792 Bacteria 90927
127 Ga0209436_103389 3300025208 Bacteria 4261
128 Ga0209646_1000006 3300025246 Bacteria 694084
129 Ga0209026_1001073 3300025250 Bacteria 13209
130 Ga0209130_1002679 3300025284 Bacteria 8488
131 Ga0209758_1010369 3300025297 Bacteria 5590
132 Ga0209050_1009444 3300025298 Bacteria 4990
133 Ga0207426_1000023 3300025302 Bacteria 545465
134 Ga0207426_1000154 3300025302 Bacteria 179701
135 Ga0207426_1000209 3300025302 Bacteria 139524
136 Ga0207426_1000318 3300025302 Bacteria 93692
137 Ga0207713_1003812 3300025735 Bacteria 10095
138 Ga0207710_10000892 3300025900 Bacteria 15970
139 Ga0207654_10000771 3300025911 Bacteria 17639
140 Ga0207654_10001195 3300025911 Bacteria 13925
141 Ga0207707_10059116 3300025912 Bacteria 3335
142 Ga0207695_10000057 3300025913 Bacteria 376090
143 Ga0207695_10000266 3300025913 Bacteria 132163
144 Ga0207695_10000810 3300025913 Bacteria 58183
145 Ga0207671_10007242 3300025914 Bacteria 9661
146 Ga0207671_10008909 3300025914 Bacteria 8450
147 Ga0207671_10021458 3300025914 Bacteria 4901
148 Ga0207671_10069600 3300025914 Bacteria 2623
149 Ga0207681_10070698 3300025923 Bacteria 2431
150 Ga0207694_10004192 3300025924 Bacteria 11303
151 Ga0207694_10064956 3300025924 Bacteria 2845
152 Ga0207650_10033034 3300025925 Bacteria 3745
153 Ga0207650_10137436 3300025925 Bacteria 1918
154 Ga0207659_10067760 3300025926 Bacteria 2593
155 Ga0207706_10127799 3300025933 Bacteria 2235
156 Ga0207709_10000049 3300025935 Bacteria 237124
157 Ga0207709_10006133 3300025935 Bacteria 6773
158 Ga0207691_10006465 3300025940 Bacteria 11319
159 Ga0207691_10083109 3300025940 Bacteria 2875
160 Ga0207689_10003214 3300025942 Bacteria 14966
161 Ga0207689_10004095 3300025942 Bacteria 13256
162 Ga0207689_10007825 3300025942 Bacteria 9346
163 Ga0207689_10010298 3300025942 Bacteria 8052
164 Ga0207667_10000020 3300025949 Bacteria 374770
165 Ga0207712_10018334 3300025961 Bacteria 4558
166 Ga0207712_10041006 3300025961 Bacteria 3180
167 Ga0207712_10047443 3300025961 Bacteria 2982
168 Ga0207668_10023856 3300025972 Bacteria 3940
169 Ga0207658_10052466 3300025986 Bacteria 3010
170 Ga0207703_10003239 3300026035 Bacteria 13684
171 Ga0207639_10031846 3300026041 Bacteria 3878
172 Ga0207639_10035662 3300026041 Bacteria 3682
173 Ga0207702_10016607 3300026078 Bacteria 6092
174 Ga0207702_10030772 3300026078 Bacteria 4471
175 Ga0207641_10000158 3300026088 Bacteria 96378
176 Ga0207648_10000559 3300026089 Bacteria 41660
177 Ga0207648_10129208 3300026089 Bacteria 2223
178 Ga0207674_10045237 3300026116 Bacteria 4529
179 Ga0207674_10045323 3300026116 Bacteria 4524
180 Ga0207675_100004293 3300026118 Bacteria 13778
181 Ga0207675_100094602 3300026118 Bacteria 2811
182 Ga0207683_10000691 3300026121 Bacteria 30953
183 Ga0207698_10004232 3300026142 Bacteria 8730
184 Ga0207698_10208104 3300026142 Bacteria 1758
185 Ga0209371_1000011 3300027312 Bacteria 848456
186 Ga0268264_10005801 3300028381 Bacteria 10466
187 Ga0268264_10011165 3300028381 Bacteria 7418
188 Ga0268264_10017359 3300028381 Bacteria 5896
189 Ga0268264_10044870 3300028381 Bacteria 3669
190 Ga0268264_10056783 3300028381 Bacteria 3273
191 Ga0307517_10005403 3300028786 Bacteria 19280
192 Ga0307515_10000001 3300028794 Bacteria 4259510
193 Ga0307515_10000246 3300028794 Bacteria 134348
194 Ga0307515_10000676 3300028794 Bacteria 78539
195 Ga0307515_10003783 3300028794 Bacteria 31678
196 Ga0265338_10077885 3300028800 Bacteria 2799
197 Ga0268256_1000011 3300030500 Bacteria 848625
198 Ga0316176_1023773 3300030732 Bacteria 10762
199 Ga0265327_10000101 3300031251 Bacteria 188671
200 Ga0265327_10000248 3300031251 Bacteria 107284
201 Ga0265316_10008332 3300031344 Bacteria 9624
202 Ga0307513_10001365 3300031456 Bacteria 35245
203 Ga0307508_10000439 3300031616 Bacteria 49671
204 Ga0307516_10001323 3300031730 Bacteria 34352
205 Ga0307416_100000052 3300032002 Bacteria 114516
206 Ga0307507_10000078 3300033179 Bacteria 151026
207 Ga0307510_10001154 3300033180 Bacteria 28403
208 Ga0395899_0013779 3300037312 Bacteria 6180
209 Ga0395900_0003309 3300037418 Bacteria 17433
210 Ga0395900_0005952 3300037418 Bacteria 12734
211 Ga0395900_0034249 3300037418 Bacteria 5229
212 Ga0395901_0046663 3300038443 Bacteria 4501
213 Ga0237819_00327 3300038705 Bacteria 17440
214 Ga0451789_0324568 3300041443 Bacteria 2735
215 Ga0451800_0225152 3300041459 Bacteria 7221
216 Ga0451804_0049542 3300041463 Bacteria 4223
217 Ga0451807_1144023 3300041486 Bacteria 2937
218 Ga0439449_0009374 3300042007 Bacteria 3712
219 Ga0439462_0010230 3300042015 Bacteria 2376
220 Ga0466972_0000022 3300044658 Bacteria 193802
221 Ga0466972_0004619 3300044658 Bacteria 6896
222 Ga0466970_0076296 3300044765 Bacteria 1806
223 Ga0466959_0004034 3300045049 Bacteria 9762
224 Ga0466958_0076096 3300045836 Bacteria 2060
225 Ga0495590_0010443 3300046457 Bacteria 3491
226 Ga0495638_0000006 3300046460 Bacteria 668846
227 Ga0495585_0000065 3300046492 Bacteria 108945
228 Ga0495606_0000264 3300046507 Bacteria 92733
229 Ga0495606_0005538 3300046507 Bacteria 12048
230 Ga0495606_0005614 3300046507 Bacteria 11922
231 Ga0495610_0000001 3300046512 Bacteria 1620061
232 Ga0495648_0004998 3300046524 Bacteria 11142
233 Ga0495633_0000042 3300046558 Bacteria 173748
234 Ga0495633_0017306 3300046558 Bacteria 3689
235 Ga0495668_0000011 3300046616 Bacteria 472186
236 Ga0495625_0000344 3300046660 Bacteria 71298
237 Ga0495625_0000873 3300046660 Bacteria 41027
238 Ga0495660_0003680 3300046810 Bacteria 9432
239 Ga0495672_0036320 3300047320 Bacteria 3027
240 Ga0495686_0000094 3300047472 Bacteria 187720
241 Ga0495686_0011745 3300047472 Bacteria 6166
242 Ga0496116_0000012 3300048919 Bacteria 611365
243 Ga0496116_0014620 3300048919 Bacteria 6256
244 Ga0496117_0000257 3300048920 Bacteria 99879
245 Ga0496117_0000769 3300048920 Bacteria 50620
246 Ga0496118_0000196 3300048921 Bacteria 106933
247 Ga0496119_0000002 3300048922 Bacteria 738385
248 Ga0496122_0000633 3300048925 Bacteria 71586
249 Ga0496122_0001285 3300048925 Bacteria 41682
250 Ga0496122_0001861 3300048925 Bacteria 32176
251 Ga0496122_0006846 3300048925 Bacteria 12924
252 Ga0496122_0007918 3300048925 Bacteria 11639
253 Ga0496123_0001590 3300048926 Bacteria 30876
254 Ga0496123_0002553 3300048926 Bacteria 22190
255 Ga0496123_0013159 3300048926 Bacteria 6976
256 Ga0496123_0014110 3300048926 Bacteria 6646
257 Ga0496124_0003447 3300048927 Bacteria 19339
258 Ga0496125_0006494 3300048928 Bacteria 12627
259 Ga0496125_0043637 3300048928 Bacteria 3802
260 Ga0501298_001759 3300049521 Bacteria 3204
261 Ga0501034_0042911 3300049571 Bacteria 4578
262 Ga0501037_0005464 3300049573 Bacteria 9259
263 Ga0501047_0095781 3300049581 Bacteria 2847
264 Ga0501047_0128749 3300049581 Bacteria 2412
265 Ga0501201_000352 3300049651 Bacteria 4249
266 Ga0501206_000740 3300049653 Bacteria 3981
267 Ga0501207_000181 3300049654 Bacteria 6092
268 Ga0501217_002315 3300049661 Bacteria 3730
269 Ga0501217_005449 3300049661 Bacteria 2662
270 Ga0501236_000491 3300049670 Bacteria 4470
271 Ga0501243_001238 3300049675 Bacteria 3656
272 Ga0501252_000764 3300049682 Bacteria 2677
273 Ga0501221_000949 3300049704 Bacteria 4759
274 Ga0501225_0013687 3300049705 Bacteria 2269
275 Ga0501044_0014766 3300049823 Bacteria 8420
276 nmdc:mga0k408_2869_c1 3300050493 Bacteria 9150
277 nmdc:mga08y16_10678_c1 3300050511 Bacteria 9638
278 Ga0500578_0000065 3300053086 Bacteria 117032
279 Ga0500651_0000992 3300053093 Bacteria 13993
280 Ga0500618_000010 3300053125 Bacteria 203909
281 Ga0500652_001219 3300053131 Bacteria 8200
282 Ga0500616_0000065 3300053153 Bacteria 239287
283 Ga0500616_0004481 3300053153 Bacteria 9925
284 Ga0500611_000008 3300053727 Bacteria 198346
285 Ga0466962_0030654 3300061719 Bacteria 2576

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045836 Ga0466958_0076096 Ga0466958_0076096_638_2014 386
2 3300003316 rootH1_10064502 rootH1_100645024 425
3 3300005289 Ga0065704_10082765 Ga0065704_100827652 447
4 3300005334 Ga0068869_100080830 Ga0068869_1000808302 452
5 3300025942 Ga0207689_10004095 Ga0207689_1000409511 452
6 3300025972 Ga0207668_10023856 Ga0207668_100238562 452
7 3300026118 Ga0207675_100094602 Ga0207675_1000946022 452
8 3300048928 Ga0496125_0006494 Ga0496125_0006494_10922_12598 457
9 3300003323 rootH1_10005542 rootH1_1000554226 462
10 3300049682 Ga0501252_000764 Ga0501252_000764_146_1831 463
11 3300028794 Ga0307515_10000246 Ga0307515_1000024695 465
12 3300005331 Ga0070670_100005836 Ga0070670_1000058365 467
13 3300005535 Ga0070684_100004717 Ga0070684_1000047174 467
14 3300025925 Ga0207650_10033034 Ga0207650_100330342 467
15 3300003320 rootH2_10001545 rootH2_1000154522 468
16 3300028800 Ga0265338_10077885 Ga0265338_100778852 468
17 3300003316 rootH1_10031920 rootH1_100319201 470
18 3300037418 Ga0395900_0003309 Ga0395900_0003309_15181_16893 470
19 3300005353 Ga0070669_100084944 Ga0070669_1000849441 471
20 3300030732 Ga0316176_1023773 Ga0316176_10237733 471
21 3300047320 Ga0495672_0036320 Ga0495672_0036320_200_1948 471
22 3300048925 Ga0496122_0007918 Ga0496122_0007918_8209_9936 471
23 3300005614 Ga0068856_100011906 Ga0068856_1000119065 472
24 3300009545 Ga0105237_10092232 Ga0105237_100922322 472
25 3300026078 Ga0207702_10016607 Ga0207702_100166073 472
26 3300044765 Ga0466970_0076296 Ga0466970_0076296_30_1778 472
27 3300009553 Ga0105249_10034967 Ga0105249_100349672 473
28 3300046507 Ga0495606_0000264 Ga0495606_0000264_82808_84433 473
29 3300005289 Ga0065704_10078494 Ga0065704_100784942 474
30 3300013102 Ga0157371_10000037 Ga0157371_1000003726 474
31 3300013104 Ga0157370_10003225 Ga0157370_100032258 474
32 3300013105 Ga0157369_10000403 Ga0157369_100004033 474
33 3300013308 Ga0157375_10000052 Ga0157375_1000005249 474
34 3300015261 Ga0182006_1000048 Ga0182006_100004899 474
35 3300046512 Ga0495610_0000001 Ga0495610_0000001_1195357_1197084 474
36 3300041443 Ga0451789_0324568 Ga0451789_0324568_938_2500 475
37 3300048919 Ga0496116_0000012 Ga0496116_0000012_208155_209882 475
38 3300048920 Ga0496117_0000257 Ga0496117_0000257_10276_12003 475
39 3300048921 Ga0496118_0000196 Ga0496118_0000196_8114_9841 475
40 3300048922 Ga0496119_0000002 Ga0496119_0000002_382886_384613 475
41 3300048925 Ga0496122_0000633 Ga0496122_0000633_59694_61421 475
42 3300048926 Ga0496123_0013159 Ga0496123_0013159_1131_2858 475
43 3300048927 Ga0496124_0003447 Ga0496124_0003447_7539_9266 475
44 3300048928 Ga0496125_0043637 Ga0496125_0043637_1286_3013 475
45 3300009545 Ga0105237_10001556 Ga0105237_1000155622 476
46 3300013104 Ga0157370_10003823 Ga0157370_100038234 476
47 3300013296 Ga0157374_10000001 Ga0157374_10000001597 476
48 3300014497 Ga0182008_10000471 Ga0182008_100004717 476
49 3300014969 Ga0157376_10052872 Ga0157376_100528721 476
50 3300015261 Ga0182006_1000134 Ga0182006_100013447 476
51 3300037418 Ga0395900_0034249 Ga0395900_0034249_1893_3569 476
52 3300048925 Ga0496122_0001285 Ga0496122_0001285_38157_39914 476
53 3300048926 Ga0496123_0002553 Ga0496123_0002553_9576_11333 476
54 3300005618 Ga0068864_100072037 Ga0068864_1000720373 477
55 3300046460 Ga0495638_0000006 Ga0495638_0000006_60757_62445 477
56 3300053153 Ga0500616_0000065 Ga0500616_0000065_38575_40263 477
57 3300013102 Ga0157371_10007706 Ga0157371_100077064 478
58 3300013105 Ga0157369_10012614 Ga0157369_100126146 478
59 3300025298 Ga0209050_1009444 Ga0209050_10094442 478
60 3300031251 Ga0265327_10000248 Ga0265327_1000024883 478
61 3300006048 Ga0075363_100037125 Ga0075363_1000371251 479
62 3300009101 Ga0105247_10002407 Ga0105247_100024075 479
63 3300025900 Ga0207710_10000892 Ga0207710_100008925 479
64 3300044658 Ga0466972_0004619 Ga0466972_0004619_3539_5221 479
65 3300044658 Ga0466972_0000022 Ga0466972_0000022_67006_68694 480
66 3300005330 Ga0070690_100021843 Ga0070690_1000218432 481
67 3300005539 Ga0068853_100042799 Ga0068853_1000427991 481
68 3300009553 Ga0105249_10035843 Ga0105249_100358432 481
69 3300025961 Ga0207712_10018334 Ga0207712_100183343 481
70 3300026041 Ga0207639_10035662 Ga0207639_100356621 481
71 3300005288 Ga0065714_10064574 Ga0065714_1006457417 482
72 3300005289 Ga0065704_10000319 Ga0065704_1000031955 482
73 3300005289 Ga0065704_10114659 Ga0065704_101146591 482
74 3300005328 Ga0070676_10014223 Ga0070676_100142232 482
75 3300005331 Ga0070670_100079953 Ga0070670_1000799532 482
76 3300005333 Ga0070677_10012015 Ga0070677_100120152 482
77 3300005335 Ga0070666_10023572 Ga0070666_100235722 482
78 3300005338 Ga0068868_100012496 Ga0068868_1000124962 482
79 3300005459 Ga0068867_100032180 Ga0068867_1000321803 482
80 3300005543 Ga0070672_100044396 Ga0070672_1000443962 482
81 3300005548 Ga0070665_100038263 Ga0070665_1000382634 482
82 3300006881 Ga0068865_100003179 Ga0068865_1000031793 482
83 3300009176 Ga0105242_10033483 Ga0105242_100334832 482
84 3300011119 Ga0105246_10027811 Ga0105246_100278112 482
85 3300013297 Ga0157378_10037322 Ga0157378_100373222 482
86 3300013308 Ga0157375_10050996 Ga0157375_100509962 482
87 3300025935 Ga0207709_10000049 Ga0207709_1000004944 482
88 3300025940 Ga0207691_10006465 Ga0207691_100064652 482
89 3300025942 Ga0207689_10003214 Ga0207689_1000321413 482
90 3300025942 Ga0207689_10007825 Ga0207689_100078255 482
91 3300025986 Ga0207658_10052466 Ga0207658_100524662 482
92 3300026089 Ga0207648_10000559 Ga0207648_100005595 482
93 3300026089 Ga0207648_10129208 Ga0207648_101292082 482
94 3300026121 Ga0207683_10000691 Ga0207683_1000069112 482
95 3300028381 Ga0268264_10044870 Ga0268264_100448702 482
96 3300032002 Ga0307416_100000052 Ga0307416_10000005235 482
97 3300042007 Ga0439449_0009374 Ga0439449_0009374_22_1728 482
98 3300042015 Ga0439462_0010230 Ga0439462_0010230_530_2236 482
99 3300049571 Ga0501034_0042911 Ga0501034_0042911_2667_4349 482
100 3300049573 Ga0501037_0005464 Ga0501037_0005464_2855_4537 482
101 3300049823 Ga0501044_0014766 Ga0501044_0014766_3482_5164 482
102 3300005335 Ga0070666_10000042 Ga0070666_1000004267 483
103 3300005367 Ga0070667_100088523 Ga0070667_1000885231 483
104 3300005563 Ga0068855_100001312 Ga0068855_1000013128 483
105 3300005616 Ga0068852_100002932 Ga0068852_1000029324 483
106 3300005617 Ga0068859_100000130 Ga0068859_10000013031 483
107 3300005618 Ga0068864_100017753 Ga0068864_1000177533 483
108 3300005841 Ga0068863_100017915 Ga0068863_1000179152 483
109 3300005842 Ga0068858_100009083 Ga0068858_1000090833 483
110 3300005843 Ga0068860_100012309 Ga0068860_1000123095 483
111 3300006237 Ga0097621_100042555 Ga0097621_1000425552 483
112 3300006931 Ga0097620_100000130 Ga0097620_10000013037 483
113 3300009174 Ga0105241_10002423 Ga0105241_100024238 483
114 3300009545 Ga0105237_10020674 Ga0105237_100206744 483
115 3300013297 Ga0157378_10074478 Ga0157378_100744783 483
116 3300013306 Ga0163162_10000445 Ga0163162_100004458 483
117 3300014968 Ga0157379_10004592 Ga0157379_100045926 483
118 3300025911 Ga0207654_10001195 Ga0207654_100011955 483
119 3300025942 Ga0207689_10010298 Ga0207689_100102982 483
120 3300025961 Ga0207712_10041006 Ga0207712_100410061 483
121 3300026035 Ga0207703_10003239 Ga0207703_100032392 483
122 3300026088 Ga0207641_10000158 Ga0207641_1000015838 483
123 3300026142 Ga0207698_10004232 Ga0207698_100042324 483
124 3300028381 Ga0268264_10017359 Ga0268264_100173595 483
125 3300002738 JGI25154J39366_1000028 JGI25154J39366_1000028157 484
126 3300003354 JGI25160J50197_1004696 JGI25160J50197_10046963 484
127 3300005563 Ga0068855_100000019 Ga0068855_100000019127 484
128 3300009148 Ga0105243_10000007 Ga0105243_10000007350 484
129 3300025246 Ga0209646_1000006 Ga0209646_100000671 484
130 3300025250 Ga0209026_1001073 Ga0209026_100107310 484
131 3300025297 Ga0209758_1010369 Ga0209758_10103693 484
132 3300025302 Ga0207426_1000209 Ga0207426_100020968 484
133 3300025949 Ga0207667_10000020 Ga0207667_1000002042 484
134 3300028381 Ga0268264_10011165 Ga0268264_100111654 484
135 3300053131 Ga0500652_001219 Ga0500652_001219_2423_4120 484
136 3300005295 Ga0065707_10103755 Ga0065707_101037552 485
137 3300025208 Ga0209436_103389 Ga0209436_1033892 485
138 3300025302 Ga0207426_1000318 Ga0207426_10003186 485
139 3300025913 Ga0207695_10000057 Ga0207695_1000005770 485
140 3300031251 Ga0265327_10000101 Ga0265327_1000010137 485
141 3300048919 Ga0496116_0014620 Ga0496116_0014620_4362_6062 485
142 3300048920 Ga0496117_0000769 Ga0496117_0000769_7213_8913 485
143 3300048925 Ga0496122_0006846 Ga0496122_0006846_9175_10875 485
144 3300048926 Ga0496123_0014110 Ga0496123_0014110_3608_5308 485
145 3300049581 Ga0501047_0095781 Ga0501047_0095781_1063_2760 485
146 3300010375 Ga0105239_10000036 Ga0105239_10000036118 486
147 3300053086 Ga0500578_0000065 Ga0500578_0000065_850_2604 486
148 3300009093 Ga0105240_10000306 Ga0105240_1000030631 487
149 3300009174 Ga0105241_10012290 Ga0105241_100122903 487
150 3300009545 Ga0105237_10014052 Ga0105237_100140524 487
151 3300009551 Ga0105238_10007627 Ga0105238_100076276 487
152 3300013307 Ga0157372_10059398 Ga0157372_100593982 487
153 3300025911 Ga0207654_10000771 Ga0207654_1000077111 487
154 3300025913 Ga0207695_10000810 Ga0207695_1000081028 487
155 3300025914 Ga0207671_10008909 Ga0207671_100089094 487
156 3300025924 Ga0207694_10004192 Ga0207694_100041925 487
157 3300026116 Ga0207674_10045323 Ga0207674_100453232 487
158 3300038705 Ga0237819_00327 Ga0237819_00327_14915_16495 487
159 3300049581 Ga0501047_0128749 Ga0501047_0128749_786_2393 487
160 3300003320 rootH2_10074946 rootH2_100749468 488
161 3300026041 Ga0207639_10031846 Ga0207639_100318462 488
162 3300031616 Ga0307508_10000439 Ga0307508_1000043934 488
163 3300005617 Ga0068859_100019617 Ga0068859_1000196174 489
164 3300006931 Ga0097620_100019618 Ga0097620_1000196182 489
165 3300025961 Ga0207712_10047443 Ga0207712_100474432 489
166 3300028381 Ga0268264_10056783 Ga0268264_100567832 489
167 3300003320 rootH2_10002269 rootH2_1000226922 490
168 3300005290 Ga0065712_10008890 Ga0065712_100088903 490
169 3300005293 Ga0065715_10015605 Ga0065715_100156051 490
170 3300005331 Ga0070670_100039896 Ga0070670_1000398962 490
171 3300005353 Ga0070669_100008056 Ga0070669_1000080562 490
172 3300005354 Ga0070675_100027544 Ga0070675_1000275442 490
173 3300005457 Ga0070662_100067241 Ga0070662_1000672411 490
174 3300005577 Ga0068857_100110413 Ga0068857_1001104132 490
175 3300005617 Ga0068859_100015097 Ga0068859_1000150972 490
176 3300005617 Ga0068859_100023842 Ga0068859_1000238422 490
177 3300006931 Ga0097620_100015097 Ga0097620_1000150972 490
178 3300006931 Ga0097620_100023841 Ga0097620_1000238414 490
179 3300009094 Ga0111539_10002802 Ga0111539_100028022 490
180 3300014745 Ga0157377_10002506 Ga0157377_100025064 490
181 3300025923 Ga0207681_10070698 Ga0207681_100706981 490
182 3300025925 Ga0207650_10137436 Ga0207650_101374361 490
183 3300025933 Ga0207706_10127799 Ga0207706_101277992 490
184 3300025940 Ga0207691_10083109 Ga0207691_100831092 490
185 3300026116 Ga0207674_10045237 Ga0207674_100452372 490
186 3300026118 Ga0207675_100004293 Ga0207675_1000042932 490
187 3300050511 nmdc:mga08y16_10678_c1 nmdc:mga08y16_10678_c1_258_1928 490
188 3300025284 Ga0209130_1002679 Ga0209130_10026798 491
189 3300025302 Ga0207426_1000154 Ga0207426_100015464 491
190 3300005331 Ga0070670_100130106 Ga0070670_1001301062 492
191 3300005841 Ga0068863_100013700 Ga0068863_1000137004 492
192 3300025302 Ga0207426_1000023 Ga0207426_100002380 492
193 3300047472 Ga0495686_0011745 Ga0495686_0011745_1216_2967 492
194 3300053727 Ga0500611_000008 Ga0500611_000008_195048_196733 492
195 iso_pu_bacteria 2511231000 2511234469 492
196 iso_pu_bacteria 2582581281 2585155824 492
197 iso_pu_bacteria 2582581282 2585160252 492
198 iso_pu_bacteria 2585428187 2588234377 492
199 iso_pu_bacteria 2816332188 2816872862 492
200 iso_pu_bacteria 2889290771 2889291887 492
201 iso_pu_bacteria 2993372514 2993373772 492
202 3300003316 rootH1_10138708 rootH1_101387084 493
203 3300005335 Ga0070666_10049196 Ga0070666_100491962 493
204 3300005458 Ga0070681_10060078 Ga0070681_100600783 493
205 3300005539 Ga0068853_100003813 Ga0068853_1000038138 493
206 3300005841 Ga0068863_100055337 Ga0068863_1000553372 493
207 3300005843 Ga0068860_100010705 Ga0068860_1000107054 493
208 3300009545 Ga0105237_10000437 Ga0105237_1000043724 493
209 3300009545 Ga0105237_10022459 Ga0105237_100224595 493
210 3300009551 Ga0105238_10081606 Ga0105238_100816062 493
211 3300010375 Ga0105239_10002520 Ga0105239_1000252013 493
212 3300013306 Ga0163162_10001068 Ga0163162_1000106812 493
213 3300013307 Ga0157372_10131401 Ga0157372_101314012 493
214 3300025912 Ga0207707_10059116 Ga0207707_100591162 493
215 3300025913 Ga0207695_10000266 Ga0207695_1000026667 493
216 3300025914 Ga0207671_10007242 Ga0207671_100072423 493
217 3300025914 Ga0207671_10021458 Ga0207671_100214584 493
218 3300025924 Ga0207694_10064956 Ga0207694_100649563 493
219 3300028381 Ga0268264_10005801 Ga0268264_100058017 493
220 3300028786 Ga0307517_10005403 Ga0307517_100054037 493
221 3300028794 Ga0307515_10000001 Ga0307515_100000011028 493
222 3300031730 Ga0307516_10001323 Ga0307516_1000132316 493
223 3300033180 Ga0307510_10001154 Ga0307510_100011545 493
224 3300045049 Ga0466959_0004034 Ga0466959_0004034_96_1802 493
225 3300046507 Ga0495606_0005614 Ga0495606_0005614_1500_3206 493
226 3300049521 Ga0501298_001759 Ga0501298_001759_1371_3095 493
227 3300049651 Ga0501201_000352 Ga0501201_000352_795_2516 493
228 3300049653 Ga0501206_000740 Ga0501206_000740_270_1994 493
229 3300049654 Ga0501207_000181 Ga0501207_000181_4299_6023 493
230 3300049661 Ga0501217_002315 Ga0501217_002315_695_2419 493
231 3300049675 Ga0501243_001238 Ga0501243_001238_369_2093 493
232 3300049704 Ga0501221_000949 Ga0501221_000949_469_2193 493
233 3300049705 Ga0501225_0013687 Ga0501225_0013687_490_2214 493
234 3300053153 Ga0500616_0004481 Ga0500616_0004481_830_2548 493
235 3300061719 Ga0466962_0030654 Ga0466962_0030654_44_1750 493
236 iso_pu_bacteria 2738541279 2738733863 493
237 iso_pu_bacteria 2738541285 2738766180 493
238 iso_pu_bacteria 2738543007 2739215444 493
239 iso_pu_bacteria 2818991460 2819678884 493
240 iso_pu_bacteria 2818991460 2819680216 493
241 iso_pu_bacteria 2842903701 2842907849 493
242 iso_pu_bacteria 2884791551 2884793921 493
243 iso_pu_bacteria 2914759650 2914761384 493
244 iso_pu_bacteria 2929177148 2929182028 493
245 iso_pu_bacteria 2929177148 2929182554 493
246 iso_pu_bacteria 2945977869 2945977969 493
247 iso_pu_bacteria 2945977869 2945978479 493
248 iso_pu_bacteria 2946013367 2946015659 493
249 iso_pu_bacteria 2946013367 2946016178 493
250 3300003316 rootH1_10027139 rootH1_100271392 494
251 3300003323 rootH1_10014911 rootH1_1001491115 494
252 3300005354 Ga0070675_100028815 Ga0070675_1000288152 494
253 3300005614 Ga0068856_100004414 Ga0068856_1000044147 494
254 3300009036 Ga0105244_10000054 Ga0105244_1000005437 494
255 3300009174 Ga0105241_10146242 Ga0105241_101462421 494
256 3300009545 Ga0105237_10012394 Ga0105237_100123945 494
257 3300010375 Ga0105239_10021791 Ga0105239_100217914 494
258 3300017792 Ga0163161_10000091 Ga0163161_1000009151 494
259 3300025914 Ga0207671_10069600 Ga0207671_100696002 494
260 3300025926 Ga0207659_10067760 Ga0207659_100677602 494
261 3300026078 Ga0207702_10030772 Ga0207702_100307723 494
262 3300037312 Ga0395899_0013779 Ga0395899_0013779_2033_3745 494
263 3300037418 Ga0395900_0005952 Ga0395900_0005952_4403_6115 494
264 3300038443 Ga0395901_0046663 Ga0395901_0046663_2472_4184 494
265 3300049661 Ga0501217_005449 Ga0501217_005449_850_2538 494
266 3300049670 Ga0501236_000491 Ga0501236_000491_916_2604 494
267 iso_pu_bacteria 2721755487 2722730750 494
268 iso_pu_bacteria 2821136567 2821142400 494
269 iso_pu_bacteria 2842903701 2842907177 494
270 iso_pu_bacteria 2896317667 2896320902 494
271 iso_pu_bacteria 2904780799 2904783248 494
272 iso_pu_bacteria 2910245624 2910250423 494
273 iso_pu_bacteria 2919177583 2919180856 494
274 iso_pu_bacteria 2928078545 2928082435 494
275 iso_pu_bacteria 2928147474 2928148981 494
276 iso_pu_bacteria 2929921140 2929924788 494
277 iso_pu_bacteria 2932082852 2932087511 494
278 iso_pu_bacteria 2958512119 2958515936 494
279 iso_pu_bacteria 2965320100 2965321630 494
280 iso_pu_bacteria 3003233435 3003234038 494
281 iso_pu_bacteria 8003151029 8003156277 494
282 3300006195 Ga0075366_10043344 Ga0075366_100433442 495
283 3300013306 Ga0163162_10002617 Ga0163162_100026175 495
284 3300026142 Ga0207698_10208104 Ga0207698_102081041 495
285 3300028794 Ga0307515_10000676 Ga0307515_1000067682 495
286 3300028794 Ga0307515_10003783 Ga0307515_1000378324 495
287 3300033179 Ga0307507_10000078 Ga0307507_1000007888 495
288 3300046457 Ga0495590_0010443 Ga0495590_0010443_411_2108 495
289 3300046492 Ga0495585_0000065 Ga0495585_0000065_23912_25612 495
290 3300046507 Ga0495606_0005538 Ga0495606_0005538_3833_5539 495
291 3300046524 Ga0495648_0004998 Ga0495648_0004998_2220_3926 495
292 3300046558 Ga0495633_0000042 Ga0495633_0000042_63290_64996 495
293 3300046616 Ga0495668_0000011 Ga0495668_0000011_171489_173195 495
294 3300046660 Ga0495625_0000344 Ga0495625_0000344_8517_10223 495
295 3300046660 Ga0495625_0000873 Ga0495625_0000873_36572_38278 495
296 3300046810 Ga0495660_0003680 Ga0495660_0003680_7359_9059 495
297 3300047472 Ga0495686_0000094 Ga0495686_0000094_46481_48208 495
298 3300050493 nmdc:mga0k408_2869_c1 nmdc:mga0k408_2869_c1_6333_8039 495
299 3300053125 Ga0500618_000010 Ga0500618_000010_46566_48272 495
300 3300003856 Ga0058692_1000138 Ga0058692_100013825 496
301 3300027312 Ga0209371_1000011 Ga0209371_100001115 496
302 3300030500 Ga0268256_1000011 Ga0268256_100001115 496
303 3300013104 Ga0157370_10021807 Ga0157370_100218073 497
304 3300013104 Ga0157370_10053096 Ga0157370_100530962 497
305 3300013105 Ga0157369_10047946 Ga0157369_100479462 497
306 3300031344 Ga0265316_10008332 Ga0265316_100083322 497
307 3300046558 Ga0495633_0017306 Ga0495633_0017306_1502_3076 497
308 3300048925 Ga0496122_0001861 Ga0496122_0001861_15856_17430 497
309 3300048926 Ga0496123_0001590 Ga0496123_0001590_24095_25669 497
310 3300053093 Ga0500651_0000992 Ga0500651_0000992_1164_2738 498
311 iso_pu_bacteria 2747842501 2748015555 499
312 iso_pu_bacteria 2818991457 2819659718 499
313 iso_pu_bacteria 2928972540 2928973919 499
314 iso_pu_bacteria 2977240413 2977241121 499
315 3300031456 Ga0307513_10001365 Ga0307513_1000136529 500
316 2162886007 SwRhRL2b_contig_3662940 SwRhRL2b_0545.00007440 503
317 2162886007 SwRhRL2b_contig_3769461 SwRhRL2b_0794.00009320 503
318 3300005289 Ga0065704_10070507 Ga0065704_1007050715 503
319 3300009011 Ga0105251_10004062 Ga0105251_100040622 503
320 3300009148 Ga0105243_10018684 Ga0105243_100186844 503
321 3300025735 Ga0207713_1003812 Ga0207713_10038125 503
322 3300025935 Ga0207709_10006133 Ga0207709_100061332 503
323 3300041459 Ga0451800_0225152 Ga0451800_0225152_2944_4506 503
324 3300041463 Ga0451804_0049542 Ga0451804_0049542_68_1630 503
325 3300041486 Ga0451807_1144023 Ga0451807_1144023_1265_2827 503

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00474

SSF

Sodium:solute symporter family

41

485

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dh4-assembly1.cif.gz_A crystal structure of sodium/sugar symporter with bound galactose from vibrio parahaemolyticus 0.9213 42 503
2xq2-assembly1.cif.gz_B structure of the k294a mutant of vsglt 0.8975 46 503
2xq2-assembly1.cif.gz_A structure of the k294a mutant of vsglt 0.8794 5 503
2xq2-assembly1.cif.gz_A structure of the k294a mutant of vsglt 0.8711 5 503
8hez-assembly1.cif.gz_A structure of human sglt2-map17 complex with dapagliflozin 0.8694 9 503
ID Description Score Start End Superfamily
af_F1QBX6_71_590_1.20.1730.10 Mainly Alpha;Up-down Bundle;Sodium/glucose cotransporter;Sodium/glucose cotransporter 0.8913 35 466 1.20.1730.10
af_P31448_28_554_1.20.1730.10 Mainly Alpha;Up-down Bundle;Sodium/glucose cotransporter;Sodium/glucose cotransporter 0.8835 33 499 1.20.1730.10
2xq2A01 Mainly Alpha;Up-down Bundle;Sodium/glucose cotransporter;Sodium/glucose cotransporter 0.8702 5 503 1.20.1730.10
2xq2A01 Mainly Alpha;Up-down Bundle;Sodium/glucose cotransporter;Sodium/glucose cotransporter 0.862 5 503 1.20.1730.10
af_A0A0G2K669_1_416_1.20.1730.10 Mainly Alpha;Up-down Bundle;Sodium/glucose cotransporter;Sodium/glucose cotransporter 0.8566 135 465 1.20.1730.10
ID Description Score Start End GO Terms
AF-A0A519KC53-F1-model_v4 Sodium transporter 0.9533 55 392 GO:0005412
GO:0005886
AF-A0A2N1XZ56-F1-model_v4 Sodium transporter 0.9474 5 451 GO:0005412
GO:0005886
AF-A0A519K0Z8-F1-model_v4 Sodium transporter 0.9354 7 232 GO:0005412
GO:0005886
AF-A0A1W9T2I1-F1-model_v4 Na+/glucose cotransporter 0.9236 10 299 GO:0005412
GO:0005886
AF-A0A2D5PMP3-F1-model_v4 Sodium transporter 0.9112 343 503 GO:0016020
GO:0022857

Feature Viewer

pLDDT pTM Quality
78.25 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map