F407642

General Info

Members Datasets Scaffolds Average Seq Length
325 217 650 157

Family's Representative Sequence

Representative Sequence 3300003316|rootH1_10035914|rootH1_100359141
Length 152
Sequence VKDNLIARRVEAARAGNNSYVICRLASGWLVVGDVQPRPGYCLLLADPVRPCLNSLSDDDRVAYLLDMSRIGDALLKVTGAVRINYETLGNTEPALHTHIIPRYRDEPMWRSVLPTSLSYPRIFAPRFNPEKQAGFIANMRDELHRPLAANN

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
41 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
42 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
45 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
68 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
98 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
101 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
102 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
103 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
104 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
105 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
106 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
107 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
108 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
109 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
110 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
111 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
112 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
113 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
114 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
115 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
116 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
117 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
118 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
119 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
120 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
121 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
122 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
123 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
124 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
125 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
126 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
127 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
128 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
129 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
130 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
131 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
132 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
133 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
134 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
135 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
136 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
137 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
138 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
139 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
140 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
141 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
142 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
143 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
144 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
145 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
146 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
147 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
148 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
149 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
150 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
151 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
152 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
153 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
154 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
155 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
156 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
157 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
158 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
159 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
160 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
161 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
162 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
163 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
164 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
165 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
166 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
167 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
180 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
181 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
182 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
183 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
184 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
185 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
186 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
187 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
188 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
189 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
190 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
191 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
194 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
195 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
196 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
197 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
198 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
199 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
200 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
201 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
202 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
203 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
204 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
205 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
206 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
207 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
208 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
209 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
210 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
211 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
212 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
213 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
214 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
215 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
216 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
217 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.77
Nodule 0
Rhizoplane 2.15
Rhizosphere 85.85
Stem 0
Stem Tuber 0
Unclassified 23.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10035914 3300003316 Unclassified 2357
2 SwRhRL2b_contig_1885379 2162886007 Bacteria 2599
3 JGI24744J21845_10084294 3300002077 Bacteria 582
4 JGI25406J46586_10017143 3300003203 Bacteria 3001
5 rootH2_10033320 3300003320 Bacteria 15868
6 rootL2_10100825 3300003322 Bacteria 5621
7 rootL2_10163037 3300003322 Bacteria 2758
8 JGI25405J52794_10025558 3300003911 Bacteria 1210
9 Ga0070676_10073744 3300005328 Bacteria 2054
10 Ga0070676_11012371 3300005328 Bacteria 624
11 Ga0070683_100845003 3300005329 Bacteria 878
12 Ga0070690_100949195 3300005330 Unclassified 675
13 Ga0068869_100028649 3300005334 Bacteria 3895
14 Ga0068869_101491791 3300005334 Bacteria 600
15 Ga0070682_100004876 3300005337 Bacteria 7447
16 Ga0070682_100048230 3300005337 Unclassified 2651
17 Ga0070682_100191579 3300005337 Bacteria 1436
18 Ga0070682_100500954 3300005337 Unclassified 941
19 Ga0070687_100301626 3300005343 Bacteria 1017
20 Ga0070692_10849888 3300005345 Unclassified 627
21 Ga0070669_100357366 3300005353 Bacteria 1187
22 Ga0070669_100474245 3300005353 Bacteria 1034
23 Ga0070675_100035665 3300005354 Bacteria 4043
24 Ga0070675_100537904 3300005354 Unclassified 1055
25 Ga0070671_100116430 3300005355 Bacteria 2247
26 Ga0070674_100017052 3300005356 Bacteria 4559
27 Ga0070674_100766233 3300005356 Unclassified 830
28 Ga0070673_100117056 3300005364 Bacteria 2217
29 Ga0070673_100600016 3300005364 Bacteria 1004
30 Ga0070659_100703014 3300005366 Unclassified 874
31 Ga0070701_10032997 3300005438 Bacteria 2583
32 Ga0070701_10316987 3300005438 Unclassified 964
33 Ga0070700_100011911 3300005441 Bacteria 4831
34 Ga0070700_100188023 3300005441 Bacteria 1442
35 Ga0070700_100484752 3300005441 Unclassified 948
36 Ga0070663_100722398 3300005455 Bacteria 848
37 Ga0070678_100291083 3300005456 Bacteria 1384
38 Ga0070662_100265442 3300005457 Bacteria 1384
39 Ga0070681_10027108 3300005458 Bacteria 5761
40 Ga0068867_100543549 3300005459 Bacteria 1005
41 Ga0068867_101118312 3300005459 Bacteria 720
42 Ga0070685_10292367 3300005466 Bacteria 1095
43 Ga0070672_100061374 3300005543 Unclassified 2963
44 Ga0070672_100084584 3300005543 Bacteria 2548
45 Ga0070672_100214419 3300005543 Bacteria 1613
46 Ga0070686_100792320 3300005544 Unclassified 763
47 Ga0070665_100002002 3300005548 Bacteria 22928
48 Ga0070665_100029017 3300005548 Bacteria 5569
49 Ga0070665_100342522 3300005548 Bacteria 1500
50 Ga0070665_100436644 3300005548 Unclassified 1318
51 Ga0070704_100245256 3300005549 Bacteria 1468
52 Ga0070664_100126469 3300005564 Unclassified 2243
53 Ga0070664_100472836 3300005564 Bacteria 1153
54 Ga0068857_100893241 3300005577 Unclassified 852
55 Ga0068854_100241986 3300005578 Bacteria 1437
56 Ga0068859_100577524 3300005617 Bacteria 1218
57 Ga0068859_100871263 3300005617 Bacteria 986
58 Ga0068864_100987508 3300005618 Unclassified 834
59 Ga0068866_10497901 3300005718 Unclassified 806
60 Ga0068861_100144563 3300005719 Bacteria 1945
61 Ga0068861_100524630 3300005719 Bacteria 1075
62 Ga0068861_100558063 3300005719 Bacteria 1045
63 Ga0068870_10059877 3300005840 Bacteria 2042
64 Ga0068858_100852373 3300005842 Bacteria 890
65 Ga0068862_100916037 3300005844 Unclassified 863
66 Ga0068862_101611798 3300005844 Unclassified 656
67 Ga0081455_10000192 3300005937 Bacteria 77713
68 Ga0081455_10297441 3300005937 Bacteria 1159
69 Ga0081539_10000011 3300005985 Bacteria 461887
70 Ga0097621_100716856 3300006237 Bacteria 922
71 Ga0068871_100064411 3300006358 Unclassified 3001
72 Ga0075428_100021494 3300006844 Bacteria 7141
73 Ga0075430_100928637 3300006846 Unclassified 717
74 Ga0075433_10000885 3300006852 Bacteria 21073
75 Ga0075434_100000099 3300006871 Bacteria 48394
76 Ga0068865_100077210 3300006881 Bacteria 2379
77 Ga0068865_100773773 3300006881 Bacteria 826
78 Ga0097620_100577533 3300006931 Bacteria 1218
79 Ga0097620_100718755 3300006931 Unclassified 1089
80 Ga0097620_100871390 3300006931 Bacteria 986
81 Ga0075435_100006124 3300007076 Bacteria 8477
82 Ga0105240_10011228 3300009093 Bacteria 12491
83 Ga0111539_10133293 3300009094 Bacteria 2909
84 Ga0111539_11177864 3300009094 Bacteria 890
85 Ga0114129_10186900 3300009147 Bacteria 2815
86 Ga0105243_11018315 3300009148 Unclassified 832
87 Ga0105243_12335257 3300009148 Bacteria 573
88 Ga0105242_10098936 3300009176 Unclassified 2468
89 Ga0105248_10340622 3300009177 Bacteria 1688
90 Ga0105237_10462251 3300009545 Bacteria 1275
91 Ga0105249_10120625 3300009553 Bacteria 2491
92 Ga0105249_10607368 3300009553 Bacteria 1149
93 Ga0163162_10222933 3300013306 Unclassified 2015
94 Ga0157375_10289137 3300013308 Unclassified 1802
95 Ga0157375_11734693 3300013308 Unclassified 740
96 Ga0163163_10061612 3300014325 Bacteria 3717
97 Ga0163163_10536278 3300014325 Unclassified 1233
98 Ga0163163_10541316 3300014325 Unclassified 1227
99 Ga0163163_10930214 3300014325 Bacteria 933
100 Ga0157380_10008004 3300014326 Bacteria 7528
101 Ga0157380_10037519 3300014326 Bacteria 3755
102 Ga0157379_11152022 3300014968 Unclassified 744
103 Ga0213874_10008412 3300021377 Bacteria 2515
104 Ga0207682_10003128 3300025893 Bacteria 7249
105 Ga0207682_10066538 3300025893 Unclassified 1519
106 Ga0207688_10266990 3300025901 Bacteria 1040
107 Ga0207645_10065311 3300025907 Bacteria 2325
108 Ga0207643_10067394 3300025908 Unclassified 2054
109 Ga0207707_10001227 3300025912 Bacteria 24068
110 Ga0207695_10012570 3300025913 Bacteria 10145
111 Ga0207695_10063974 3300025913 Bacteria 3790
112 Ga0207662_10368315 3300025918 Unclassified 968
113 Ga0207681_10318355 3300025923 Unclassified 1236
114 Ga0207659_10202499 3300025926 Bacteria 1586
115 Ga0207659_10301299 3300025926 Bacteria 1317
116 Ga0207644_10067405 3300025931 Bacteria 2609
117 Ga0207644_10166062 3300025931 Bacteria 1720
118 Ga0207690_10503465 3300025932 Bacteria 980
119 Ga0207706_10207275 3300025933 Bacteria 1719
120 Ga0207706_10728732 3300025933 Bacteria 846
121 Ga0207709_10420848 3300025935 Unclassified 1026
122 Ga0207669_10061349 3300025937 Bacteria 2310
123 Ga0207691_10000649 3300025940 Bacteria 34369
124 Ga0207691_10013130 3300025940 Bacteria 7929
125 Ga0207691_10218254 3300025940 Bacteria 1654
126 Ga0207711_10252838 3300025941 Bacteria 1618
127 Ga0207689_10014628 3300025942 Bacteria 6668
128 Ga0207689_10023211 3300025942 Bacteria 5208
129 Ga0207689_10637030 3300025942 Unclassified 898
130 Ga0207679_10136761 3300025945 Unclassified 1974
131 Ga0207679_10530868 3300025945 Bacteria 1054
132 Ga0207651_10635907 3300025960 Unclassified 936
133 Ga0207651_10696895 3300025960 Unclassified 894
134 Ga0207712_10040902 3300025961 Bacteria 3183
135 Ga0207668_10379311 3300025972 Bacteria 1190
136 Ga0207658_10290857 3300025986 Bacteria 1404
137 Ga0207678_10702621 3300026067 Unclassified 890
138 Ga0207708_10446899 3300026075 Bacteria 1076
139 Ga0207708_10543440 3300026075 Bacteria 979
140 Ga0207708_10609152 3300026075 Bacteria 926
141 Ga0207648_10394644 3300026089 Bacteria 1253
142 Ga0207648_10444059 3300026089 Bacteria 1180
143 Ga0207648_11700873 3300026089 Bacteria 592
144 Ga0207676_10168239 3300026095 Unclassified 1907
145 Ga0207675_100112390 3300026118 Bacteria 2571
146 Ga0207675_100129247 3300026118 Bacteria 2395
147 Ga0207675_100211235 3300026118 Bacteria 1866
148 Ga0207675_100484735 3300026118 Bacteria 1229
149 Ga0207675_100558083 3300026118 Bacteria 1145
150 Ga0207675_100860856 3300026118 Bacteria 922
151 Ga0207683_10053604 3300026121 Bacteria 3537
152 Ga0209967_1013489 3300027364 Bacteria 1160
153 Ga0207428_10142153 3300027907 Bacteria 1831
154 Ga0268266_10015691 3300028379 Bacteria 6490
155 Ga0268266_10321452 3300028379 Bacteria 1448
156 Ga0268265_10194644 3300028380 Bacteria 1754
157 Ga0268265_10205791 3300028380 Bacteria 1711
158 Ga0268265_10669771 3300028380 Bacteria 999
159 Ga0268265_10845871 3300028380 Bacteria 895
160 Ga0307515_10260324 3300028794 Unclassified 1472
161 Ga0307512_10183220 3300030522 Bacteria 1172
162 Ga0265340_10215893 3300031247 Bacteria 860
163 Ga0307513_10009513 3300031456 Bacteria 12291
164 Ga0307513_10045885 3300031456 Bacteria 4772
165 Ga0307513_10136055 3300031456 Bacteria 2392
166 Ga0307513_10695065 3300031456 Bacteria 723
167 Ga0307509_10407233 3300031507 Bacteria 1065
168 Ga0307408_100935064 3300031548 Bacteria 795
169 Ga0307514_10139751 3300031649 Bacteria 1649
170 Ga0307405_10000399 3300031731 Bacteria 16298
171 Ga0307413_10114431 3300031824 Bacteria 1813
172 Ga0307413_10125238 3300031824 Unclassified 1748
173 Ga0307410_10029856 3300031852 Bacteria 3477
174 Ga0307410_10145669 3300031852 Viruses 1757
175 Ga0326468_10004696 3300031889 Unclassified 1202
176 Ga0307406_10481151 3300031901 Bacteria 1003
177 Ga0307407_10536835 3300031903 Viruses 863
178 Ga0307412_10004926 3300031911 Bacteria 7459
179 Ga0307412_10065469 3300031911 Bacteria 2460
180 Ga0307409_100563341 3300031995 Bacteria 1120
181 Ga0307416_100037045 3300032002 Bacteria 3748
182 Ga0307416_100953412 3300032002 Bacteria 960
183 Ga0307414_10030136 3300032004 Bacteria 3541
184 Ga0307411_10040787 3300032005 Bacteria 2947
185 Ga0307411_10057805 3300032005 Bacteria 2564
186 Ga0307411_10974997 3300032005 Unclassified 757
187 Ga0307415_100007965 3300032126 Bacteria 5837
188 Ga0307415_100313486 3300032126 Bacteria 1305
189 Ga0373962_0151210 3300035242 Bacteria 760
190 Ga0373937_1181157 3300036401 Bacteria 714
191 Ga0436363_0183139 3300039450 Bacteria 10666
192 Ga0451791_1520986 3300041451 Bacteria 2430
193 Ga0451798_0915130 3300041458 Unclassified 2276
194 Ga0451800_0087101 3300041459 Bacteria 1623
195 Ga0451800_0155432 3300041459 Unclassified 612
196 Ga0451802_1033446 3300041460 Unclassified 688
197 Ga0451807_0987605 3300041486 Bacteria 2183
198 Ga0451853_1763004 3300041512 Unclassified 1151
199 Ga0451853_3179884 3300041512 Bacteria 913
200 Ga0451853_3193999 3300041512 Unclassified 637
201 Ga0439431_0174146 3300041997 Unclassified 619
202 Ga0439443_000799 3300042003 Bacteria 3131
203 Ga0439456_012107 3300042013 Bacteria 1788
204 Ga0450920_006823 3300042122 Bacteria 2058
205 Ga0450920_032224 3300042122 Bacteria 1034
206 Ga0450922_008674 3300042124 Bacteria 961
207 Ga0450923_000348 3300042125 Bacteria 4795
208 Ga0450923_009606 3300042125 Bacteria 1697
209 Ga0450923_091878 3300042125 Unclassified 692
210 Ga0450894_012119 3300042131 Bacteria 1125
211 Ga0450894_014992 3300042131 Bacteria 1025
212 Ga0450894_021352 3300042131 Bacteria 875
213 Ga0450895_001107 3300042132 Bacteria 1802
214 Ga0450896_003534 3300042133 Bacteria 2083
215 Ga0450896_005701 3300042133 Bacteria 1699
216 Ga0450898_001829 3300042134 Bacteria 2873
217 Ga0450907_052802 3300042146 Bacteria 699
218 Ga0450910_012608 3300042147 Bacteria 1223
219 Ga0439446_0000023 3300042156 Bacteria 27788
220 Ga0439446_0010956 3300042156 Bacteria 2452
221 Ga0450908_000668 3300042184 Bacteria 6605
222 Ga0450908_003184 3300042184 Bacteria 3194
223 Ga0439434_0198261 3300042435 Bacteria 676
224 Ga0439435_0000280 3300042436 Bacteria 7532
225 Ga0439444_0000217 3300042437 Bacteria 5552
226 Ga0439459_0073516 3300042438 Bacteria 795
227 Ga0439459_0159917 3300042438 Bacteria 594
228 Ga0439460_0001058 3300042461 Bacteria 6404
229 Ga0450918_006038 3300042531 Bacteria 2165
230 Ga0450918_021647 3300042531 Bacteria 1123
231 Ga0451577_0108444 3300042876 Bacteria 2482
232 Ga0466972_0114990 3300044658 Bacteria 1270
233 Ga0453684_1047566 3300044712 Unclassified 865
234 Ga0466959_0023251 3300045049 Bacteria 4587
235 Ga0495590_0044932 3300046457 Unclassified 1540
236 Ga0495638_0007791 3300046460 Bacteria 7647
237 Ga0495641_0171094 3300046461 Bacteria 972
238 Ga0495650_0118188 3300046471 Bacteria 978
239 Ga0495584_0166307 3300046491 Bacteria 1121
240 Ga0495616_0006791 3300046513 Bacteria 6897
241 Ga0495632_0069302 3300046519 Unclassified 1698
242 Ga0495621_0071044 3300046539 Unclassified 1282
243 Ga0495656_0408468 3300046615 Unclassified 711
244 Ga0495668_0220515 3300046616 Bacteria 1038
245 Ga0495668_0422310 3300046616 Unclassified 733
246 Ga0495625_0066065 3300046660 Unclassified 2548
247 Ga0495625_0089123 3300046660 Unclassified 2136
248 Ga0495625_0250133 3300046660 Bacteria 1151
249 Ga0495649_0002841 3300046694 Bacteria 12023
250 Ga0495589_0211143 3300046794 Bacteria 914
251 Ga0495686_0345438 3300047472 Bacteria 810
252 Ga0496108_0099589 3300048911 Unclassified 2478
253 Ga0501032_0062126 3300049569 Bacteria 2503
254 Ga0501033_0439850 3300049570 Bacteria 907
255 Ga0501034_0653489 3300049571 Bacteria 953
256 Ga0501036_0006211 3300049572 Bacteria 9690
257 Ga0501037_0091111 3300049573 Bacteria 2205
258 Ga0501037_0223804 3300049573 Unclassified 1323
259 Ga0501037_0832593 3300049573 Unclassified 608
260 Ga0501038_0032017 3300049574 Bacteria 4644
261 Ga0501039_0002229 3300049575 Bacteria 14343
262 Ga0501040_0006399 3300049576 Bacteria 7648
263 Ga0501040_0182445 3300049576 Bacteria 1488
264 Ga0501040_0536115 3300049576 Bacteria 844
265 Ga0501041_0017912 3300049577 Bacteria 4215
266 Ga0501042_0007040 3300049578 Bacteria 7345
267 Ga0501043_0181033 3300049579 Bacteria 1642
268 Ga0501046_1109253 3300049580 Unclassified 546
269 Ga0501048_0031188 3300049582 Bacteria 3856
270 Ga0501067_0289344 3300049583 Bacteria 912
271 Ga0501068_0052782 3300049584 Bacteria 2460
272 Ga0501068_0317858 3300049584 Bacteria 998
273 Ga0501069_0904211 3300049585 Bacteria 537
274 Ga0501071_0042525 3300049587 Bacteria 3256
275 Ga0501071_0855974 3300049587 Bacteria 701
276 Ga0501072_0084513 3300049588 Bacteria 2516
277 Ga0501072_0148950 3300049588 Bacteria 1866
278 Ga0501074_0043780 3300049590 Bacteria 3240
279 Ga0501075_0001728 3300049591 Bacteria 14345
280 Ga0501075_0225834 3300049591 Unclassified 1428
281 Ga0501076_0288972 3300049592 Bacteria 1343
282 Ga0501076_0436034 3300049592 Bacteria 1078
283 Ga0501079_0108128 3300049741 Bacteria 2159
284 Ga0501079_0139911 3300049741 Unclassified 1885
285 Ga0501080_0159170 3300049742 Bacteria 2086
286 Ga0501080_0793638 3300049742 Bacteria 831
287 Ga0501080_1523746 3300049742 Bacteria 568
288 Ga0501081_0068702 3300049743 Bacteria 2467
289 Ga0501081_0484006 3300049743 Bacteria 921
290 Ga0501035_0005386 3300049822 Bacteria 12102
291 Ga0501035_0871185 3300049822 Bacteria 715
292 Ga0501035_1126457 3300049822 Unclassified 612
293 Ga0501044_0625180 3300049823 Bacteria 968
294 Ga0501045_0003941 3300049824 Bacteria 10225
295 nmdc:mga00v17_864054_c1 3300050491 Bacteria 574
296 nmdc:mga0yw44_442529_c1 3300050492 Bacteria 880
297 nmdc:mga0qj67_857716_c1 3300050509 Unclassified 717
298 nmdc:mga08y16_38213_c1 3300050511 Bacteria 5042
299 nmdc:mga08y16_929067_c1 3300050511 Unclassified 854
300 nmdc:mga0n895_445_c1 3300050512 Bacteria 27685
301 nmdc:mga0rr50_40717_c1 3300050513 Bacteria 3380
302 nmdc:mga0a205_22397_c1 3300050515 Bacteria 5985
303 Ga0500644_0126480 3300053088 Bacteria 1002
304 Ga0500581_238976 3300053089 Unclassified 773
305 Ga0500583_0092342 3300053092 Bacteria 1474
306 Ga0500583_0328731 3300053092 Unclassified 744
307 Ga0500651_0171534 3300053093 Bacteria 1293
308 Ga0500556_0164180 3300053104 Bacteria 877
309 Ga0500594_0044216 3300053118 Unclassified 1231
310 Ga0500617_056688 3300053124 Bacteria 1740
311 Ga0500642_0059580 3300053130 Bacteria 1710
312 Ga0500658_0026434 3300053134 Bacteria 2236
313 Ga0500568_0141349 3300053139 Bacteria 892
314 Ga0500568_0159499 3300053139 Bacteria 832
315 Ga0500568_0189607 3300053139 Unclassified 755
316 Ga0500577_0225173 3300053142 Unclassified 812
317 Ga0500588_0003745 3300053146 Bacteria 3237
318 Ga0500588_0197311 3300053146 Bacteria 745
319 Ga0500589_144135 3300053147 Bacteria 977
320 Ga0500616_0000042 3300053153 Bacteria 351293
321 Ga0500616_0128790 3300053153 Bacteria 1198
322 Ga0500611_008862 3300053727 Bacteria 1573
323 Ga0501082_0063532 3300060353 Bacteria 3179
324 Ga0501082_0449088 3300060353 Unclassified 1126
325 Ga0466962_0337629 3300061719 Unclassified 749
326 rootH1_10035914
327 SwRhRL2b_contig_1885379
328 JGI24744J21845_10084294
329 JGI25406J46586_10017143
330 rootH2_10033320
331 rootL2_10100825
332 rootL2_10163037
333 JGI25405J52794_10025558
334 Ga0070676_10073744
335 Ga0070676_11012371
336 Ga0070683_100845003
337 Ga0070690_100949195
338 Ga0068869_100028649
339 Ga0068869_101491791
340 Ga0070682_100004876
341 Ga0070682_100048230
342 Ga0070682_100191579
343 Ga0070682_100500954
344 Ga0070687_100301626
345 Ga0070692_10849888
346 Ga0070669_100357366
347 Ga0070669_100474245
348 Ga0070675_100035665
349 Ga0070675_100537904
350 Ga0070671_100116430
351 Ga0070674_100017052
352 Ga0070674_100766233
353 Ga0070673_100117056
354 Ga0070673_100600016
355 Ga0070659_100703014
356 Ga0070701_10032997
357 Ga0070701_10316987
358 Ga0070700_100011911
359 Ga0070700_100188023
360 Ga0070700_100484752
361 Ga0070663_100722398
362 Ga0070678_100291083
363 Ga0070662_100265442
364 Ga0070681_10027108
365 Ga0068867_100543549
366 Ga0068867_101118312
367 Ga0070685_10292367
368 Ga0070672_100061374
369 Ga0070672_100084584
370 Ga0070672_100214419
371 Ga0070686_100792320
372 Ga0070665_100002002
373 Ga0070665_100029017
374 Ga0070665_100342522
375 Ga0070665_100436644
376 Ga0070704_100245256
377 Ga0070664_100126469
378 Ga0070664_100472836
379 Ga0068857_100893241
380 Ga0068854_100241986
381 Ga0068859_100577524
382 Ga0068859_100871263
383 Ga0068864_100987508
384 Ga0068866_10497901
385 Ga0068861_100144563
386 Ga0068861_100524630
387 Ga0068861_100558063
388 Ga0068870_10059877
389 Ga0068858_100852373
390 Ga0068862_100916037
391 Ga0068862_101611798
392 Ga0081455_10000192
393 Ga0081455_10297441
394 Ga0081539_10000011
395 Ga0097621_100716856
396 Ga0068871_100064411
397 Ga0075428_100021494
398 Ga0075430_100928637
399 Ga0075433_10000885
400 Ga0075434_100000099
401 Ga0068865_100077210
402 Ga0068865_100773773
403 Ga0097620_100577533
404 Ga0097620_100718755
405 Ga0097620_100871390
406 Ga0075435_100006124
407 Ga0105240_10011228
408 Ga0111539_10133293
409 Ga0111539_11177864
410 Ga0114129_10186900
411 Ga0105243_11018315
412 Ga0105243_12335257
413 Ga0105242_10098936
414 Ga0105248_10340622
415 Ga0105237_10462251
416 Ga0105249_10120625
417 Ga0105249_10607368
418 Ga0163162_10222933
419 Ga0157375_10289137
420 Ga0157375_11734693
421 Ga0163163_10061612
422 Ga0163163_10536278
423 Ga0163163_10541316
424 Ga0163163_10930214
425 Ga0157380_10008004
426 Ga0157380_10037519
427 Ga0157379_11152022
428 Ga0213874_10008412
429 Ga0207682_10003128
430 Ga0207682_10066538
431 Ga0207688_10266990
432 Ga0207645_10065311
433 Ga0207643_10067394
434 Ga0207707_10001227
435 Ga0207695_10012570
436 Ga0207695_10063974
437 Ga0207662_10368315
438 Ga0207681_10318355
439 Ga0207659_10202499
440 Ga0207659_10301299
441 Ga0207644_10067405
442 Ga0207644_10166062
443 Ga0207690_10503465
444 Ga0207706_10207275
445 Ga0207706_10728732
446 Ga0207709_10420848
447 Ga0207669_10061349
448 Ga0207691_10000649
449 Ga0207691_10013130
450 Ga0207691_10218254
451 Ga0207711_10252838
452 Ga0207689_10014628
453 Ga0207689_10023211
454 Ga0207689_10637030
455 Ga0207679_10136761
456 Ga0207679_10530868
457 Ga0207651_10635907
458 Ga0207651_10696895
459 Ga0207712_10040902
460 Ga0207668_10379311
461 Ga0207658_10290857
462 Ga0207678_10702621
463 Ga0207708_10446899
464 Ga0207708_10543440
465 Ga0207708_10609152
466 Ga0207648_10394644
467 Ga0207648_10444059
468 Ga0207648_11700873
469 Ga0207676_10168239
470 Ga0207675_100112390
471 Ga0207675_100129247
472 Ga0207675_100211235
473 Ga0207675_100484735
474 Ga0207675_100558083
475 Ga0207675_100860856
476 Ga0207683_10053604
477 Ga0209967_1013489
478 Ga0207428_10142153
479 Ga0268266_10015691
480 Ga0268266_10321452
481 Ga0268265_10194644
482 Ga0268265_10205791
483 Ga0268265_10669771
484 Ga0268265_10845871
485 Ga0307515_10260324
486 Ga0307512_10183220
487 Ga0265340_10215893
488 Ga0307513_10009513
489 Ga0307513_10045885
490 Ga0307513_10136055
491 Ga0307513_10695065
492 Ga0307509_10407233
493 Ga0307408_100935064
494 Ga0307514_10139751
495 Ga0307405_10000399
496 Ga0307413_10114431
497 Ga0307413_10125238
498 Ga0307410_10029856
499 Ga0307410_10145669
500 Ga0326468_10004696
501 Ga0307406_10481151
502 Ga0307407_10536835
503 Ga0307412_10004926
504 Ga0307412_10065469
505 Ga0307409_100563341
506 Ga0307416_100037045
507 Ga0307416_100953412
508 Ga0307414_10030136
509 Ga0307411_10040787
510 Ga0307411_10057805
511 Ga0307411_10974997
512 Ga0307415_100007965
513 Ga0307415_100313486
514 Ga0373962_0151210
515 Ga0373937_1181157
516 Ga0436363_0183139
517 Ga0451791_1520986
518 Ga0451798_0915130
519 Ga0451800_0087101
520 Ga0451800_0155432
521 Ga0451802_1033446
522 Ga0451807_0987605
523 Ga0451853_1763004
524 Ga0451853_3179884
525 Ga0451853_3193999
526 Ga0439431_0174146
527 Ga0439443_000799
528 Ga0439456_012107
529 Ga0450920_006823
530 Ga0450920_032224
531 Ga0450922_008674
532 Ga0450923_000348
533 Ga0450923_009606
534 Ga0450923_091878
535 Ga0450894_012119
536 Ga0450894_014992
537 Ga0450894_021352
538 Ga0450895_001107
539 Ga0450896_003534
540 Ga0450896_005701
541 Ga0450898_001829
542 Ga0450907_052802
543 Ga0450910_012608
544 Ga0439446_0000023
545 Ga0439446_0010956
546 Ga0450908_000668
547 Ga0450908_003184
548 Ga0439434_0198261
549 Ga0439435_0000280
550 Ga0439444_0000217
551 Ga0439459_0073516
552 Ga0439459_0159917
553 Ga0439460_0001058
554 Ga0450918_006038
555 Ga0450918_021647
556 Ga0451577_0108444
557 Ga0466972_0114990
558 Ga0453684_1047566
559 Ga0466959_0023251
560 Ga0495590_0044932
561 Ga0495638_0007791
562 Ga0495641_0171094
563 Ga0495650_0118188
564 Ga0495584_0166307
565 Ga0495616_0006791
566 Ga0495632_0069302
567 Ga0495621_0071044
568 Ga0495656_0408468
569 Ga0495668_0220515
570 Ga0495668_0422310
571 Ga0495625_0066065
572 Ga0495625_0089123
573 Ga0495625_0250133
574 Ga0495649_0002841
575 Ga0495589_0211143
576 Ga0495686_0345438
577 Ga0496108_0099589
578 Ga0501032_0062126
579 Ga0501033_0439850
580 Ga0501034_0653489
581 Ga0501036_0006211
582 Ga0501037_0091111
583 Ga0501037_0223804
584 Ga0501037_0832593
585 Ga0501038_0032017
586 Ga0501039_0002229
587 Ga0501040_0006399
588 Ga0501040_0182445
589 Ga0501040_0536115
590 Ga0501041_0017912
591 Ga0501042_0007040
592 Ga0501043_0181033
593 Ga0501046_1109253
594 Ga0501048_0031188
595 Ga0501067_0289344
596 Ga0501068_0052782
597 Ga0501068_0317858
598 Ga0501069_0904211
599 Ga0501071_0042525
600 Ga0501071_0855974
601 Ga0501072_0084513
602 Ga0501072_0148950
603 Ga0501074_0043780
604 Ga0501075_0001728
605 Ga0501075_0225834
606 Ga0501076_0288972
607 Ga0501076_0436034
608 Ga0501079_0108128
609 Ga0501079_0139911
610 Ga0501080_0159170
611 Ga0501080_0793638
612 Ga0501080_1523746
613 Ga0501081_0068702
614 Ga0501081_0484006
615 Ga0501035_0005386
616 Ga0501035_0871185
617 Ga0501035_1126457
618 Ga0501044_0625180
619 Ga0501045_0003941
620 nmdc:mga00v17_864054_c1
621 nmdc:mga0yw44_442529_c1
622 nmdc:mga0qj67_857716_c1
623 nmdc:mga08y16_38213_c1
624 nmdc:mga08y16_929067_c1
625 nmdc:mga0n895_445_c1
626 nmdc:mga0rr50_40717_c1
627 nmdc:mga0a205_22397_c1
628 Ga0500644_0126480
629 Ga0500581_238976
630 Ga0500583_0092342
631 Ga0500583_0328731
632 Ga0500651_0171534
633 Ga0500556_0164180
634 Ga0500594_0044216
635 Ga0500617_056688
636 Ga0500642_0059580
637 Ga0500658_0026434
638 Ga0500568_0141349
639 Ga0500568_0159499
640 Ga0500568_0189607
641 Ga0500577_0225173
642 Ga0500588_0003745
643 Ga0500588_0197311
644 Ga0500589_144135
645 Ga0500616_0000042
646 Ga0500616_0128790
647 Ga0500611_008862
648 Ga0501082_0063532
649 Ga0501082_0449088
650 Ga0466962_0337629

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3i4s-assembly1.cif.gz_B crystal structure of histidine triad protein blr8122 from bradyrhizobium japonicum 0.8699 27 149
3i24-assembly1.cif.gz_B crystal structure of a hit family hydrolase protein from vibrio fischeri. northeast structural genomics consortium target id vfr176 0.8425 27 151
2fhi-assembly1.cif.gz_A-2 substrate analog (ib2) complex with the his 96 asn substitution of the fragile histidine triad protein, fhit 0.8382 25 147
2oik-assembly2.cif.gz_D crystal structure of a histidine triad (hit) protein (mfla_2506) from methylobacillus flagellatus kt at 1.65 a resolution 0.8256 27 151
7p8p-assembly2.cif.gz_C crystal structure of fhit covalently bound to a nucleotide 0.8228 25 147
ID Description Score Start End Superfamily
af_A0A140LH01_2_105_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8963 26 109 3.30.428.10
af_P49775_3_108_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8893 26 113 3.30.428.10
3i4sB00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8699 27 149 3.30.428.10
1y23D01 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8542 18 112 3.30.428.10
af_E7FA20_1083_1232_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.8433 19 115 3.30.428.10
ID Description Score Start End GO Terms
AF-A0A127FAP0-F1-model_v4 HIT domain-containing protein 0.9827 16 149 GO:0003824
AF-A0A0S7Z606-F1-model_v4 VOC domain-containing protein 0.9818 10 152 GO:0003824
AF-A0A7W1AFA9-F1-model_v4 HIT domain-containing protein 0.9806 10 151 GO:0003824
AF-A0A534AZN2-F1-model_v4 HIT domain-containing protein 0.9784 10 152 GO:0003824
AF-A0A520YD17-F1-model_v4 HIT domain-containing protein 0.9679 9 152 GO:0003824

Map