F407571

General Info

Members Datasets Scaffolds Average Seq Length
324 148 648 97

Family's Representative Sequence

Representative Sequence 3300049589|Ga0501073_0271218|Ga0501073_0271218_721_1035
Length 104
Sequence MLDNATGHDHDHQPGDLHREPLPAWRPDFRPLHLPQTLLLGSIRLYQLTLSRAMPVNTCRFYPSCSRYGFEAVRRYGVFKGSLMAAWRVLRCNPFNPGGYDPVP

Samples

Sample ID Description Type Environment
1 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
2 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
3 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
19 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
20 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
21 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
22 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
23 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
30 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
41 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
54 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
55 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
68 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
69 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
70 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
71 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
72 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
73 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
74 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
75 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
76 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
77 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
78 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
79 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
80 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
81 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
82 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
83 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
84 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
85 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
86 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
87 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
88 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
89 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
90 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
91 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
92 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
93 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
94 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
96 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
97 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
98 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
99 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
100 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
101 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
102 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
103 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
104 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
105 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
106 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
107 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
108 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
109 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
110 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
111 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
112 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
113 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
114 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
116 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
119 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
120 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
121 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
122 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
123 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
124 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
125 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
126 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
127 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
128 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
129 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
130 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
131 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
132 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
133 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
134 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
135 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
136 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
137 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
138 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
139 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
140 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
141 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
142 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
143 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
144 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
145 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
146 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
147 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
148 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.91
Metatranscriptomes 3.09
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0
Rhizosphere 99.69
Stem 0
Stem Tuber 0
Unclassified 45.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501073_0271218 3300049589 Unclassified 1171
2 SwRhRL3b_contig_1286876 2162886006 Bacteria 936
3 SwRhRL2b_contig_1033251 2162886007 Bacteria 14331
4 Ga0065704_10107447 3300005289 Bacteria 2055
5 Ga0065704_10486542 3300005289 Unclassified 677
6 Ga0065712_10461183 3300005290 Unclassified 678
7 Ga0065715_10652854 3300005293 Unclassified 677
8 Ga0065707_10001174 3300005295 Bacteria 9963
9 Ga0065707_10280928 3300005295 Unclassified 1048
10 Ga0065707_10596151 3300005295 Unclassified 693
11 Ga0065707_10727513 3300005295 Unclassified 628
12 Ga0070690_101440664 3300005330 Unclassified 555
13 Ga0070670_102175227 3300005331 Unclassified 511
14 Ga0070689_101621972 3300005340 Unclassified 588
15 Ga0070705_100484083 3300005440 Unclassified 936
16 Ga0070694_100051955 3300005444 Bacteria 2769
17 Ga0070694_100306821 3300005444 Unclassified 1218
18 Ga0070694_100420425 3300005444 Unclassified 1050
19 Ga0070706_100232046 3300005467 Bacteria 1723
20 Ga0070706_100660804 3300005467 Bacteria 970
21 Ga0070707_100071039 3300005468 Unclassified 3354
22 Ga0070707_100355918 3300005468 Bacteria 1422
23 Ga0070698_100020927 3300005471 Bacteria 6854
24 Ga0070698_101142871 3300005471 Bacteria 727
25 Ga0070699_100018899 3300005518 Bacteria 5925
26 Ga0070699_100634718 3300005518 Unclassified 975
27 Ga0070684_101421516 3300005535 Bacteria 653
28 Ga0070697_100362369 3300005536 Bacteria 1253
29 Ga0070697_100624403 3300005536 Unclassified 948
30 Ga0070697_101245442 3300005536 Bacteria 663
31 Ga0070686_101193936 3300005544 Bacteria 632
32 Ga0070695_100064672 3300005545 Bacteria 2380
33 Ga0070695_101141157 3300005545 Unclassified 639
34 Ga0070696_100005760 3300005546 Bacteria 8271
35 Ga0070696_100384174 3300005546 Bacteria 1095
36 Ga0070696_100604990 3300005546 Bacteria 884
37 Ga0070693_100066463 3300005547 Unclassified 2110
38 Ga0070704_100011451 3300005549 Bacteria 5437
39 Ga0070704_101082036 3300005549 Bacteria 728
40 Ga0070704_102085716 3300005549 Bacteria 527
41 Ga0068857_100229695 3300005577 Unclassified 1697
42 Ga0070702_100214918 3300005615 Unclassified 1282
43 Ga0070702_100867465 3300005615 Unclassified 704
44 Ga0068859_100040694 3300005617 Bacteria 4666
45 Ga0068859_100394923 3300005617 Unclassified 1479
46 Ga0068859_101832831 3300005617 Unclassified 670
47 Ga0068861_101954947 3300005719 Unclassified 584
48 Ga0068863_100560272 3300005841 Bacteria 1129
49 Ga0068858_102579879 3300005842 Bacteria 502
50 Ga0068860_100514811 3300005843 Unclassified 1196
51 Ga0068860_101017844 3300005843 Unclassified 847
52 Ga0068860_102418595 3300005843 Bacteria 545
53 Ga0068862_100168409 3300005844 Unclassified 1960
54 Ga0068862_100440410 3300005844 Unclassified 1226
55 Ga0068862_102666010 3300005844 Unclassified 511
56 Ga0081539_10004539 3300005985 Bacteria 15230
57 Ga0070715_10844186 3300006163 Unclassified 559
58 Ga0075428_100006886 3300006844 Bacteria 12631
59 Ga0075428_101721400 3300006844 Unclassified 654
60 Ga0075430_100278300 3300006846 Unclassified 1385
61 Ga0075431_100728059 3300006847 Unclassified 968
62 Ga0075431_101127646 3300006847 Unclassified 748
63 Ga0075433_10136023 3300006852 Bacteria 2184
64 Ga0075434_100174780 3300006871 Bacteria 2167
65 Ga0075429_100041753 3300006880 Bacteria 3994
66 Ga0075429_100216891 3300006880 Bacteria 1676
67 Ga0075429_100449995 3300006880 Unclassified 1128
68 Ga0075436_100265240 3300006914 Bacteria 1225
69 Ga0097620_100040697 3300006931 Bacteria 4666
70 Ga0097620_100394945 3300006931 Unclassified 1479
71 Ga0097620_101833709 3300006931 Unclassified 670
72 Ga0075435_101827939 3300007076 Unclassified 533
73 Ga0111539_10205376 3300009094 Unclassified 2296
74 Ga0111539_13104120 3300009094 Unclassified 536
75 Ga0105245_11487199 3300009098 Unclassified 728
76 Ga0114129_10001125 3300009147 Bacteria 35324
77 Ga0114129_10098765 3300009147 Bacteria 4041
78 Ga0114129_10105716 3300009147 Bacteria 3889
79 Ga0114129_10108305 3300009147 Bacteria 3836
80 Ga0114129_10696234 3300009147 Bacteria 1306
81 Ga0114129_11515638 3300009147 Unclassified 823
82 Ga0105243_10039059 3300009148 Bacteria 3699
83 Ga0105243_10120830 3300009148 Bacteria 2208
84 Ga0105243_10837970 3300009148 Bacteria 910
85 Ga0105243_10936605 3300009148 Bacteria 864
86 Ga0105241_10332193 3300009174 Unclassified 1314
87 Ga0105242_10080158 3300009176 Bacteria 2728
88 Ga0105249_10388047 3300009553 Bacteria 1424
89 Ga0105249_10410420 3300009553 Unclassified 1386
90 Ga0105249_11173376 3300009553 Unclassified 839
91 Ga0105249_12948424 3300009553 Unclassified 546
92 Ga0105239_10873137 3300010375 Unclassified 1032
93 Ga0105246_10110463 3300011119 Bacteria 2019
94 Ga0105246_10512076 3300011119 Unclassified 1021
95 Ga0163163_13074392 3300014325 Bacteria 520
96 Ga0157380_11817577 3300014326 Unclassified 669
97 Ga0157379_12388500 3300014968 Unclassified 527
98 Ga0207643_10929723 3300025908 Unclassified 563
99 Ga0207643_10998656 3300025908 Bacteria 541
100 Ga0207684_10320776 3300025910 Bacteria 1335
101 Ga0207654_10392484 3300025911 Unclassified 963
102 Ga0207660_10911518 3300025917 Bacteria 717
103 Ga0207660_11139714 3300025917 Bacteria 635
104 Ga0207709_10119392 3300025935 Bacteria 1778
105 Ga0207709_11030123 3300025935 Bacteria 674
106 Ga0207670_10552297 3300025936 Bacteria 941
107 Ga0207670_10562020 3300025936 Unclassified 933
108 Ga0207689_10350760 3300025942 Bacteria 1227
109 Ga0207712_10853623 3300025961 Bacteria 803
110 Ga0207712_11674443 3300025961 Unclassified 570
111 Ga0207674_10070481 3300026116 Unclassified 3515
112 Ga0207674_10285207 3300026116 Bacteria 1600
113 Ga0207674_11131130 3300026116 Bacteria 752
114 Ga0207675_100107190 3300026118 Unclassified 2635
115 Ga0207675_101545263 3300026118 Bacteria 684
116 Ga0268265_10516514 3300028380 Unclassified 1128
117 Ga0268265_10658342 3300028380 Unclassified 1007
118 Ga0268265_11130591 3300028380 Bacteria 778
119 Ga0268265_11407358 3300028380 Unclassified 699
120 Ga0268264_10422392 3300028381 Unclassified 1286
121 Ga0265326_10058178 3300028558 Bacteria 1094
122 Ga0265334_10011777 3300028573 Unclassified 3676
123 Ga0265318_10045966 3300028577 Unclassified 1649
124 Ga0265322_10132580 3300028654 Unclassified 711
125 Ga0265322_10202938 3300028654 Unclassified 568
126 Ga0265324_10072075 3300029957 Unclassified 1177
127 Ga0265320_10030728 3300031240 Unclassified 2766
128 Ga0265340_10004961 3300031247 Bacteria 7398
129 Ga0265340_10142699 3300031247 Unclassified 1095
130 Ga0265340_10278613 3300031247 Unclassified 743
131 Ga0265331_10013066 3300031250 Unclassified 4473
132 Ga0265327_10013827 3300031251 Bacteria 5330
133 Ga0265316_10036826 3300031344 Unclassified 3955
134 Ga0265316_10399476 3300031344 Unclassified 990
135 Ga0307408_100613257 3300031548 Bacteria 968
136 Ga0307408_102406207 3300031548 Unclassified 511
137 Ga0316579_10104060 3300031691 Unclassified 1360
138 Ga0316579_10246193 3300031691 Bacteria 865
139 Ga0316576_10053123 3300031727 Bacteria 2952
140 Ga0316576_10204057 3300031727 Bacteria 1489
141 Ga0316576_10679110 3300031727 Unclassified 747
142 Ga0316576_10710355 3300031727 Unclassified 728
143 Ga0316576_10999835 3300031727 Unclassified 596
144 Ga0316576_11115485 3300031727 Unclassified 559
145 Ga0316578_10003144 3300031728 Bacteria 7464
146 Ga0316578_10015935 3300031728 Bacteria 4056
147 Ga0316578_10050086 3300031728 Unclassified 2443
148 Ga0316578_10155353 3300031728 Unclassified 1379
149 Ga0316578_10290678 3300031728 Unclassified 978
150 Ga0307405_10828087 3300031731 Bacteria 777
151 Ga0316577_10000154 3300031733 Bacteria 21296
152 Ga0316577_10003821 3300031733 Bacteria 7671
153 Ga0316577_10298109 3300031733 Unclassified 913
154 Ga0316577_10525659 3300031733 Unclassified 673
155 Ga0316577_10864856 3300031733 Unclassified 513
156 Ga0307413_10246411 3300031824 Bacteria 1323
157 Ga0307413_10599579 3300031824 Bacteria 901
158 Ga0307410_10813943 3300031852 Unclassified 795
159 Ga0307410_10903782 3300031852 Bacteria 756
160 Ga0307406_10763595 3300031901 Bacteria 813
161 Ga0307407_10036507 3300031903 Bacteria 2708
162 Ga0307407_10509818 3300031903 Bacteria 883
163 Ga0307407_10777856 3300031903 Bacteria 727
164 Ga0307412_10046225 3300031911 Bacteria 2851
165 Ga0307409_100323008 3300031995 Bacteria 1445
166 Ga0307409_100982258 3300031995 Unclassified 862
167 Ga0307414_10211390 3300032004 Bacteria 1586
168 Ga0307415_100524402 3300032126 Bacteria 1040
169 Ga0307415_101001811 3300032126 Bacteria 777
170 Ga0307415_102007108 3300032126 Bacteria 563
171 Ga0316585_10008274 3300032137 Bacteria 3015
172 Ga0316585_10185000 3300032137 Unclassified 688
173 Ga0316585_10186633 3300032137 Unclassified 685
174 Ga0316580_10073178 3300032139 Bacteria 1049
175 Ga0316580_10093876 3300032139 Unclassified 918
176 Ga0316593_10002018 3300032168 Unclassified 4685
177 Ga0316593_10003048 3300032168 Unclassified 4089
178 Ga0316593_10019232 3300032168 Bacteria 2109
179 Ga0316593_10022242 3300032168 Unclassified 1990
180 Ga0316593_10044123 3300032168 Unclassified 1491
181 Ga0316596_1001981 3300033541 Unclassified 4291
182 Ga0316596_1043785 3300033541 Bacteria 1179
183 Ga0316596_1045840 3300033541 Bacteria 1154
184 Ga0316596_1057160 3300033541 Bacteria 1038
185 Ga0316596_1094829 3300033541 Unclassified 805
186 Ga0373948_0181012 3300034817 Unclassified 541
187 Ga0373928_0178778 3300035084 Bacteria 602
188 Ga0373932_0273679 3300035112 Unclassified 622
189 Ga0373942_0068369 3300035207 Bacteria 1032
190 Ga0373961_0008501 3300035241 Bacteria 2497
191 Ga0373962_0251862 3300035242 Unclassified 613
192 Ga0316574_0000566 3300035398 Bacteria 15301
193 Ga0316574_0113199 3300035398 Bacteria 1740
194 Ga0316582_0000586 3300036647 Bacteria 14074
195 Ga0316582_0029839 3300036647 Unclassified 3315
196 Ga0316582_0613137 3300036647 Unclassified 749
197 Ga0316582_0780701 3300036647 Unclassified 655
198 Ga0316584_0000583 3300036712 Bacteria 19728
199 Ga0316584_0041147 3300036712 Bacteria 3445
200 Ga0316584_0055980 3300036712 Bacteria 2952
201 Ga0316584_0117065 3300036712 Bacteria 1993
202 Ga0316584_0284607 3300036712 Unclassified 1200
203 Ga0316584_0835129 3300036712 Bacteria 624
204 Ga0316584_0976739 3300036712 Unclassified 567
205 Ga0316581_0003446 3300037588 Bacteria 3936
206 Ga0400484_28749 3300038725 Bacteria 1555
207 Ga0451577_0037278 3300042876 Bacteria 4377
208 Ga0451577_0195109 3300042876 Bacteria 1827
209 Ga0451577_0277272 3300042876 Bacteria 1519
210 Ga0451577_0290095 3300042876 Unclassified 1482
211 Ga0451577_0337056 3300042876 Unclassified 1368
212 Ga0451577_0784178 3300042876 Unclassified 861
213 Ga0451577_0802780 3300042876 Bacteria 850
214 Ga0451577_0843029 3300042876 Unclassified 827
215 Ga0451577_1143400 3300042876 Unclassified 696
216 Ga0451577_1289091 3300042876 Unclassified 650
217 Ga0451577_1395648 3300042876 Unclassified 621
218 Ga0451577_1721077 3300042876 Bacteria 551
219 Ga0453683_0081963 3300044673 Bacteria 2021
220 Ga0453683_0327774 3300044673 Bacteria 982
221 Ga0453683_0609352 3300044673 Unclassified 712
222 Ga0453684_0000012 3300044712 Bacteria 1062512
223 Ga0453684_0000447 3300044712 Bacteria 166799
224 Ga0453684_0005397 3300044712 Bacteria 25381
225 Ga0453684_0007171 3300044712 Bacteria 20726
226 Ga0453684_0016721 3300044712 Bacteria 11440
227 Ga0453684_0023025 3300044712 Bacteria 9205
228 Ga0453684_0030402 3300044712 Bacteria 7632
229 Ga0453684_0062121 3300044712 Unclassified 4787
230 Ga0453684_0087836 3300044712 Bacteria 3852
231 Ga0453684_0091802 3300044712 Bacteria 3747
232 Ga0453684_0104923 3300044712 Bacteria 3449
233 Ga0453684_0113793 3300044712 Bacteria 3281
234 Ga0453684_0131516 3300044712 Bacteria 3002
235 Ga0453684_0179937 3300044712 Bacteria 2483
236 Ga0453684_0203678 3300044712 Unclassified 2305
237 Ga0453684_0304882 3300044712 Unclassified 1809
238 Ga0453684_0350913 3300044712 Unclassified 1663
239 Ga0453684_0414959 3300044712 Bacteria 1505
240 Ga0453684_0421191 3300044712 Bacteria 1491
241 Ga0453684_0439785 3300044712 Bacteria 1453
242 Ga0453684_0451990 3300044712 Bacteria 1430
243 Ga0453684_0453821 3300044712 Bacteria 1426
244 Ga0453684_0482792 3300044712 Unclassified 1374
245 Ga0453684_0553590 3300044712 Bacteria 1267
246 Ga0453684_0555757 3300044712 Unclassified 1264
247 Ga0453684_0579390 3300044712 Unclassified 1232
248 Ga0453684_0586204 3300044712 Unclassified 1224
249 Ga0453684_0618965 3300044712 Bacteria 1185
250 Ga0453684_0633309 3300044712 Bacteria 1168
251 Ga0453684_0637721 3300044712 Bacteria 1164
252 Ga0453684_0680197 3300044712 Unclassified 1120
253 Ga0453684_0770665 3300044712 Unclassified 1040
254 Ga0453684_0793255 3300044712 Bacteria 1022
255 Ga0453684_1146440 3300044712 Unclassified 819
256 Ga0453684_1690272 3300044712 Unclassified 647
257 Ga0453684_2324773 3300044712 Unclassified 532
258 Ga0453684_2578394 3300044712 Unclassified 500
259 Ga0451576_0039081 3300045051 Bacteria 5022
260 Ga0451576_0081854 3300045051 Bacteria 3357
261 Ga0451576_0087268 3300045051 Unclassified 3245
262 Ga0451576_0170079 3300045051 Bacteria 2274
263 Ga0451576_0193898 3300045051 Bacteria 2122
264 Ga0451576_0539420 3300045051 Bacteria 1226
265 Ga0451576_0865186 3300045051 Unclassified 949
266 Ga0495584_0339630 3300046491 Bacteria 763
267 Ga0495667_0398787 3300046559 Unclassified 867
268 Ga0501290_082168 3300049513 Bacteria 551
269 Ga0501300_066296 3300049523 Bacteria 578
270 Ga0501036_0596748 3300049572 Unclassified 916
271 Ga0501036_1629092 3300049572 Unclassified 521
272 Ga0501038_0492114 3300049574 Bacteria 939
273 Ga0501038_0733710 3300049574 Unclassified 738
274 Ga0501040_0414630 3300049576 Bacteria 968
275 Ga0501041_0212834 3300049577 Unclassified 1212
276 Ga0501043_0294608 3300049579 Unclassified 1241
277 Ga0501046_0865387 3300049580 Unclassified 631
278 Ga0501071_0080809 3300049587 Bacteria 2378
279 Ga0501072_0161252 3300049588 Bacteria 1789
280 Ga0501074_0045927 3300049590 Bacteria 3159
281 Ga0501074_0883757 3300049590 Bacteria 629
282 Ga0501075_0004325 3300049591 Bacteria 9611
283 Ga0501075_0680225 3300049591 Bacteria 784
284 Ga0501076_0038515 3300049592 Bacteria 3753
285 Ga0501076_0792050 3300049592 Bacteria 782
286 Ga0501077_0178678 3300049593 Bacteria 1349
287 Ga0501077_0400566 3300049593 Bacteria 877
288 Ga0501207_098234 3300049654 Unclassified 585
289 Ga0501227_075883 3300049665 Bacteria 877
290 Ga0501233_254125 3300049668 Bacteria 529
291 Ga0501250_016708 3300049680 Bacteria 914
292 Ga0501079_0257665 3300049741 Bacteria 1363
293 Ga0501080_0913436 3300049742 Unclassified 765
294 Ga0501081_0225025 3300049743 Bacteria 1365
295 Ga0501279_110399 3300049775 Unclassified 504
296 Ga0501282_039287 3300049778 Bacteria 561
297 Ga0501035_1038418 3300049822 Bacteria 643
298 Ga0501035_1491327 3300049822 Unclassified 516
299 Ga0501045_1067053 3300049824 Bacteria 591
300 Ga0501045_1384462 3300049824 Unclassified 511
301 nmdc:mga05p37_101744_c1 3300050507 Bacteria 3538
302 nmdc:mga05p37_1434114_c1 3300050507 Unclassified 693
303 nmdc:mga05p37_211088_c1 3300050507 Bacteria 2347
304 nmdc:mga05p37_2899_c1 3300050507 Bacteria 19898
305 nmdc:mga09592_1310721_c1 3300050508 Bacteria 595
306 nmdc:mga09592_39920_c1 3300050508 Unclassified 3943
307 nmdc:mga09592_669970_c1 3300050508 Unclassified 885
308 nmdc:mga0qj67_1006734_c1 3300050509 Unclassified 654
309 nmdc:mga0qj67_1534580_c1 3300050509 Bacteria 512
310 nmdc:mga0qj67_267823_c1 3300050509 Unclassified 1385
311 nmdc:mga0qj67_476725_c1 3300050509 Bacteria 1004
312 nmdc:mga06r32_1134925_c1 3300050510 Unclassified 730
313 nmdc:mga06r32_88300_c1 3300050510 Bacteria 3026
314 nmdc:mga06r32_991690_c1 3300050510 Unclassified 793
315 nmdc:mga08y16_55904_c1 3300050511 Unclassified 4124
316 nmdc:mga0n895_1615618_c1 3300050512 Unclassified 612
317 nmdc:mga0n895_939386_c1 3300050512 Unclassified 849
318 nmdc:mga08x19_786539_c1 3300050514 Unclassified 676
319 nmdc:mga0a205_68914_c1 3300050515 Bacteria 3416
320 Ga0501084_0006161 3300054114 Bacteria 9864
321 Ga0501084_0451295 3300054114 Bacteria 1087
322 Ga0590071_145451 3300059421 Bacteria 613
323 Ga0501082_0907030 3300060353 Bacteria 771
324 Ga0530510_0029054 3300061734 Bacteria 3967
325 Ga0501073_0271218
326 SwRhRL3b_contig_1286876
327 SwRhRL2b_contig_1033251
328 Ga0065704_10107447
329 Ga0065704_10486542
330 Ga0065712_10461183
331 Ga0065715_10652854
332 Ga0065707_10001174
333 Ga0065707_10280928
334 Ga0065707_10596151
335 Ga0065707_10727513
336 Ga0070690_101440664
337 Ga0070670_102175227
338 Ga0070689_101621972
339 Ga0070705_100484083
340 Ga0070694_100051955
341 Ga0070694_100306821
342 Ga0070694_100420425
343 Ga0070706_100232046
344 Ga0070706_100660804
345 Ga0070707_100071039
346 Ga0070707_100355918
347 Ga0070698_100020927
348 Ga0070698_101142871
349 Ga0070699_100018899
350 Ga0070699_100634718
351 Ga0070684_101421516
352 Ga0070697_100362369
353 Ga0070697_100624403
354 Ga0070697_101245442
355 Ga0070686_101193936
356 Ga0070695_100064672
357 Ga0070695_101141157
358 Ga0070696_100005760
359 Ga0070696_100384174
360 Ga0070696_100604990
361 Ga0070693_100066463
362 Ga0070704_100011451
363 Ga0070704_101082036
364 Ga0070704_102085716
365 Ga0068857_100229695
366 Ga0070702_100214918
367 Ga0070702_100867465
368 Ga0068859_100040694
369 Ga0068859_100394923
370 Ga0068859_101832831
371 Ga0068861_101954947
372 Ga0068863_100560272
373 Ga0068858_102579879
374 Ga0068860_100514811
375 Ga0068860_101017844
376 Ga0068860_102418595
377 Ga0068862_100168409
378 Ga0068862_100440410
379 Ga0068862_102666010
380 Ga0081539_10004539
381 Ga0070715_10844186
382 Ga0075428_100006886
383 Ga0075428_101721400
384 Ga0075430_100278300
385 Ga0075431_100728059
386 Ga0075431_101127646
387 Ga0075433_10136023
388 Ga0075434_100174780
389 Ga0075429_100041753
390 Ga0075429_100216891
391 Ga0075429_100449995
392 Ga0075436_100265240
393 Ga0097620_100040697
394 Ga0097620_100394945
395 Ga0097620_101833709
396 Ga0075435_101827939
397 Ga0111539_10205376
398 Ga0111539_13104120
399 Ga0105245_11487199
400 Ga0114129_10001125
401 Ga0114129_10098765
402 Ga0114129_10105716
403 Ga0114129_10108305
404 Ga0114129_10696234
405 Ga0114129_11515638
406 Ga0105243_10039059
407 Ga0105243_10120830
408 Ga0105243_10837970
409 Ga0105243_10936605
410 Ga0105241_10332193
411 Ga0105242_10080158
412 Ga0105249_10388047
413 Ga0105249_10410420
414 Ga0105249_11173376
415 Ga0105249_12948424
416 Ga0105239_10873137
417 Ga0105246_10110463
418 Ga0105246_10512076
419 Ga0163163_13074392
420 Ga0157380_11817577
421 Ga0157379_12388500
422 Ga0207643_10929723
423 Ga0207643_10998656
424 Ga0207684_10320776
425 Ga0207654_10392484
426 Ga0207660_10911518
427 Ga0207660_11139714
428 Ga0207709_10119392
429 Ga0207709_11030123
430 Ga0207670_10552297
431 Ga0207670_10562020
432 Ga0207689_10350760
433 Ga0207712_10853623
434 Ga0207712_11674443
435 Ga0207674_10070481
436 Ga0207674_10285207
437 Ga0207674_11131130
438 Ga0207675_100107190
439 Ga0207675_101545263
440 Ga0268265_10516514
441 Ga0268265_10658342
442 Ga0268265_11130591
443 Ga0268265_11407358
444 Ga0268264_10422392
445 Ga0265326_10058178
446 Ga0265334_10011777
447 Ga0265318_10045966
448 Ga0265322_10132580
449 Ga0265322_10202938
450 Ga0265324_10072075
451 Ga0265320_10030728
452 Ga0265340_10004961
453 Ga0265340_10142699
454 Ga0265340_10278613
455 Ga0265331_10013066
456 Ga0265327_10013827
457 Ga0265316_10036826
458 Ga0265316_10399476
459 Ga0307408_100613257
460 Ga0307408_102406207
461 Ga0316579_10104060
462 Ga0316579_10246193
463 Ga0316576_10053123
464 Ga0316576_10204057
465 Ga0316576_10679110
466 Ga0316576_10710355
467 Ga0316576_10999835
468 Ga0316576_11115485
469 Ga0316578_10003144
470 Ga0316578_10015935
471 Ga0316578_10050086
472 Ga0316578_10155353
473 Ga0316578_10290678
474 Ga0307405_10828087
475 Ga0316577_10000154
476 Ga0316577_10003821
477 Ga0316577_10298109
478 Ga0316577_10525659
479 Ga0316577_10864856
480 Ga0307413_10246411
481 Ga0307413_10599579
482 Ga0307410_10813943
483 Ga0307410_10903782
484 Ga0307406_10763595
485 Ga0307407_10036507
486 Ga0307407_10509818
487 Ga0307407_10777856
488 Ga0307412_10046225
489 Ga0307409_100323008
490 Ga0307409_100982258
491 Ga0307414_10211390
492 Ga0307415_100524402
493 Ga0307415_101001811
494 Ga0307415_102007108
495 Ga0316585_10008274
496 Ga0316585_10185000
497 Ga0316585_10186633
498 Ga0316580_10073178
499 Ga0316580_10093876
500 Ga0316593_10002018
501 Ga0316593_10003048
502 Ga0316593_10019232
503 Ga0316593_10022242
504 Ga0316593_10044123
505 Ga0316596_1001981
506 Ga0316596_1043785
507 Ga0316596_1045840
508 Ga0316596_1057160
509 Ga0316596_1094829
510 Ga0373948_0181012
511 Ga0373928_0178778
512 Ga0373932_0273679
513 Ga0373942_0068369
514 Ga0373961_0008501
515 Ga0373962_0251862
516 Ga0316574_0000566
517 Ga0316574_0113199
518 Ga0316582_0000586
519 Ga0316582_0029839
520 Ga0316582_0613137
521 Ga0316582_0780701
522 Ga0316584_0000583
523 Ga0316584_0041147
524 Ga0316584_0055980
525 Ga0316584_0117065
526 Ga0316584_0284607
527 Ga0316584_0835129
528 Ga0316584_0976739
529 Ga0316581_0003446
530 Ga0400484_28749
531 Ga0451577_0037278
532 Ga0451577_0195109
533 Ga0451577_0277272
534 Ga0451577_0290095
535 Ga0451577_0337056
536 Ga0451577_0784178
537 Ga0451577_0802780
538 Ga0451577_0843029
539 Ga0451577_1143400
540 Ga0451577_1289091
541 Ga0451577_1395648
542 Ga0451577_1721077
543 Ga0453683_0081963
544 Ga0453683_0327774
545 Ga0453683_0609352
546 Ga0453684_0000012
547 Ga0453684_0000447
548 Ga0453684_0005397
549 Ga0453684_0007171
550 Ga0453684_0016721
551 Ga0453684_0023025
552 Ga0453684_0030402
553 Ga0453684_0062121
554 Ga0453684_0087836
555 Ga0453684_0091802
556 Ga0453684_0104923
557 Ga0453684_0113793
558 Ga0453684_0131516
559 Ga0453684_0179937
560 Ga0453684_0203678
561 Ga0453684_0304882
562 Ga0453684_0350913
563 Ga0453684_0414959
564 Ga0453684_0421191
565 Ga0453684_0439785
566 Ga0453684_0451990
567 Ga0453684_0453821
568 Ga0453684_0482792
569 Ga0453684_0553590
570 Ga0453684_0555757
571 Ga0453684_0579390
572 Ga0453684_0586204
573 Ga0453684_0618965
574 Ga0453684_0633309
575 Ga0453684_0637721
576 Ga0453684_0680197
577 Ga0453684_0770665
578 Ga0453684_0793255
579 Ga0453684_1146440
580 Ga0453684_1690272
581 Ga0453684_2324773
582 Ga0453684_2578394
583 Ga0451576_0039081
584 Ga0451576_0081854
585 Ga0451576_0087268
586 Ga0451576_0170079
587 Ga0451576_0193898
588 Ga0451576_0539420
589 Ga0451576_0865186
590 Ga0495584_0339630
591 Ga0495667_0398787
592 Ga0501290_082168
593 Ga0501300_066296
594 Ga0501036_0596748
595 Ga0501036_1629092
596 Ga0501038_0492114
597 Ga0501038_0733710
598 Ga0501040_0414630
599 Ga0501041_0212834
600 Ga0501043_0294608
601 Ga0501046_0865387
602 Ga0501071_0080809
603 Ga0501072_0161252
604 Ga0501074_0045927
605 Ga0501074_0883757
606 Ga0501075_0004325
607 Ga0501075_0680225
608 Ga0501076_0038515
609 Ga0501076_0792050
610 Ga0501077_0178678
611 Ga0501077_0400566
612 Ga0501207_098234
613 Ga0501227_075883
614 Ga0501233_254125
615 Ga0501250_016708
616 Ga0501079_0257665
617 Ga0501080_0913436
618 Ga0501081_0225025
619 Ga0501279_110399
620 Ga0501282_039287
621 Ga0501035_1038418
622 Ga0501035_1491327
623 Ga0501045_1067053
624 Ga0501045_1384462
625 nmdc:mga05p37_101744_c1
626 nmdc:mga05p37_1434114_c1
627 nmdc:mga05p37_211088_c1
628 nmdc:mga05p37_2899_c1
629 nmdc:mga09592_1310721_c1
630 nmdc:mga09592_39920_c1
631 nmdc:mga09592_669970_c1
632 nmdc:mga0qj67_1006734_c1
633 nmdc:mga0qj67_1534580_c1
634 nmdc:mga0qj67_267823_c1
635 nmdc:mga0qj67_476725_c1
636 nmdc:mga06r32_1134925_c1
637 nmdc:mga06r32_88300_c1
638 nmdc:mga06r32_991690_c1
639 nmdc:mga08y16_55904_c1
640 nmdc:mga0n895_1615618_c1
641 nmdc:mga0n895_939386_c1
642 nmdc:mga08x19_786539_c1
643 nmdc:mga0a205_68914_c1
644 Ga0501084_0006161
645 Ga0501084_0451295
646 Ga0590071_145451
647 Ga0501082_0907030
648 Ga0530510_0029054

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01809

YidD

Putative membrane protein insertion efficiency factor

36

103

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7v2f-assembly1.cif.gz_m deactive state complex i from q10-nadh dataset 0.4586 23 78
7r4g-assembly1.cif.gz_J bovine complex i in the presence of im1761092, slack class ii (composite map) 0.4245 30 82
2qz4-assembly1.cif.gz_A human paraplegin, aaa domain in complex with adp 0.3634 14 91
5vmn-assembly1.cif.gz_A crystal structure of grouper iridovirus giv66 0.3216 16 77
7v2f-assembly1.cif.gz_m deactive state complex i from q10-nadh dataset 0.318 23 78
ID Description Score Start End Superfamily
af_P96855_573_711_1.20.140.10 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Butyryl-CoA Dehydrogenase, subunit A, domain 3 0.4282 16 93 1.20.140.10
af_F1R4B9_110_200_1.10.533.10 Mainly Alpha;Orthogonal Bundle;Death Domain, Fas;Death Domain, Fas 0.4206 32 85 1.10.533.10
af_Q20255_664_735_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.3918 30 82 1.25.40.10
af_Q4D6M2_17_368_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.3888 24 79 3.60.21.10
af_B3DKG3_25_169_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.3795 19 82 1.20.140.150
ID Description Score Start End GO Terms
AF-A0A7V9ACW2-F1-model_v4 Putative membrane protein insertion efficiency factor 0.8522 24 87 GO:0005886
AF-A0A1H9DRF4-F1-model_v4 Putative membrane protein insertion efficiency factor 0.8518 24 90 GO:0005886
AF-A0A7W1N3S2-F1-model_v4 Putative membrane protein insertion efficiency factor 0.8502 28 87 GO:0005886
AF-A0A3M2GZR3-F1-model_v4 Putative membrane protein insertion efficiency factor 0.8501 24 88 GO:0005886
AF-A0A2E6MYM3-F1-model_v4 Putative membrane protein insertion efficiency factor 0.8434 24 87 GO:0005886

Map