F406830
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 323 | 203 | 322 | 152 |
Family's Representative Sequence
| Representative Sequence | 3300005518|Ga0070699_100041083|Ga0070699_1000410836 |
| Length | 165 |
| Sequence | LKPRTRRALWIVSGLAALGLAAGLVLNAFQSNLVFFFTPSQVVANEAPRDRAFRVGGLVEAGSVVRDKDALTVRFRVTDTARTIPVVYSGILPDLFREGKGVVAQGRLGADGVFRASEVLAKHDENYMPPEAAEALRKAGHPMDKGAFAGQKAKPGVPVQTGPNK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 2 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 37 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 44 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 45 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 47 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 48 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 49 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 50 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 51 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 52 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 53 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 54 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 55 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 57 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 58 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 59 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 60 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 62 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 71 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 83 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 84 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 130 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 131 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 132 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 133 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 134 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 135 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 136 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 137 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 138 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 139 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 140 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 141 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 142 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 143 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 144 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 145 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 146 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 147 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 148 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 149 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 150 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 151 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 152 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 153 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 154 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 155 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 156 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 157 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 158 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 159 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 160 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 161 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 162 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 163 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 164 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 165 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 166 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 176 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 177 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 178 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 179 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 180 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 181 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 184 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 185 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 186 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 187 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 188 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 189 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 192 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 193 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 194 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 195 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 196 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 197 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 198 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 201 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 202 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 203 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.69 |
| Metatranscriptomes | 0 |
| Isolates | 0.31 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.17 |
| Nodule | 0 |
| Rhizoplane | 1.55 |
| Rhizosphere | 94.74 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.55 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0055540_1016849 | 3300003792 | Bacteria | 2059 |
| 2 | Ga0065707_10085167 | 3300005295 | Bacteria | 6390 |
| 3 | Ga0070658_10012401 | 3300005327 | Bacteria | 6838 |
| 4 | Ga0070658_10053539 | 3300005327 | Bacteria | 3276 |
| 5 | Ga0070676_10191311 | 3300005328 | Bacteria | 1336 |
| 6 | Ga0070683_100131909 | 3300005329 | Bacteria | 2365 |
| 7 | Ga0070683_100636449 | 3300005329 | Bacteria | 1021 |
| 8 | Ga0070690_100382024 | 3300005330 | Bacteria | 1030 |
| 9 | Ga0070690_100581926 | 3300005330 | Bacteria | 848 |
| 10 | Ga0070677_10121284 | 3300005333 | Bacteria | 1181 |
| 11 | Ga0068868_100329472 | 3300005338 | Bacteria | 1303 |
| 12 | Ga0070660_100434443 | 3300005339 | Bacteria | 1088 |
| 13 | Ga0070689_100014433 | 3300005340 | Bacteria | 5738 |
| 14 | Ga0070689_100719855 | 3300005340 | Bacteria | 873 |
| 15 | Ga0070689_101564896 | 3300005340 | Bacteria | 598 |
| 16 | Ga0070687_100228409 | 3300005343 | Bacteria | 1144 |
| 17 | Ga0070661_100551269 | 3300005344 | Bacteria | 927 |
| 18 | Ga0070668_100214731 | 3300005347 | Bacteria | 1584 |
| 19 | Ga0070669_100151230 | 3300005353 | Bacteria | 1797 |
| 20 | Ga0070675_100284888 | 3300005354 | Bacteria | 1453 |
| 21 | Ga0070675_100479152 | 3300005354 | Bacteria | 1119 |
| 22 | Ga0070674_100763856 | 3300005356 | Bacteria | 832 |
| 23 | Ga0070673_100091291 | 3300005364 | Bacteria | 2490 |
| 24 | Ga0070673_100306451 | 3300005364 | Bacteria | 1400 |
| 25 | Ga0070688_100172567 | 3300005365 | Bacteria | 1494 |
| 26 | Ga0070688_101042207 | 3300005365 | Bacteria | 652 |
| 27 | Ga0070688_101287339 | 3300005365 | Bacteria | 590 |
| 28 | Ga0070659_100288596 | 3300005366 | Bacteria | 1366 |
| 29 | Ga0070667_100915161 | 3300005367 | Bacteria | 817 |
| 30 | Ga0070709_10232733 | 3300005434 | Bacteria | 1319 |
| 31 | Ga0070714_100078923 | 3300005435 | Bacteria | 2862 |
| 32 | Ga0070714_100138037 | 3300005435 | Bacteria | 2186 |
| 33 | Ga0070713_100026620 | 3300005436 | Bacteria | 4543 |
| 34 | Ga0070710_10222648 | 3300005437 | Bacteria | 1201 |
| 35 | Ga0070710_10383608 | 3300005437 | Bacteria | 938 |
| 36 | Ga0070701_10083122 | 3300005438 | Bacteria | 1738 |
| 37 | Ga0070711_100210004 | 3300005439 | Bacteria | 1507 |
| 38 | Ga0070705_100398935 | 3300005440 | Bacteria | 1018 |
| 39 | Ga0070705_100632994 | 3300005440 | Bacteria | 832 |
| 40 | Ga0070700_100314486 | 3300005441 | Bacteria | 1148 |
| 41 | Ga0070700_100408502 | 3300005441 | Bacteria | 1023 |
| 42 | Ga0070678_100305271 | 3300005456 | Bacteria | 1354 |
| 43 | Ga0070662_100469994 | 3300005457 | Bacteria | 1046 |
| 44 | Ga0070681_10009569 | 3300005458 | Bacteria | 9532 |
| 45 | Ga0070681_10182378 | 3300005458 | Bacteria | 2020 |
| 46 | Ga0068867_100011005 | 3300005459 | Bacteria | 6378 |
| 47 | Ga0068867_100136062 | 3300005459 | Bacteria | 1915 |
| 48 | Ga0068867_100406471 | 3300005459 | Bacteria | 1150 |
| 49 | Ga0070699_100041083 | 3300005518 | Bacteria | 4003 |
| 50 | Ga0070699_100764599 | 3300005518 | Bacteria | 884 |
| 51 | Ga0070679_100103542 | 3300005530 | Bacteria | 2833 |
| 52 | Ga0070684_100267411 | 3300005535 | Bacteria | 1565 |
| 53 | Ga0070684_100493983 | 3300005535 | Bacteria | 1133 |
| 54 | Ga0070684_100511232 | 3300005535 | Bacteria | 1113 |
| 55 | Ga0068853_100034419 | 3300005539 | Bacteria | 4300 |
| 56 | Ga0070672_100231783 | 3300005543 | Bacteria | 1551 |
| 57 | Ga0070686_100516741 | 3300005544 | Bacteria | 929 |
| 58 | Ga0070696_101104286 | 3300005546 | Bacteria | 667 |
| 59 | Ga0070693_100002877 | 3300005547 | Bacteria | 7935 |
| 60 | Ga0070693_100070073 | 3300005547 | Bacteria | 2062 |
| 61 | Ga0070693_100332104 | 3300005547 | Bacteria | 1035 |
| 62 | Ga0070704_100205934 | 3300005549 | Bacteria | 1591 |
| 63 | Ga0070704_100216825 | 3300005549 | Bacteria | 1554 |
| 64 | Ga0070704_100635791 | 3300005549 | Bacteria | 941 |
| 65 | Ga0068855_100006898 | 3300005563 | Bacteria | 13776 |
| 66 | Ga0068855_100009692 | 3300005563 | Bacteria | 11627 |
| 67 | Ga0068855_100019481 | 3300005563 | Bacteria | 8153 |
| 68 | Ga0068855_100019994 | 3300005563 | Bacteria | 8041 |
| 69 | Ga0068855_100086376 | 3300005563 | Bacteria | 3627 |
| 70 | Ga0068855_100184688 | 3300005563 | Bacteria | 2356 |
| 71 | Ga0068854_100224022 | 3300005578 | Bacteria | 1489 |
| 72 | Ga0068854_101700575 | 3300005578 | Bacteria | 577 |
| 73 | Ga0068856_100039767 | 3300005614 | Bacteria | 4618 |
| 74 | Ga0070702_101235716 | 3300005615 | Bacteria | 604 |
| 75 | Ga0068852_100090321 | 3300005616 | Bacteria | 2739 |
| 76 | Ga0068852_100117252 | 3300005616 | Bacteria | 2431 |
| 77 | Ga0068852_100127613 | 3300005616 | Bacteria | 2338 |
| 78 | Ga0068852_100465558 | 3300005616 | Bacteria | 1254 |
| 79 | Ga0068859_100287557 | 3300005617 | Bacteria | 1737 |
| 80 | Ga0068866_10029507 | 3300005718 | Bacteria | 2624 |
| 81 | Ga0068866_10116302 | 3300005718 | Bacteria | 1500 |
| 82 | Ga0068861_100016929 | 3300005719 | Bacteria | 5168 |
| 83 | Ga0068861_101112420 | 3300005719 | Bacteria | 760 |
| 84 | Ga0068858_100004779 | 3300005842 | Bacteria | 13267 |
| 85 | Ga0068858_100146076 | 3300005842 | Bacteria | 2221 |
| 86 | Ga0068860_100002076 | 3300005843 | Bacteria | 21118 |
| 87 | Ga0075364_10172151 | 3300006051 | Bacteria | 1464 |
| 88 | Ga0075432_10479142 | 3300006058 | Bacteria | 551 |
| 89 | Ga0075366_10306518 | 3300006195 | Bacteria | 972 |
| 90 | Ga0097621_100086751 | 3300006237 | Bacteria | 2613 |
| 91 | Ga0097621_100184697 | 3300006237 | Bacteria | 1803 |
| 92 | Ga0068871_100062179 | 3300006358 | Bacteria | 3051 |
| 93 | Ga0075433_10398104 | 3300006852 | Bacteria | 1215 |
| 94 | Ga0075434_101681887 | 3300006871 | Bacteria | 642 |
| 95 | Ga0075436_100000522 | 3300006914 | Bacteria | 25028 |
| 96 | Ga0097620_100287580 | 3300006931 | Bacteria | 1737 |
| 97 | Ga0099795_10055784 | 3300007788 | Bacteria | 1451 |
| 98 | Ga0105240_10108151 | 3300009093 | Bacteria | 3369 |
| 99 | Ga0105240_10130023 | 3300009093 | Bacteria | 3021 |
| 100 | Ga0105240_10218937 | 3300009093 | Bacteria | 2219 |
| 101 | Ga0105240_10942285 | 3300009093 | Bacteria | 927 |
| 102 | Ga0105240_12550329 | 3300009093 | Bacteria | 528 |
| 103 | Ga0105245_10285838 | 3300009098 | Bacteria | 1614 |
| 104 | Ga0105245_10691952 | 3300009098 | Bacteria | 1052 |
| 105 | Ga0114129_10475941 | 3300009147 | Bacteria | 1635 |
| 106 | Ga0105241_10032594 | 3300009174 | Bacteria | 3907 |
| 107 | Ga0105241_10173734 | 3300009174 | Bacteria | 1781 |
| 108 | Ga0105241_10935083 | 3300009174 | Bacteria | 807 |
| 109 | Ga0105241_11245157 | 3300009174 | Bacteria | 706 |
| 110 | Ga0105242_10002434 | 3300009176 | Bacteria | 14624 |
| 111 | Ga0105242_10025903 | 3300009176 | Bacteria | 4645 |
| 112 | Ga0105242_10209473 | 3300009176 | Bacteria | 1736 |
| 113 | Ga0105242_10600397 | 3300009176 | Bacteria | 1063 |
| 114 | Ga0105242_11056056 | 3300009176 | Bacteria | 823 |
| 115 | Ga0105248_10096753 | 3300009177 | Bacteria | 3326 |
| 116 | Ga0105248_10800027 | 3300009177 | Bacteria | 1064 |
| 117 | Ga0105238_10113072 | 3300009551 | Bacteria | 2695 |
| 118 | Ga0105238_10284411 | 3300009551 | Bacteria | 1635 |
| 119 | Ga0105238_10447561 | 3300009551 | Bacteria | 1288 |
| 120 | Ga0105249_10026569 | 3300009553 | Bacteria | 5218 |
| 121 | Ga0105249_10988650 | 3300009553 | Bacteria | 910 |
| 122 | Ga0099796_10102756 | 3300010159 | Bacteria | 1077 |
| 123 | Ga0157370_10020147 | 3300013104 | Bacteria | 6666 |
| 124 | Ga0157370_11454172 | 3300013104 | Bacteria | 616 |
| 125 | Ga0157370_11590826 | 3300013104 | Bacteria | 587 |
| 126 | Ga0157369_10008819 | 3300013105 | Bacteria | 11553 |
| 127 | Ga0157369_11854701 | 3300013105 | Bacteria | 612 |
| 128 | Ga0157378_10056005 | 3300013297 | Bacteria | 3512 |
| 129 | Ga0157378_10501179 | 3300013297 | Bacteria | 1213 |
| 130 | Ga0163162_10005575 | 3300013306 | Bacteria | 12177 |
| 131 | Ga0163162_10023953 | 3300013306 | Bacteria | 6024 |
| 132 | Ga0163162_10529361 | 3300013306 | Bacteria | 1308 |
| 133 | Ga0157372_10003179 | 3300013307 | Bacteria | 17712 |
| 134 | Ga0157372_10426867 | 3300013307 | Bacteria | 1545 |
| 135 | Ga0157372_11464663 | 3300013307 | Bacteria | 787 |
| 136 | Ga0157375_10052688 | 3300013308 | Bacteria | 4001 |
| 137 | Ga0163163_11338823 | 3300014325 | Bacteria | 778 |
| 138 | Ga0157380_10535782 | 3300014326 | Bacteria | 1145 |
| 139 | Ga0157380_11408384 | 3300014326 | Bacteria | 748 |
| 140 | Ga0157380_11739942 | 3300014326 | Bacteria | 682 |
| 141 | Ga0157380_11777423 | 3300014326 | Bacteria | 675 |
| 142 | Ga0157379_10195591 | 3300014968 | Bacteria | 1827 |
| 143 | Ga0157376_10055172 | 3300014969 | Bacteria | 3315 |
| 144 | Ga0163161_10353262 | 3300017792 | Bacteria | 1169 |
| 145 | Ga0213872_10074644 | 3300021361 | Bacteria | 1526 |
| 146 | Ga0213876_10113448 | 3300021384 | Bacteria | 1438 |
| 147 | Ga0209051_1002911 | 3300025303 | Bacteria | 11739 |
| 148 | Ga0209051_1015732 | 3300025303 | Bacteria | 3466 |
| 149 | Ga0207682_10103546 | 3300025893 | Bacteria | 1247 |
| 150 | Ga0207692_10150384 | 3300025898 | Bacteria | 1333 |
| 151 | Ga0207692_10390833 | 3300025898 | Bacteria | 865 |
| 152 | Ga0207710_10480634 | 3300025900 | Bacteria | 643 |
| 153 | Ga0207645_10190150 | 3300025907 | Bacteria | 1349 |
| 154 | Ga0207705_10026611 | 3300025909 | Bacteria | 4124 |
| 155 | Ga0207654_10026745 | 3300025911 | Bacteria | 3128 |
| 156 | Ga0207654_10528464 | 3300025911 | Bacteria | 836 |
| 157 | Ga0207654_10904039 | 3300025911 | Bacteria | 640 |
| 158 | Ga0207707_10083924 | 3300025912 | Bacteria | 2782 |
| 159 | Ga0207707_10220727 | 3300025912 | Bacteria | 1650 |
| 160 | Ga0207695_10010543 | 3300025913 | Bacteria | 11299 |
| 161 | Ga0207695_10072503 | 3300025913 | Bacteria | 3513 |
| 162 | Ga0207695_10161417 | 3300025913 | Bacteria | 2172 |
| 163 | Ga0207695_10210660 | 3300025913 | Bacteria | 1854 |
| 164 | Ga0207695_11346958 | 3300025913 | Bacteria | 594 |
| 165 | Ga0207693_10179468 | 3300025915 | Bacteria | 1666 |
| 166 | Ga0207663_10044747 | 3300025916 | Bacteria | 2719 |
| 167 | Ga0207657_10288182 | 3300025919 | Bacteria | 1303 |
| 168 | Ga0207657_10566296 | 3300025919 | Bacteria | 888 |
| 169 | Ga0207649_10098246 | 3300025920 | Bacteria | 1932 |
| 170 | Ga0207649_10523094 | 3300025920 | Bacteria | 905 |
| 171 | Ga0207652_10059664 | 3300025921 | Bacteria | 3289 |
| 172 | Ga0207652_10106343 | 3300025921 | Bacteria | 2483 |
| 173 | Ga0207681_10126456 | 3300025923 | Bacteria | 1883 |
| 174 | Ga0207694_10012272 | 3300025924 | Bacteria | 6457 |
| 175 | Ga0207694_10107583 | 3300025924 | Bacteria | 2215 |
| 176 | Ga0207694_10402590 | 3300025924 | Bacteria | 1138 |
| 177 | Ga0207694_10447934 | 3300025924 | Bacteria | 1077 |
| 178 | Ga0207687_10367147 | 3300025927 | Bacteria | 1176 |
| 179 | Ga0207687_10447090 | 3300025927 | Bacteria | 1071 |
| 180 | Ga0207664_10128109 | 3300025929 | Bacteria | 2133 |
| 181 | Ga0207644_10536398 | 3300025931 | Bacteria | 968 |
| 182 | Ga0207690_10154790 | 3300025932 | Bacteria | 1703 |
| 183 | Ga0207706_10289728 | 3300025933 | Bacteria | 1427 |
| 184 | Ga0207686_10026438 | 3300025934 | Bacteria | 3385 |
| 185 | Ga0207686_10063102 | 3300025934 | Bacteria | 2355 |
| 186 | Ga0207686_10105818 | 3300025934 | Bacteria | 1887 |
| 187 | Ga0207686_10313587 | 3300025934 | Bacteria | 1169 |
| 188 | Ga0207709_10355054 | 3300025935 | Bacteria | 1108 |
| 189 | Ga0207670_10055935 | 3300025936 | Bacteria | 2669 |
| 190 | Ga0207670_10579312 | 3300025936 | Bacteria | 920 |
| 191 | Ga0207669_10034806 | 3300025937 | Bacteria | 2858 |
| 192 | Ga0207704_10401971 | 3300025938 | Bacteria | 1081 |
| 193 | Ga0207691_10015882 | 3300025940 | Bacteria | 7155 |
| 194 | Ga0207711_10024735 | 3300025941 | Bacteria | 5036 |
| 195 | Ga0207689_11646693 | 3300025942 | Bacteria | 533 |
| 196 | Ga0207661_10103145 | 3300025944 | Bacteria | 2400 |
| 197 | Ga0207661_10212238 | 3300025944 | Bacteria | 1707 |
| 198 | Ga0207667_10007028 | 3300025949 | Bacteria | 13598 |
| 199 | Ga0207667_10015924 | 3300025949 | Bacteria | 8515 |
| 200 | Ga0207667_10017769 | 3300025949 | Bacteria | 7999 |
| 201 | Ga0207667_10040469 | 3300025949 | Bacteria | 4963 |
| 202 | Ga0207667_10365062 | 3300025949 | Bacteria | 1472 |
| 203 | Ga0207667_10632680 | 3300025949 | Bacteria | 1077 |
| 204 | Ga0207651_10294610 | 3300025960 | Bacteria | 1347 |
| 205 | Ga0207712_10193485 | 3300025961 | Bacteria | 1607 |
| 206 | Ga0207668_10068534 | 3300025972 | Bacteria | 2523 |
| 207 | Ga0207640_10712173 | 3300025981 | Bacteria | 862 |
| 208 | Ga0207677_11852007 | 3300026023 | Bacteria | 560 |
| 209 | Ga0207703_10074906 | 3300026035 | Bacteria | 2804 |
| 210 | Ga0207703_10436311 | 3300026035 | Bacteria | 1221 |
| 211 | Ga0207703_11141672 | 3300026035 | Bacteria | 749 |
| 212 | Ga0207639_10021080 | 3300026041 | Bacteria | 4676 |
| 213 | Ga0207639_10107169 | 3300026041 | Bacteria | 2269 |
| 214 | Ga0207639_11023256 | 3300026041 | Bacteria | 774 |
| 215 | Ga0207708_10259942 | 3300026075 | Bacteria | 1401 |
| 216 | Ga0207708_10655810 | 3300026075 | Bacteria | 894 |
| 217 | Ga0207702_10627248 | 3300026078 | Bacteria | 1056 |
| 218 | Ga0207648_10002634 | 3300026089 | Bacteria | 19183 |
| 219 | Ga0207648_10015419 | 3300026089 | Bacteria | 7031 |
| 220 | Ga0207648_10090659 | 3300026089 | Bacteria | 2671 |
| 221 | Ga0207648_10172739 | 3300026089 | Bacteria | 1911 |
| 222 | Ga0207675_100008746 | 3300026118 | Bacteria | 9511 |
| 223 | Ga0207675_100974647 | 3300026118 | Bacteria | 866 |
| 224 | Ga0207675_101279145 | 3300026118 | Bacteria | 754 |
| 225 | Ga0207683_10019538 | 3300026121 | Bacteria | 5786 |
| 226 | Ga0207683_10394982 | 3300026121 | Bacteria | 1272 |
| 227 | Ga0207683_11145158 | 3300026121 | Bacteria | 721 |
| 228 | Ga0207698_10007350 | 3300026142 | Bacteria | 6904 |
| 229 | Ga0207698_10065524 | 3300026142 | Bacteria | 2854 |
| 230 | Ga0207698_10191024 | 3300026142 | Bacteria | 1824 |
| 231 | Ga0268264_10005310 | 3300028381 | Bacteria | 10907 |
| 232 | Ga0307517_10543439 | 3300028786 | Bacteria | 582 |
| 233 | Ga0307515_10000026 | 3300028794 | Bacteria | 382411 |
| 234 | Ga0265328_10007489 | 3300031239 | Bacteria | 4547 |
| 235 | Ga0265328_10022354 | 3300031239 | Bacteria | 2407 |
| 236 | Ga0265339_10150535 | 3300031249 | Bacteria | 1177 |
| 237 | Ga0265331_10000055 | 3300031250 | Bacteria | 177693 |
| 238 | Ga0265331_10291344 | 3300031250 | Bacteria | 731 |
| 239 | Ga0265327_10000045 | 3300031251 | Bacteria | 282880 |
| 240 | Ga0265327_10000174 | 3300031251 | Bacteria | 138922 |
| 241 | Ga0265316_10000391 | 3300031344 | Bacteria | 50025 |
| 242 | Ga0307408_100007603 | 3300031548 | Bacteria | 7167 |
| 243 | Ga0307408_100346593 | 3300031548 | Bacteria | 1259 |
| 244 | Ga0265314_10064196 | 3300031711 | Bacteria | 2488 |
| 245 | Ga0307405_10026779 | 3300031731 | Bacteria | 3332 |
| 246 | Ga0307413_10031916 | 3300031824 | Bacteria | 2978 |
| 247 | Ga0307410_10002137 | 3300031852 | Bacteria | 9390 |
| 248 | Ga0307410_10861175 | 3300031852 | Bacteria | 774 |
| 249 | Ga0307406_10009643 | 3300031901 | Bacteria | 5426 |
| 250 | Ga0307407_10055157 | 3300031903 | Bacteria | 2295 |
| 251 | Ga0307412_10205271 | 3300031911 | Bacteria | 1499 |
| 252 | Ga0307409_100000504 | 3300031995 | Bacteria | 16863 |
| 253 | Ga0307411_10004100 | 3300032005 | Bacteria | 6910 |
| 254 | Ga0373944_0039904 | 3300035089 | Bacteria | 1447 |
| 255 | Ga0373956_0326860 | 3300035119 | Bacteria | 731 |
| 256 | Ga0373931_0021627 | 3300035691 | Bacteria | 3228 |
| 257 | Ga0373927_0043199 | 3300035695 | Bacteria | 2919 |
| 258 | Ga0373947_0128779 | 3300035725 | Bacteria | 1614 |
| 259 | Ga0373925_0038419 | 3300037068 | Bacteria | 3539 |
| 260 | Ga0373925_0077326 | 3300037068 | Bacteria | 2525 |
| 261 | Ga0395900_0023944 | 3300037418 | Bacteria | 6248 |
| 262 | Ga0395905_0053119 | 3300037471 | Bacteria | 3793 |
| 263 | Ga0395905_0693783 | 3300037471 | Bacteria | 920 |
| 264 | Ga0395901_0076280 | 3300038443 | Bacteria | 3497 |
| 265 | Ga0436365_0442840 | 3300039437 | Bacteria | 4126 |
| 266 | Ga0436360_0483908 | 3300039438 | Bacteria | 1307 |
| 267 | Ga0436361_0218235 | 3300039447 | Bacteria | 3714 |
| 268 | Ga0439447_060258 | 3300041407 | Bacteria | 894 |
| 269 | Ga0439450_115053 | 3300042008 | Bacteria | 690 |
| 270 | Ga0451577_0049379 | 3300042876 | Bacteria | 3757 |
| 271 | Ga0466966_0214348 | 3300044684 | Bacteria | 1163 |
| 272 | Ga0466959_0205098 | 3300045049 | Bacteria | 1372 |
| 273 | Ga0451576_0233595 | 3300045051 | Bacteria | 1920 |
| 274 | Ga0466958_0220268 | 3300045836 | Bacteria | 1210 |
| 275 | Ga0466967_1185504 | 3300045976 | Bacteria | 761 |
| 276 | Ga0495607_0001481 | 3300046501 | Bacteria | 20860 |
| 277 | Ga0495643_0024638 | 3300046522 | Bacteria | 3411 |
| 278 | Ga0495648_0038721 | 3300046524 | Bacteria | 3044 |
| 279 | Ga0495663_0145944 | 3300046525 | Bacteria | 805 |
| 280 | Ga0495586_0375339 | 3300046535 | Bacteria | 817 |
| 281 | Ga0495621_0009892 | 3300046539 | Bacteria | 2910 |
| 282 | Ga0495621_0122553 | 3300046539 | Bacteria | 1006 |
| 283 | Ga0495661_0003784 | 3300046665 | Bacteria | 11079 |
| 284 | Ga0495647_0168060 | 3300046681 | Bacteria | 948 |
| 285 | Ga0495613_0899951 | 3300046689 | Bacteria | 573 |
| 286 | Ga0496104_0326624 | 3300048907 | Bacteria | 1447 |
| 287 | Ga0496105_0464614 | 3300048908 | Bacteria | 997 |
| 288 | Ga0496108_0064565 | 3300048911 | Bacteria | 3084 |
| 289 | Ga0496109_0213802 | 3300048912 | Bacteria | 1813 |
| 290 | Ga0496112_0331048 | 3300048915 | Bacteria | 1467 |
| 291 | Ga0496125_0110640 | 3300048928 | Bacteria | 1991 |
| 292 | Ga0501034_0582432 | 3300049571 | Bacteria | 1026 |
| 293 | Ga0501047_0006119 | 3300049581 | Bacteria | 11307 |
| 294 | Ga0501047_0225850 | 3300049581 | Bacteria | 1727 |
| 295 | Ga0501047_0683853 | 3300049581 | Bacteria | 844 |
| 296 | Ga0501067_0183623 | 3300049583 | Bacteria | 1165 |
| 297 | Ga0501069_0004773 | 3300049585 | Bacteria | 7015 |
| 298 | Ga0501070_0027840 | 3300049586 | Bacteria | 4740 |
| 299 | Ga0501070_0235145 | 3300049586 | Bacteria | 1501 |
| 300 | Ga0501070_0709154 | 3300049586 | Bacteria | 795 |
| 301 | Ga0501072_0421094 | 3300049588 | Bacteria | 1058 |
| 302 | Ga0501073_0006933 | 3300049589 | Bacteria | 8435 |
| 303 | Ga0501073_0241327 | 3300049589 | Bacteria | 1248 |
| 304 | Ga0501074_0000154 | 3300049590 | Bacteria | 35857 |
| 305 | Ga0501074_0275600 | 3300049590 | Bacteria | 1196 |
| 306 | Ga0501079_0001763 | 3300049741 | Bacteria | 15436 |
| 307 | Ga0501080_0005032 | 3300049742 | Bacteria | 11775 |
| 308 | Ga0501080_0141828 | 3300049742 | Bacteria | 2221 |
| 309 | Ga0501083_0000323 | 3300049744 | Bacteria | 30331 |
| 310 | Ga0501044_0028237 | 3300049823 | Bacteria | 5923 |
| 311 | Ga0501044_0155307 | 3300049823 | Bacteria | 2268 |
| 312 | nmdc:mga00v17_672451_c1 | 3300050491 | Bacteria | 665 |
| 313 | nmdc:mga0k408_197626_c1 | 3300050493 | Bacteria | 1200 |
| 314 | nmdc:mga05p37_535821_c1 | 3300050507 | Bacteria | 1336 |
| 315 | nmdc:mga0rr50_231637_c1 | 3300050513 | Bacteria | 1528 |
| 316 | nmdc:mga0a205_425471_c1 | 3300050515 | Bacteria | 1190 |
| 317 | Ga0495601_0704373 | 3300053077 | Bacteria | 644 |
| 318 | Ga0495595_0224348 | 3300053084 | Bacteria | 938 |
| 319 | Ga0501084_0189080 | 3300054114 | Bacteria | 1737 |
| 320 | Ga0501084_1119060 | 3300054114 | Bacteria | 661 |
| 321 | Ga0501082_0219208 | 3300060353 | Bacteria | 1655 |
| 322 | Ga0466962_0390367 | 3300061719 | Bacteria | 696 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049589 | Ga0501073_0241327 | Ga0501073_0241327_353_832 | 133 |
| 2 | 3300049571 | Ga0501034_0582432 | Ga0501034_0582432_310_720 | 134 |
| 3 | 3300054114 | Ga0501084_1119060 | Ga0501084_1119060_50_460 | 134 |
| 4 | 3300046525 | Ga0495663_0145944 | Ga0495663_0145944_102_515 | 135 |
| 5 | 3300048907 | Ga0496104_0326624 | Ga0496104_0326624_79_549 | 135 |
| 6 | 3300048908 | Ga0496105_0464614 | Ga0496105_0464614_507_977 | 135 |
| 7 | 3300035119 | Ga0373956_0326860 | Ga0373956_0326860_184_648 | 136 |
| 8 | 3300046689 | Ga0495613_0899951 | Ga0495613_0899951_92_556 | 136 |
| 9 | 3300053077 | Ga0495601_0704373 | Ga0495601_0704373_157_621 | 136 |
| 10 | 3300053084 | Ga0495595_0224348 | Ga0495595_0224348_205_669 | 136 |
| 11 | 3300009093 | Ga0105240_10218937 | Ga0105240_102189372 | 139 |
| 12 | 3300009551 | Ga0105238_10113072 | Ga0105238_101130723 | 139 |
| 13 | 3300013104 | Ga0157370_11454172 | Ga0157370_114541721 | 139 |
| 14 | 3300013105 | Ga0157369_10008819 | Ga0157369_100088192 | 139 |
| 15 | 3300013307 | Ga0157372_10003179 | Ga0157372_1000317911 | 139 |
| 16 | 3300046539 | Ga0495621_0009892 | Ga0495621_0009892_1171_1617 | 140 |
| 17 | 3300031249 | Ga0265339_10150535 | Ga0265339_101505352 | 141 |
| 18 | 3300031250 | Ga0265331_10291344 | Ga0265331_102913441 | 141 |
| 19 | 3300031548 | Ga0307408_100007603 | Ga0307408_1000076033 | 141 |
| 20 | 3300031711 | Ga0265314_10064196 | Ga0265314_100641962 | 141 |
| 21 | 3300031731 | Ga0307405_10026779 | Ga0307405_100267793 | 141 |
| 22 | 3300031824 | Ga0307413_10031916 | Ga0307413_100319163 | 141 |
| 23 | 3300031852 | Ga0307410_10002137 | Ga0307410_100021379 | 141 |
| 24 | 3300031901 | Ga0307406_10009643 | Ga0307406_100096433 | 141 |
| 25 | 3300031903 | Ga0307407_10055157 | Ga0307407_100551574 | 141 |
| 26 | 3300031911 | Ga0307412_10205271 | Ga0307412_102052712 | 141 |
| 27 | 3300031995 | Ga0307409_100000504 | Ga0307409_10000050417 | 141 |
| 28 | 3300032005 | Ga0307411_10004100 | Ga0307411_100041006 | 141 |
| 29 | 3300005563 | Ga0068855_100184688 | Ga0068855_1001846882 | 142 |
| 30 | 3300025949 | Ga0207667_10365062 | Ga0207667_103650622 | 142 |
| 31 | 3300037418 | Ga0395900_0023944 | Ga0395900_0023944_4388_4822 | 142 |
| 32 | 3300037471 | Ga0395905_0053119 | Ga0395905_0053119_474_908 | 142 |
| 33 | 3300038443 | Ga0395901_0076280 | Ga0395901_0076280_1893_2327 | 142 |
| 34 | 3300045049 | Ga0466959_0205098 | Ga0466959_0205098_425_859 | 142 |
| 35 | 3300045836 | Ga0466958_0220268 | Ga0466958_0220268_478_912 | 142 |
| 36 | 3300050515 | nmdc:mga0a205_425471_c1 | nmdc:mga0a205_425471_c1_589_1023 | 142 |
| 37 | 3300061719 | Ga0466962_0390367 | Ga0466962_0390367_125_559 | 142 |
| 38 | 3300009174 | Ga0105241_11245157 | Ga0105241_112451572 | 143 |
| 39 | 3300009176 | Ga0105242_10025903 | Ga0105242_100259034 | 143 |
| 40 | 3300009176 | Ga0105242_10209473 | Ga0105242_102094732 | 143 |
| 41 | 3300013297 | Ga0157378_10501179 | Ga0157378_105011792 | 143 |
| 42 | 3300025934 | Ga0207686_10063102 | Ga0207686_100631022 | 143 |
| 43 | 3300009093 | Ga0105240_12550329 | Ga0105240_125503291 | 144 |
| 44 | 3300009174 | Ga0105241_10032594 | Ga0105241_100325946 | 144 |
| 45 | 3300013104 | Ga0157370_11590826 | Ga0157370_115908261 | 144 |
| 46 | 3300013306 | Ga0163162_10529361 | Ga0163162_105293613 | 144 |
| 47 | 3300014326 | Ga0157380_11739942 | Ga0157380_117399421 | 144 |
| 48 | 3300025900 | Ga0207710_10480634 | Ga0207710_104806342 | 144 |
| 49 | 3300049581 | Ga0501047_0006119 | Ga0501047_0006119_1610_2050 | 144 |
| 50 | 3300049581 | Ga0501047_0683853 | Ga0501047_0683853_98_538 | 144 |
| 51 | 3300049583 | Ga0501067_0183623 | Ga0501067_0183623_62_502 | 144 |
| 52 | 3300049585 | Ga0501069_0004773 | Ga0501069_0004773_2678_3118 | 144 |
| 53 | 3300049586 | Ga0501070_0027840 | Ga0501070_0027840_30_470 | 144 |
| 54 | 3300049586 | Ga0501070_0709154 | Ga0501070_0709154_90_530 | 144 |
| 55 | 3300049588 | Ga0501072_0421094 | Ga0501072_0421094_398_838 | 144 |
| 56 | 3300049589 | Ga0501073_0006933 | Ga0501073_0006933_3597_4037 | 144 |
| 57 | 3300049590 | Ga0501074_0000154 | Ga0501074_0000154_9083_9523 | 144 |
| 58 | 3300049741 | Ga0501079_0001763 | Ga0501079_0001763_729_1169 | 144 |
| 59 | 3300049742 | Ga0501080_0005032 | Ga0501080_0005032_5399_5839 | 144 |
| 60 | 3300049744 | Ga0501083_0000323 | Ga0501083_0000323_27028_27468 | 144 |
| 61 | 3300049823 | Ga0501044_0028237 | Ga0501044_0028237_2757_3197 | 144 |
| 62 | 3300054114 | Ga0501084_0189080 | Ga0501084_0189080_879_1319 | 144 |
| 63 | 3300060353 | Ga0501082_0219208 | Ga0501082_0219208_1004_1444 | 144 |
| 64 | 3300009098 | Ga0105245_10285838 | Ga0105245_102858381 | 145 |
| 65 | 3300009174 | Ga0105241_10935083 | Ga0105241_109350832 | 145 |
| 66 | 3300009177 | Ga0105248_10096753 | Ga0105248_100967532 | 145 |
| 67 | 3300013297 | Ga0157378_10056005 | Ga0157378_100560052 | 145 |
| 68 | 3300013306 | Ga0163162_10023953 | Ga0163162_100239536 | 145 |
| 69 | 3300014325 | Ga0163163_11338823 | Ga0163163_113388232 | 145 |
| 70 | 3300014969 | Ga0157376_10055172 | Ga0157376_100551726 | 145 |
| 71 | 3300031852 | Ga0307410_10861175 | Ga0307410_108611752 | 145 |
| 72 | 3300041407 | Ga0439447_060258 | Ga0439447_060258_432_875 | 145 |
| 73 | 3300050513 | nmdc:mga0rr50_231637_c1 | nmdc:mga0rr50_231637_c1_763_1206 | 145 |
| 74 | iso_pu_bacteria | 8047673197 | 8047677101 | 145 |
| 75 | 3300009553 | Ga0105249_10988650 | Ga0105249_109886501 | 146 |
| 76 | 3300021384 | Ga0213876_10113448 | Ga0213876_101134483 | 146 |
| 77 | 3300037068 | Ga0373925_0038419 | Ga0373925_0038419_2609_3061 | 146 |
| 78 | 3300039437 | Ga0436365_0442840 | Ga0436365_0442840_1448_1894 | 146 |
| 79 | 3300014326 | Ga0157380_11777423 | Ga0157380_117774232 | 147 |
| 80 | 3300042008 | Ga0439450_115053 | Ga0439450_115053_16_474 | 147 |
| 81 | 3300046501 | Ga0495607_0001481 | Ga0495607_0001481_8423_8881 | 147 |
| 82 | 3300046522 | Ga0495643_0024638 | Ga0495643_0024638_478_936 | 147 |
| 83 | 3300046524 | Ga0495648_0038721 | Ga0495648_0038721_2473_2931 | 147 |
| 84 | 3300046665 | Ga0495661_0003784 | Ga0495661_0003784_6567_7025 | 147 |
| 85 | 3300048928 | Ga0496125_0110640 | Ga0496125_0110640_493_951 | 147 |
| 86 | 3300026075 | Ga0207708_10259942 | Ga0207708_102599423 | 149 |
| 87 | 3300028786 | Ga0307517_10543439 | Ga0307517_105434391 | 150 |
| 88 | 3300028794 | Ga0307515_10000026 | Ga0307515_100000261 | 150 |
| 89 | 3300042876 | Ga0451577_0049379 | Ga0451577_0049379_758_1216 | 150 |
| 90 | 3300045051 | Ga0451576_0233595 | Ga0451576_0233595_804_1262 | 150 |
| 91 | 3300005435 | Ga0070714_100138037 | Ga0070714_1001380373 | 151 |
| 92 | 3300005437 | Ga0070710_10383608 | Ga0070710_103836082 | 151 |
| 93 | 3300005458 | Ga0070681_10009569 | Ga0070681_1000956910 | 151 |
| 94 | 3300009093 | Ga0105240_10942285 | Ga0105240_109422851 | 151 |
| 95 | 3300009551 | Ga0105238_10447561 | Ga0105238_104475612 | 151 |
| 96 | 3300025898 | Ga0207692_10390833 | Ga0207692_103908332 | 151 |
| 97 | 3300025911 | Ga0207654_10904039 | Ga0207654_109040392 | 151 |
| 98 | 3300025921 | Ga0207652_10106343 | Ga0207652_101063432 | 151 |
| 99 | 3300005329 | Ga0070683_100131909 | Ga0070683_1001319094 | 152 |
| 100 | 3300005344 | Ga0070661_100551269 | Ga0070661_1005512692 | 152 |
| 101 | 3300005458 | Ga0070681_10182378 | Ga0070681_101823784 | 152 |
| 102 | 3300005518 | Ga0070699_100764599 | Ga0070699_1007645991 | 152 |
| 103 | 3300005535 | Ga0070684_100267411 | Ga0070684_1002674111 | 152 |
| 104 | 3300005539 | Ga0068853_100034419 | Ga0068853_1000344196 | 152 |
| 105 | 3300005547 | Ga0070693_100332104 | Ga0070693_1003321042 | 152 |
| 106 | 3300005563 | Ga0068855_100006898 | Ga0068855_10000689813 | 152 |
| 107 | 3300005563 | Ga0068855_100009692 | Ga0068855_1000096927 | 152 |
| 108 | 3300005563 | Ga0068855_100019994 | Ga0068855_10001999411 | 152 |
| 109 | 3300005563 | Ga0068855_100086376 | Ga0068855_1000863763 | 152 |
| 110 | 3300005578 | Ga0068854_100224022 | Ga0068854_1002240223 | 152 |
| 111 | 3300005614 | Ga0068856_100039767 | Ga0068856_1000397676 | 152 |
| 112 | 3300005616 | Ga0068852_100090321 | Ga0068852_1000903212 | 152 |
| 113 | 3300005616 | Ga0068852_100465558 | Ga0068852_1004655583 | 152 |
| 114 | 3300006051 | Ga0075364_10172151 | Ga0075364_101721512 | 152 |
| 115 | 3300007788 | Ga0099795_10055784 | Ga0099795_100557842 | 152 |
| 116 | 3300009093 | Ga0105240_10108151 | Ga0105240_101081512 | 152 |
| 117 | 3300009093 | Ga0105240_10130023 | Ga0105240_101300232 | 152 |
| 118 | 3300010159 | Ga0099796_10102756 | Ga0099796_101027562 | 152 |
| 119 | 3300013104 | Ga0157370_10020147 | Ga0157370_100201476 | 152 |
| 120 | 3300013105 | Ga0157369_11854701 | Ga0157369_118547012 | 152 |
| 121 | 3300013307 | Ga0157372_10426867 | Ga0157372_104268672 | 152 |
| 122 | 3300025911 | Ga0207654_10026745 | Ga0207654_100267456 | 152 |
| 123 | 3300025912 | Ga0207707_10083924 | Ga0207707_100839242 | 152 |
| 124 | 3300025912 | Ga0207707_10220727 | Ga0207707_102207272 | 152 |
| 125 | 3300025913 | Ga0207695_10010543 | Ga0207695_1001054311 | 152 |
| 126 | 3300025913 | Ga0207695_10072503 | Ga0207695_100725034 | 152 |
| 127 | 3300025913 | Ga0207695_10210660 | Ga0207695_102106603 | 152 |
| 128 | 3300025913 | Ga0207695_11346958 | Ga0207695_113469582 | 152 |
| 129 | 3300025920 | Ga0207649_10523094 | Ga0207649_105230942 | 152 |
| 130 | 3300025924 | Ga0207694_10107583 | Ga0207694_101075832 | 152 |
| 131 | 3300025944 | Ga0207661_10103145 | Ga0207661_101031452 | 152 |
| 132 | 3300025949 | Ga0207667_10007028 | Ga0207667_100070287 | 152 |
| 133 | 3300025949 | Ga0207667_10017769 | Ga0207667_100177698 | 152 |
| 134 | 3300025949 | Ga0207667_10040469 | Ga0207667_100404695 | 152 |
| 135 | 3300025949 | Ga0207667_10632680 | Ga0207667_106326803 | 152 |
| 136 | 3300026041 | Ga0207639_10107169 | Ga0207639_101071692 | 152 |
| 137 | 3300026078 | Ga0207702_10627248 | Ga0207702_106272482 | 152 |
| 138 | 3300026142 | Ga0207698_10191024 | Ga0207698_101910242 | 152 |
| 139 | 3300050491 | nmdc:mga00v17_672451_c1 | nmdc:mga00v17_672451_c1_148_612 | 152 |
| 140 | 3300050493 | nmdc:mga0k408_197626_c1 | nmdc:mga0k408_197626_c1_677_1141 | 152 |
| 141 | 3300005327 | Ga0070658_10012401 | Ga0070658_100124015 | 153 |
| 142 | 3300005327 | Ga0070658_10053539 | Ga0070658_100535395 | 153 |
| 143 | 3300005329 | Ga0070683_100636449 | Ga0070683_1006364492 | 153 |
| 144 | 3300005330 | Ga0070690_100581926 | Ga0070690_1005819261 | 153 |
| 145 | 3300005333 | Ga0070677_10121284 | Ga0070677_101212842 | 153 |
| 146 | 3300005338 | Ga0068868_100329472 | Ga0068868_1003294722 | 153 |
| 147 | 3300005339 | Ga0070660_100434443 | Ga0070660_1004344432 | 153 |
| 148 | 3300005340 | Ga0070689_100014433 | Ga0070689_1000144332 | 153 |
| 149 | 3300005340 | Ga0070689_101564896 | Ga0070689_1015648961 | 153 |
| 150 | 3300005343 | Ga0070687_100228409 | Ga0070687_1002284093 | 153 |
| 151 | 3300005354 | Ga0070675_100284888 | Ga0070675_1002848883 | 153 |
| 152 | 3300005356 | Ga0070674_100763856 | Ga0070674_1007638562 | 153 |
| 153 | 3300005364 | Ga0070673_100091291 | Ga0070673_1000912914 | 153 |
| 154 | 3300005364 | Ga0070673_100306451 | Ga0070673_1003064511 | 153 |
| 155 | 3300005365 | Ga0070688_100172567 | Ga0070688_1001725673 | 153 |
| 156 | 3300005365 | Ga0070688_101287339 | Ga0070688_1012873391 | 153 |
| 157 | 3300005366 | Ga0070659_100288596 | Ga0070659_1002885962 | 153 |
| 158 | 3300005367 | Ga0070667_100915161 | Ga0070667_1009151612 | 153 |
| 159 | 3300005434 | Ga0070709_10232733 | Ga0070709_102327333 | 153 |
| 160 | 3300005436 | Ga0070713_100026620 | Ga0070713_1000266203 | 153 |
| 161 | 3300005437 | Ga0070710_10222648 | Ga0070710_102226483 | 153 |
| 162 | 3300005439 | Ga0070711_100210004 | Ga0070711_1002100043 | 153 |
| 163 | 3300005440 | Ga0070705_100398935 | Ga0070705_1003989352 | 153 |
| 164 | 3300005441 | Ga0070700_100408502 | Ga0070700_1004085022 | 153 |
| 165 | 3300005456 | Ga0070678_100305271 | Ga0070678_1003052712 | 153 |
| 166 | 3300005457 | Ga0070662_100469994 | Ga0070662_1004699942 | 153 |
| 167 | 3300005459 | Ga0068867_100136062 | Ga0068867_1001360622 | 153 |
| 168 | 3300005530 | Ga0070679_100103542 | Ga0070679_1001035422 | 153 |
| 169 | 3300005535 | Ga0070684_100493983 | Ga0070684_1004939832 | 153 |
| 170 | 3300005535 | Ga0070684_100511232 | Ga0070684_1005112322 | 153 |
| 171 | 3300005544 | Ga0070686_100516741 | Ga0070686_1005167412 | 153 |
| 172 | 3300005546 | Ga0070696_101104286 | Ga0070696_1011042861 | 153 |
| 173 | 3300005547 | Ga0070693_100002877 | Ga0070693_1000028773 | 153 |
| 174 | 3300005547 | Ga0070693_100070073 | Ga0070693_1000700732 | 153 |
| 175 | 3300005549 | Ga0070704_100635791 | Ga0070704_1006357911 | 153 |
| 176 | 3300005563 | Ga0068855_100019481 | Ga0068855_1000194816 | 153 |
| 177 | 3300005615 | Ga0070702_101235716 | Ga0070702_1012357161 | 153 |
| 178 | 3300005616 | Ga0068852_100117252 | Ga0068852_1001172523 | 153 |
| 179 | 3300005616 | Ga0068852_100127613 | Ga0068852_1001276132 | 153 |
| 180 | 3300005617 | Ga0068859_100287557 | Ga0068859_1002875572 | 153 |
| 181 | 3300005718 | Ga0068866_10116302 | Ga0068866_101163024 | 153 |
| 182 | 3300006058 | Ga0075432_10479142 | Ga0075432_104791421 | 153 |
| 183 | 3300006237 | Ga0097621_100086751 | Ga0097621_1000867513 | 153 |
| 184 | 3300006237 | Ga0097621_100184697 | Ga0097621_1001846974 | 153 |
| 185 | 3300006358 | Ga0068871_100062179 | Ga0068871_1000621792 | 153 |
| 186 | 3300006852 | Ga0075433_10398104 | Ga0075433_103981042 | 153 |
| 187 | 3300006871 | Ga0075434_101681887 | Ga0075434_1016818872 | 153 |
| 188 | 3300006914 | Ga0075436_100000522 | Ga0075436_10000052223 | 153 |
| 189 | 3300006931 | Ga0097620_100287580 | Ga0097620_1002875802 | 153 |
| 190 | 3300009147 | Ga0114129_10475941 | Ga0114129_104759414 | 153 |
| 191 | 3300009174 | Ga0105241_10173734 | Ga0105241_101737344 | 153 |
| 192 | 3300009176 | Ga0105242_11056056 | Ga0105242_110560563 | 153 |
| 193 | 3300013307 | Ga0157372_11464663 | Ga0157372_114646632 | 153 |
| 194 | 3300025898 | Ga0207692_10150384 | Ga0207692_101503843 | 153 |
| 195 | 3300025907 | Ga0207645_10190150 | Ga0207645_101901503 | 153 |
| 196 | 3300025909 | Ga0207705_10026611 | Ga0207705_100266115 | 153 |
| 197 | 3300025911 | Ga0207654_10528464 | Ga0207654_105284642 | 153 |
| 198 | 3300025913 | Ga0207695_10161417 | Ga0207695_101614174 | 153 |
| 199 | 3300025915 | Ga0207693_10179468 | Ga0207693_101794682 | 153 |
| 200 | 3300025916 | Ga0207663_10044747 | Ga0207663_100447472 | 153 |
| 201 | 3300025919 | Ga0207657_10566296 | Ga0207657_105662962 | 153 |
| 202 | 3300025920 | Ga0207649_10098246 | Ga0207649_100982462 | 153 |
| 203 | 3300025921 | Ga0207652_10059664 | Ga0207652_100596643 | 153 |
| 204 | 3300025924 | Ga0207694_10012272 | Ga0207694_100122722 | 153 |
| 205 | 3300025924 | Ga0207694_10447934 | Ga0207694_104479342 | 153 |
| 206 | 3300025927 | Ga0207687_10367147 | Ga0207687_103671472 | 153 |
| 207 | 3300025932 | Ga0207690_10154790 | Ga0207690_101547902 | 153 |
| 208 | 3300025933 | Ga0207706_10289728 | Ga0207706_102897282 | 153 |
| 209 | 3300025934 | Ga0207686_10313587 | Ga0207686_103135872 | 153 |
| 210 | 3300025935 | Ga0207709_10355054 | Ga0207709_103550541 | 153 |
| 211 | 3300025936 | Ga0207670_10055935 | Ga0207670_100559352 | 153 |
| 212 | 3300025938 | Ga0207704_10401971 | Ga0207704_104019712 | 153 |
| 213 | 3300025941 | Ga0207711_10024735 | Ga0207711_100247353 | 153 |
| 214 | 3300025944 | Ga0207661_10212238 | Ga0207661_102122382 | 153 |
| 215 | 3300025949 | Ga0207667_10015924 | Ga0207667_100159246 | 153 |
| 216 | 3300025960 | Ga0207651_10294610 | Ga0207651_102946102 | 153 |
| 217 | 3300026023 | Ga0207677_11852007 | Ga0207677_118520072 | 153 |
| 218 | 3300026035 | Ga0207703_11141672 | Ga0207703_111416721 | 153 |
| 219 | 3300026041 | Ga0207639_10021080 | Ga0207639_100210802 | 153 |
| 220 | 3300026075 | Ga0207708_10655810 | Ga0207708_106558102 | 153 |
| 221 | 3300026089 | Ga0207648_10015419 | Ga0207648_100154199 | 153 |
| 222 | 3300026089 | Ga0207648_10090659 | Ga0207648_100906592 | 153 |
| 223 | 3300026121 | Ga0207683_10019538 | Ga0207683_100195386 | 153 |
| 224 | 3300026121 | Ga0207683_10394982 | Ga0207683_103949823 | 153 |
| 225 | 3300026142 | Ga0207698_10007350 | Ga0207698_100073507 | 153 |
| 226 | 3300026142 | Ga0207698_10065524 | Ga0207698_100655242 | 153 |
| 227 | 3300031239 | Ga0265328_10022354 | Ga0265328_100223543 | 153 |
| 228 | 3300031251 | Ga0265327_10000174 | Ga0265327_1000017447 | 153 |
| 229 | 3300037471 | Ga0395905_0693783 | Ga0395905_0693783_437_904 | 153 |
| 230 | 3300039438 | Ga0436360_0483908 | Ga0436360_0483908_421_888 | 153 |
| 231 | 3300044684 | Ga0466966_0214348 | Ga0466966_0214348_406_873 | 153 |
| 232 | 3300045976 | Ga0466967_1185504 | Ga0466967_1185504_116_583 | 153 |
| 233 | 3300046539 | Ga0495621_0122553 | Ga0495621_0122553_502_972 | 153 |
| 234 | 3300048915 | Ga0496112_0331048 | Ga0496112_0331048_385_852 | 153 |
| 235 | 3300049581 | Ga0501047_0225850 | Ga0501047_0225850_733_1200 | 153 |
| 236 | 3300049586 | Ga0501070_0235145 | Ga0501070_0235145_668_1135 | 153 |
| 237 | 3300049590 | Ga0501074_0275600 | Ga0501074_0275600_225_692 | 153 |
| 238 | 3300049742 | Ga0501080_0141828 | Ga0501080_0141828_195_662 | 153 |
| 239 | 3300049823 | Ga0501044_0155307 | Ga0501044_0155307_642_1109 | 153 |
| 240 | 3300050507 | nmdc:mga05p37_535821_c1 | nmdc:mga05p37_535821_c1_114_581 | 153 |
| 241 | 3300003792 | Ga0055540_1016849 | Ga0055540_10168492 | 154 |
| 242 | 3300005295 | Ga0065707_10085167 | Ga0065707_100851671 | 154 |
| 243 | 3300005328 | Ga0070676_10191311 | Ga0070676_101913113 | 154 |
| 244 | 3300005330 | Ga0070690_100382024 | Ga0070690_1003820242 | 154 |
| 245 | 3300005340 | Ga0070689_100719855 | Ga0070689_1007198552 | 154 |
| 246 | 3300005347 | Ga0070668_100214731 | Ga0070668_1002147313 | 154 |
| 247 | 3300005353 | Ga0070669_100151230 | Ga0070669_1001512302 | 154 |
| 248 | 3300005354 | Ga0070675_100479152 | Ga0070675_1004791521 | 154 |
| 249 | 3300005365 | Ga0070688_101042207 | Ga0070688_1010422071 | 154 |
| 250 | 3300005435 | Ga0070714_100078923 | Ga0070714_1000789233 | 154 |
| 251 | 3300005438 | Ga0070701_10083122 | Ga0070701_100831222 | 154 |
| 252 | 3300005440 | Ga0070705_100632994 | Ga0070705_1006329943 | 154 |
| 253 | 3300005441 | Ga0070700_100314486 | Ga0070700_1003144863 | 154 |
| 254 | 3300005459 | Ga0068867_100011005 | Ga0068867_1000110057 | 154 |
| 255 | 3300005459 | Ga0068867_100406471 | Ga0068867_1004064713 | 154 |
| 256 | 3300005518 | Ga0070699_100041083 | Ga0070699_1000410836 | 154 |
| 257 | 3300005543 | Ga0070672_100231783 | Ga0070672_1002317832 | 154 |
| 258 | 3300005549 | Ga0070704_100205934 | Ga0070704_1002059343 | 154 |
| 259 | 3300005549 | Ga0070704_100216825 | Ga0070704_1002168254 | 154 |
| 260 | 3300005578 | Ga0068854_101700575 | Ga0068854_1017005751 | 154 |
| 261 | 3300005718 | Ga0068866_10029507 | Ga0068866_100295075 | 154 |
| 262 | 3300005719 | Ga0068861_100016929 | Ga0068861_1000169292 | 154 |
| 263 | 3300005719 | Ga0068861_101112420 | Ga0068861_1011124202 | 154 |
| 264 | 3300005842 | Ga0068858_100004779 | Ga0068858_1000047796 | 154 |
| 265 | 3300005842 | Ga0068858_100146076 | Ga0068858_1001460764 | 154 |
| 266 | 3300005843 | Ga0068860_100002076 | Ga0068860_1000020767 | 154 |
| 267 | 3300006195 | Ga0075366_10306518 | Ga0075366_103065183 | 154 |
| 268 | 3300009098 | Ga0105245_10691952 | Ga0105245_106919521 | 154 |
| 269 | 3300009176 | Ga0105242_10002434 | Ga0105242_100024342 | 154 |
| 270 | 3300009176 | Ga0105242_10600397 | Ga0105242_106003972 | 154 |
| 271 | 3300009177 | Ga0105248_10800027 | Ga0105248_108000272 | 154 |
| 272 | 3300009551 | Ga0105238_10284411 | Ga0105238_102844112 | 154 |
| 273 | 3300009553 | Ga0105249_10026569 | Ga0105249_100265692 | 154 |
| 274 | 3300013306 | Ga0163162_10005575 | Ga0163162_1000557512 | 154 |
| 275 | 3300013308 | Ga0157375_10052688 | Ga0157375_100526886 | 154 |
| 276 | 3300014326 | Ga0157380_10535782 | Ga0157380_105357822 | 154 |
| 277 | 3300014326 | Ga0157380_11408384 | Ga0157380_114083841 | 154 |
| 278 | 3300014968 | Ga0157379_10195591 | Ga0157379_101955912 | 154 |
| 279 | 3300017792 | Ga0163161_10353262 | Ga0163161_103532623 | 154 |
| 280 | 3300021361 | Ga0213872_10074644 | Ga0213872_100746443 | 154 |
| 281 | 3300025303 | Ga0209051_1002911 | Ga0209051_100291111 | 154 |
| 282 | 3300025303 | Ga0209051_1015732 | Ga0209051_10157321 | 154 |
| 283 | 3300025893 | Ga0207682_10103546 | Ga0207682_101035462 | 154 |
| 284 | 3300025919 | Ga0207657_10288182 | Ga0207657_102881822 | 154 |
| 285 | 3300025923 | Ga0207681_10126456 | Ga0207681_101264561 | 154 |
| 286 | 3300025924 | Ga0207694_10402590 | Ga0207694_104025903 | 154 |
| 287 | 3300025927 | Ga0207687_10447090 | Ga0207687_104470902 | 154 |
| 288 | 3300025929 | Ga0207664_10128109 | Ga0207664_101281092 | 154 |
| 289 | 3300025931 | Ga0207644_10536398 | Ga0207644_105363982 | 154 |
| 290 | 3300025934 | Ga0207686_10026438 | Ga0207686_100264382 | 154 |
| 291 | 3300025934 | Ga0207686_10105818 | Ga0207686_101058182 | 154 |
| 292 | 3300025936 | Ga0207670_10579312 | Ga0207670_105793123 | 154 |
| 293 | 3300025937 | Ga0207669_10034806 | Ga0207669_100348064 | 154 |
| 294 | 3300025940 | Ga0207691_10015882 | Ga0207691_100158822 | 154 |
| 295 | 3300025942 | Ga0207689_11646693 | Ga0207689_116466931 | 154 |
| 296 | 3300025961 | Ga0207712_10193485 | Ga0207712_101934853 | 154 |
| 297 | 3300025972 | Ga0207668_10068534 | Ga0207668_100685342 | 154 |
| 298 | 3300025981 | Ga0207640_10712173 | Ga0207640_107121733 | 154 |
| 299 | 3300026035 | Ga0207703_10074906 | Ga0207703_100749062 | 154 |
| 300 | 3300026035 | Ga0207703_10436311 | Ga0207703_104363113 | 154 |
| 301 | 3300026041 | Ga0207639_11023256 | Ga0207639_110232562 | 154 |
| 302 | 3300026089 | Ga0207648_10002634 | Ga0207648_1000263421 | 154 |
| 303 | 3300026089 | Ga0207648_10172739 | Ga0207648_101727393 | 154 |
| 304 | 3300026118 | Ga0207675_100008746 | Ga0207675_1000087468 | 154 |
| 305 | 3300026118 | Ga0207675_100974647 | Ga0207675_1009746471 | 154 |
| 306 | 3300026118 | Ga0207675_101279145 | Ga0207675_1012791452 | 154 |
| 307 | 3300026121 | Ga0207683_11145158 | Ga0207683_111451583 | 154 |
| 308 | 3300028381 | Ga0268264_10005310 | Ga0268264_100053108 | 154 |
| 309 | 3300031239 | Ga0265328_10007489 | Ga0265328_100074894 | 154 |
| 310 | 3300031250 | Ga0265331_10000055 | Ga0265331_10000055109 | 154 |
| 311 | 3300031251 | Ga0265327_10000045 | Ga0265327_10000045211 | 154 |
| 312 | 3300031344 | Ga0265316_10000391 | Ga0265316_1000039124 | 154 |
| 313 | 3300031548 | Ga0307408_100346593 | Ga0307408_1003465933 | 154 |
| 314 | 3300035089 | Ga0373944_0039904 | Ga0373944_0039904_269_733 | 154 |
| 315 | 3300035691 | Ga0373931_0021627 | Ga0373931_0021627_226_696 | 154 |
| 316 | 3300035695 | Ga0373927_0043199 | Ga0373927_0043199_1346_1810 | 154 |
| 317 | 3300035725 | Ga0373947_0128779 | Ga0373947_0128779_558_1022 | 154 |
| 318 | 3300037068 | Ga0373925_0077326 | Ga0373925_0077326_197_661 | 154 |
| 319 | 3300039447 | Ga0436361_0218235 | Ga0436361_0218235_1640_2104 | 154 |
| 320 | 3300046535 | Ga0495586_0375339 | Ga0495586_0375339_333_797 | 154 |
| 321 | 3300046681 | Ga0495647_0168060 | Ga0495647_0168060_307_771 | 154 |
| 322 | 3300048911 | Ga0496108_0064565 | Ga0496108_0064565_1648_2118 | 154 |
| 323 | 3300048912 | Ga0496109_0213802 | Ga0496109_0213802_626_1096 | 154 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1j6q-assembly1.cif.gz_A | solution structure and characterization of the heme chaperone ccme | 0.8485 | 32 | 121 |
| 2kct-assembly1.cif.gz_A | solution nmr structure of the ob-fold domain of heme chaperone ccme from desulfovibrio vulgaris. northeast structural genomics target dvr115g. | 0.8348 | 47 | 120 |
| 6cqm-assembly2.cif.gz_H-3 | crystal structure of mitochondrial single-stranded dna binding proteins from s. cerevisiae, rim1 (form2) | 0.7908 | 51 | 120 |
| 1sr3-assembly1.cif.gz_A | solution structure of the heme chaperone ccme of escherichia coli | 0.7896 | 32 | 133 |
| 8x70-assembly4.cif.gz_D | the crystal structure of ifi16 from biortus. | 0.769 | 42 | 122 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1j6qA00 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8485 | 32 | 121 | 2.40.50.140 |
| 2kctA01 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8348 | 47 | 120 | 2.40.50.140 |
| 3f8tA02 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8242 | 49 | 121 | 2.40.50.140 |
| af_P9WF31_10_105_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8128 | 52 | 118 | 2.40.50.140 |
| af_K7VHZ3_96_226_2.40.50.140 | Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins | 0.8079 | 29 | 133 | 2.40.50.140 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1F4BIV1-F1-model_v4 | Cytochrome c biogenesis protein CcmE | 0.9541 | 1 | 123 |
GO:0005886
GO:0017004 GO:0020037 |
| AF-A0A0S7ZMS0-F1-model_v4 | Cytochrome C biogenesis protein CcmE | 0.9529 | 1 | 119 |
GO:0005886
GO:0017004 GO:0020037 |
| AF-A0A1F3X805-F1-model_v4 | Cytochrome c biogenesis protein CcmE | 0.9401 | 1 | 127 |
GO:0005886
GO:0017004 GO:0020037 GO:0046872 |
| AF-A0A836VMP7-F1-model_v4 | Cytochrome c maturation protein CcmE | 0.9395 | 1 | 123 |
GO:0005886
GO:0017004 GO:0020037 |
| AF-A0A1F4BIV1-F1-model_v4 | Cytochrome c biogenesis protein CcmE | 0.9322 | 1 | 123 |
GO:0005886
GO:0017004 GO:0020037 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar