F406830

General Info

Members Datasets Scaffolds Average Seq Length
323 203 322 152

Family's Representative Sequence

Representative Sequence 3300005518|Ga0070699_100041083|Ga0070699_1000410836
Length 165
Sequence LKPRTRRALWIVSGLAALGLAAGLVLNAFQSNLVFFFTPSQVVANEAPRDRAFRVGGLVEAGSVVRDKDALTVRFRVTDTARTIPVVYSGILPDLFREGKGVVAQGRLGADGVFRASEVLAKHDENYMPPEAAEALRKAGHPMDKGAFAGQKAKPGVPVQTGPNK

Samples

Sample ID Description Type Environment
1 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
54 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
83 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
84 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
85 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
130 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
131 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
132 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
133 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
134 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
135 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
136 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
137 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
138 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
139 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
140 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
141 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
142 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
143 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
144 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
145 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
146 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
147 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
148 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
149 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
150 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
151 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
153 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
156 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
157 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
158 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
159 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
160 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
161 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
162 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
163 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
164 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
165 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
166 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
167 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
168 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
169 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
170 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
171 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
172 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
173 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
174 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
175 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
176 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
177 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
178 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
179 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
180 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
181 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
184 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
185 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
186 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
187 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
188 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
189 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
190 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
191 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
192 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
193 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
194 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
195 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
196 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
197 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
198 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
199 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
200 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
201 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
202 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
203 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.69
Metatranscriptomes 0
Isolates 0.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.17
Nodule 0
Rhizoplane 1.55
Rhizosphere 94.74
Stem 0
Stem Tuber 0
Unclassified 1.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055540_1016849 3300003792 Bacteria 2059
2 Ga0065707_10085167 3300005295 Bacteria 6390
3 Ga0070658_10012401 3300005327 Bacteria 6838
4 Ga0070658_10053539 3300005327 Bacteria 3276
5 Ga0070676_10191311 3300005328 Bacteria 1336
6 Ga0070683_100131909 3300005329 Bacteria 2365
7 Ga0070683_100636449 3300005329 Bacteria 1021
8 Ga0070690_100382024 3300005330 Bacteria 1030
9 Ga0070690_100581926 3300005330 Bacteria 848
10 Ga0070677_10121284 3300005333 Bacteria 1181
11 Ga0068868_100329472 3300005338 Bacteria 1303
12 Ga0070660_100434443 3300005339 Bacteria 1088
13 Ga0070689_100014433 3300005340 Bacteria 5738
14 Ga0070689_100719855 3300005340 Bacteria 873
15 Ga0070689_101564896 3300005340 Bacteria 598
16 Ga0070687_100228409 3300005343 Bacteria 1144
17 Ga0070661_100551269 3300005344 Bacteria 927
18 Ga0070668_100214731 3300005347 Bacteria 1584
19 Ga0070669_100151230 3300005353 Bacteria 1797
20 Ga0070675_100284888 3300005354 Bacteria 1453
21 Ga0070675_100479152 3300005354 Bacteria 1119
22 Ga0070674_100763856 3300005356 Bacteria 832
23 Ga0070673_100091291 3300005364 Bacteria 2490
24 Ga0070673_100306451 3300005364 Bacteria 1400
25 Ga0070688_100172567 3300005365 Bacteria 1494
26 Ga0070688_101042207 3300005365 Bacteria 652
27 Ga0070688_101287339 3300005365 Bacteria 590
28 Ga0070659_100288596 3300005366 Bacteria 1366
29 Ga0070667_100915161 3300005367 Bacteria 817
30 Ga0070709_10232733 3300005434 Bacteria 1319
31 Ga0070714_100078923 3300005435 Bacteria 2862
32 Ga0070714_100138037 3300005435 Bacteria 2186
33 Ga0070713_100026620 3300005436 Bacteria 4543
34 Ga0070710_10222648 3300005437 Bacteria 1201
35 Ga0070710_10383608 3300005437 Bacteria 938
36 Ga0070701_10083122 3300005438 Bacteria 1738
37 Ga0070711_100210004 3300005439 Bacteria 1507
38 Ga0070705_100398935 3300005440 Bacteria 1018
39 Ga0070705_100632994 3300005440 Bacteria 832
40 Ga0070700_100314486 3300005441 Bacteria 1148
41 Ga0070700_100408502 3300005441 Bacteria 1023
42 Ga0070678_100305271 3300005456 Bacteria 1354
43 Ga0070662_100469994 3300005457 Bacteria 1046
44 Ga0070681_10009569 3300005458 Bacteria 9532
45 Ga0070681_10182378 3300005458 Bacteria 2020
46 Ga0068867_100011005 3300005459 Bacteria 6378
47 Ga0068867_100136062 3300005459 Bacteria 1915
48 Ga0068867_100406471 3300005459 Bacteria 1150
49 Ga0070699_100041083 3300005518 Bacteria 4003
50 Ga0070699_100764599 3300005518 Bacteria 884
51 Ga0070679_100103542 3300005530 Bacteria 2833
52 Ga0070684_100267411 3300005535 Bacteria 1565
53 Ga0070684_100493983 3300005535 Bacteria 1133
54 Ga0070684_100511232 3300005535 Bacteria 1113
55 Ga0068853_100034419 3300005539 Bacteria 4300
56 Ga0070672_100231783 3300005543 Bacteria 1551
57 Ga0070686_100516741 3300005544 Bacteria 929
58 Ga0070696_101104286 3300005546 Bacteria 667
59 Ga0070693_100002877 3300005547 Bacteria 7935
60 Ga0070693_100070073 3300005547 Bacteria 2062
61 Ga0070693_100332104 3300005547 Bacteria 1035
62 Ga0070704_100205934 3300005549 Bacteria 1591
63 Ga0070704_100216825 3300005549 Bacteria 1554
64 Ga0070704_100635791 3300005549 Bacteria 941
65 Ga0068855_100006898 3300005563 Bacteria 13776
66 Ga0068855_100009692 3300005563 Bacteria 11627
67 Ga0068855_100019481 3300005563 Bacteria 8153
68 Ga0068855_100019994 3300005563 Bacteria 8041
69 Ga0068855_100086376 3300005563 Bacteria 3627
70 Ga0068855_100184688 3300005563 Bacteria 2356
71 Ga0068854_100224022 3300005578 Bacteria 1489
72 Ga0068854_101700575 3300005578 Bacteria 577
73 Ga0068856_100039767 3300005614 Bacteria 4618
74 Ga0070702_101235716 3300005615 Bacteria 604
75 Ga0068852_100090321 3300005616 Bacteria 2739
76 Ga0068852_100117252 3300005616 Bacteria 2431
77 Ga0068852_100127613 3300005616 Bacteria 2338
78 Ga0068852_100465558 3300005616 Bacteria 1254
79 Ga0068859_100287557 3300005617 Bacteria 1737
80 Ga0068866_10029507 3300005718 Bacteria 2624
81 Ga0068866_10116302 3300005718 Bacteria 1500
82 Ga0068861_100016929 3300005719 Bacteria 5168
83 Ga0068861_101112420 3300005719 Bacteria 760
84 Ga0068858_100004779 3300005842 Bacteria 13267
85 Ga0068858_100146076 3300005842 Bacteria 2221
86 Ga0068860_100002076 3300005843 Bacteria 21118
87 Ga0075364_10172151 3300006051 Bacteria 1464
88 Ga0075432_10479142 3300006058 Bacteria 551
89 Ga0075366_10306518 3300006195 Bacteria 972
90 Ga0097621_100086751 3300006237 Bacteria 2613
91 Ga0097621_100184697 3300006237 Bacteria 1803
92 Ga0068871_100062179 3300006358 Bacteria 3051
93 Ga0075433_10398104 3300006852 Bacteria 1215
94 Ga0075434_101681887 3300006871 Bacteria 642
95 Ga0075436_100000522 3300006914 Bacteria 25028
96 Ga0097620_100287580 3300006931 Bacteria 1737
97 Ga0099795_10055784 3300007788 Bacteria 1451
98 Ga0105240_10108151 3300009093 Bacteria 3369
99 Ga0105240_10130023 3300009093 Bacteria 3021
100 Ga0105240_10218937 3300009093 Bacteria 2219
101 Ga0105240_10942285 3300009093 Bacteria 927
102 Ga0105240_12550329 3300009093 Bacteria 528
103 Ga0105245_10285838 3300009098 Bacteria 1614
104 Ga0105245_10691952 3300009098 Bacteria 1052
105 Ga0114129_10475941 3300009147 Bacteria 1635
106 Ga0105241_10032594 3300009174 Bacteria 3907
107 Ga0105241_10173734 3300009174 Bacteria 1781
108 Ga0105241_10935083 3300009174 Bacteria 807
109 Ga0105241_11245157 3300009174 Bacteria 706
110 Ga0105242_10002434 3300009176 Bacteria 14624
111 Ga0105242_10025903 3300009176 Bacteria 4645
112 Ga0105242_10209473 3300009176 Bacteria 1736
113 Ga0105242_10600397 3300009176 Bacteria 1063
114 Ga0105242_11056056 3300009176 Bacteria 823
115 Ga0105248_10096753 3300009177 Bacteria 3326
116 Ga0105248_10800027 3300009177 Bacteria 1064
117 Ga0105238_10113072 3300009551 Bacteria 2695
118 Ga0105238_10284411 3300009551 Bacteria 1635
119 Ga0105238_10447561 3300009551 Bacteria 1288
120 Ga0105249_10026569 3300009553 Bacteria 5218
121 Ga0105249_10988650 3300009553 Bacteria 910
122 Ga0099796_10102756 3300010159 Bacteria 1077
123 Ga0157370_10020147 3300013104 Bacteria 6666
124 Ga0157370_11454172 3300013104 Bacteria 616
125 Ga0157370_11590826 3300013104 Bacteria 587
126 Ga0157369_10008819 3300013105 Bacteria 11553
127 Ga0157369_11854701 3300013105 Bacteria 612
128 Ga0157378_10056005 3300013297 Bacteria 3512
129 Ga0157378_10501179 3300013297 Bacteria 1213
130 Ga0163162_10005575 3300013306 Bacteria 12177
131 Ga0163162_10023953 3300013306 Bacteria 6024
132 Ga0163162_10529361 3300013306 Bacteria 1308
133 Ga0157372_10003179 3300013307 Bacteria 17712
134 Ga0157372_10426867 3300013307 Bacteria 1545
135 Ga0157372_11464663 3300013307 Bacteria 787
136 Ga0157375_10052688 3300013308 Bacteria 4001
137 Ga0163163_11338823 3300014325 Bacteria 778
138 Ga0157380_10535782 3300014326 Bacteria 1145
139 Ga0157380_11408384 3300014326 Bacteria 748
140 Ga0157380_11739942 3300014326 Bacteria 682
141 Ga0157380_11777423 3300014326 Bacteria 675
142 Ga0157379_10195591 3300014968 Bacteria 1827
143 Ga0157376_10055172 3300014969 Bacteria 3315
144 Ga0163161_10353262 3300017792 Bacteria 1169
145 Ga0213872_10074644 3300021361 Bacteria 1526
146 Ga0213876_10113448 3300021384 Bacteria 1438
147 Ga0209051_1002911 3300025303 Bacteria 11739
148 Ga0209051_1015732 3300025303 Bacteria 3466
149 Ga0207682_10103546 3300025893 Bacteria 1247
150 Ga0207692_10150384 3300025898 Bacteria 1333
151 Ga0207692_10390833 3300025898 Bacteria 865
152 Ga0207710_10480634 3300025900 Bacteria 643
153 Ga0207645_10190150 3300025907 Bacteria 1349
154 Ga0207705_10026611 3300025909 Bacteria 4124
155 Ga0207654_10026745 3300025911 Bacteria 3128
156 Ga0207654_10528464 3300025911 Bacteria 836
157 Ga0207654_10904039 3300025911 Bacteria 640
158 Ga0207707_10083924 3300025912 Bacteria 2782
159 Ga0207707_10220727 3300025912 Bacteria 1650
160 Ga0207695_10010543 3300025913 Bacteria 11299
161 Ga0207695_10072503 3300025913 Bacteria 3513
162 Ga0207695_10161417 3300025913 Bacteria 2172
163 Ga0207695_10210660 3300025913 Bacteria 1854
164 Ga0207695_11346958 3300025913 Bacteria 594
165 Ga0207693_10179468 3300025915 Bacteria 1666
166 Ga0207663_10044747 3300025916 Bacteria 2719
167 Ga0207657_10288182 3300025919 Bacteria 1303
168 Ga0207657_10566296 3300025919 Bacteria 888
169 Ga0207649_10098246 3300025920 Bacteria 1932
170 Ga0207649_10523094 3300025920 Bacteria 905
171 Ga0207652_10059664 3300025921 Bacteria 3289
172 Ga0207652_10106343 3300025921 Bacteria 2483
173 Ga0207681_10126456 3300025923 Bacteria 1883
174 Ga0207694_10012272 3300025924 Bacteria 6457
175 Ga0207694_10107583 3300025924 Bacteria 2215
176 Ga0207694_10402590 3300025924 Bacteria 1138
177 Ga0207694_10447934 3300025924 Bacteria 1077
178 Ga0207687_10367147 3300025927 Bacteria 1176
179 Ga0207687_10447090 3300025927 Bacteria 1071
180 Ga0207664_10128109 3300025929 Bacteria 2133
181 Ga0207644_10536398 3300025931 Bacteria 968
182 Ga0207690_10154790 3300025932 Bacteria 1703
183 Ga0207706_10289728 3300025933 Bacteria 1427
184 Ga0207686_10026438 3300025934 Bacteria 3385
185 Ga0207686_10063102 3300025934 Bacteria 2355
186 Ga0207686_10105818 3300025934 Bacteria 1887
187 Ga0207686_10313587 3300025934 Bacteria 1169
188 Ga0207709_10355054 3300025935 Bacteria 1108
189 Ga0207670_10055935 3300025936 Bacteria 2669
190 Ga0207670_10579312 3300025936 Bacteria 920
191 Ga0207669_10034806 3300025937 Bacteria 2858
192 Ga0207704_10401971 3300025938 Bacteria 1081
193 Ga0207691_10015882 3300025940 Bacteria 7155
194 Ga0207711_10024735 3300025941 Bacteria 5036
195 Ga0207689_11646693 3300025942 Bacteria 533
196 Ga0207661_10103145 3300025944 Bacteria 2400
197 Ga0207661_10212238 3300025944 Bacteria 1707
198 Ga0207667_10007028 3300025949 Bacteria 13598
199 Ga0207667_10015924 3300025949 Bacteria 8515
200 Ga0207667_10017769 3300025949 Bacteria 7999
201 Ga0207667_10040469 3300025949 Bacteria 4963
202 Ga0207667_10365062 3300025949 Bacteria 1472
203 Ga0207667_10632680 3300025949 Bacteria 1077
204 Ga0207651_10294610 3300025960 Bacteria 1347
205 Ga0207712_10193485 3300025961 Bacteria 1607
206 Ga0207668_10068534 3300025972 Bacteria 2523
207 Ga0207640_10712173 3300025981 Bacteria 862
208 Ga0207677_11852007 3300026023 Bacteria 560
209 Ga0207703_10074906 3300026035 Bacteria 2804
210 Ga0207703_10436311 3300026035 Bacteria 1221
211 Ga0207703_11141672 3300026035 Bacteria 749
212 Ga0207639_10021080 3300026041 Bacteria 4676
213 Ga0207639_10107169 3300026041 Bacteria 2269
214 Ga0207639_11023256 3300026041 Bacteria 774
215 Ga0207708_10259942 3300026075 Bacteria 1401
216 Ga0207708_10655810 3300026075 Bacteria 894
217 Ga0207702_10627248 3300026078 Bacteria 1056
218 Ga0207648_10002634 3300026089 Bacteria 19183
219 Ga0207648_10015419 3300026089 Bacteria 7031
220 Ga0207648_10090659 3300026089 Bacteria 2671
221 Ga0207648_10172739 3300026089 Bacteria 1911
222 Ga0207675_100008746 3300026118 Bacteria 9511
223 Ga0207675_100974647 3300026118 Bacteria 866
224 Ga0207675_101279145 3300026118 Bacteria 754
225 Ga0207683_10019538 3300026121 Bacteria 5786
226 Ga0207683_10394982 3300026121 Bacteria 1272
227 Ga0207683_11145158 3300026121 Bacteria 721
228 Ga0207698_10007350 3300026142 Bacteria 6904
229 Ga0207698_10065524 3300026142 Bacteria 2854
230 Ga0207698_10191024 3300026142 Bacteria 1824
231 Ga0268264_10005310 3300028381 Bacteria 10907
232 Ga0307517_10543439 3300028786 Bacteria 582
233 Ga0307515_10000026 3300028794 Bacteria 382411
234 Ga0265328_10007489 3300031239 Bacteria 4547
235 Ga0265328_10022354 3300031239 Bacteria 2407
236 Ga0265339_10150535 3300031249 Bacteria 1177
237 Ga0265331_10000055 3300031250 Bacteria 177693
238 Ga0265331_10291344 3300031250 Bacteria 731
239 Ga0265327_10000045 3300031251 Bacteria 282880
240 Ga0265327_10000174 3300031251 Bacteria 138922
241 Ga0265316_10000391 3300031344 Bacteria 50025
242 Ga0307408_100007603 3300031548 Bacteria 7167
243 Ga0307408_100346593 3300031548 Bacteria 1259
244 Ga0265314_10064196 3300031711 Bacteria 2488
245 Ga0307405_10026779 3300031731 Bacteria 3332
246 Ga0307413_10031916 3300031824 Bacteria 2978
247 Ga0307410_10002137 3300031852 Bacteria 9390
248 Ga0307410_10861175 3300031852 Bacteria 774
249 Ga0307406_10009643 3300031901 Bacteria 5426
250 Ga0307407_10055157 3300031903 Bacteria 2295
251 Ga0307412_10205271 3300031911 Bacteria 1499
252 Ga0307409_100000504 3300031995 Bacteria 16863
253 Ga0307411_10004100 3300032005 Bacteria 6910
254 Ga0373944_0039904 3300035089 Bacteria 1447
255 Ga0373956_0326860 3300035119 Bacteria 731
256 Ga0373931_0021627 3300035691 Bacteria 3228
257 Ga0373927_0043199 3300035695 Bacteria 2919
258 Ga0373947_0128779 3300035725 Bacteria 1614
259 Ga0373925_0038419 3300037068 Bacteria 3539
260 Ga0373925_0077326 3300037068 Bacteria 2525
261 Ga0395900_0023944 3300037418 Bacteria 6248
262 Ga0395905_0053119 3300037471 Bacteria 3793
263 Ga0395905_0693783 3300037471 Bacteria 920
264 Ga0395901_0076280 3300038443 Bacteria 3497
265 Ga0436365_0442840 3300039437 Bacteria 4126
266 Ga0436360_0483908 3300039438 Bacteria 1307
267 Ga0436361_0218235 3300039447 Bacteria 3714
268 Ga0439447_060258 3300041407 Bacteria 894
269 Ga0439450_115053 3300042008 Bacteria 690
270 Ga0451577_0049379 3300042876 Bacteria 3757
271 Ga0466966_0214348 3300044684 Bacteria 1163
272 Ga0466959_0205098 3300045049 Bacteria 1372
273 Ga0451576_0233595 3300045051 Bacteria 1920
274 Ga0466958_0220268 3300045836 Bacteria 1210
275 Ga0466967_1185504 3300045976 Bacteria 761
276 Ga0495607_0001481 3300046501 Bacteria 20860
277 Ga0495643_0024638 3300046522 Bacteria 3411
278 Ga0495648_0038721 3300046524 Bacteria 3044
279 Ga0495663_0145944 3300046525 Bacteria 805
280 Ga0495586_0375339 3300046535 Bacteria 817
281 Ga0495621_0009892 3300046539 Bacteria 2910
282 Ga0495621_0122553 3300046539 Bacteria 1006
283 Ga0495661_0003784 3300046665 Bacteria 11079
284 Ga0495647_0168060 3300046681 Bacteria 948
285 Ga0495613_0899951 3300046689 Bacteria 573
286 Ga0496104_0326624 3300048907 Bacteria 1447
287 Ga0496105_0464614 3300048908 Bacteria 997
288 Ga0496108_0064565 3300048911 Bacteria 3084
289 Ga0496109_0213802 3300048912 Bacteria 1813
290 Ga0496112_0331048 3300048915 Bacteria 1467
291 Ga0496125_0110640 3300048928 Bacteria 1991
292 Ga0501034_0582432 3300049571 Bacteria 1026
293 Ga0501047_0006119 3300049581 Bacteria 11307
294 Ga0501047_0225850 3300049581 Bacteria 1727
295 Ga0501047_0683853 3300049581 Bacteria 844
296 Ga0501067_0183623 3300049583 Bacteria 1165
297 Ga0501069_0004773 3300049585 Bacteria 7015
298 Ga0501070_0027840 3300049586 Bacteria 4740
299 Ga0501070_0235145 3300049586 Bacteria 1501
300 Ga0501070_0709154 3300049586 Bacteria 795
301 Ga0501072_0421094 3300049588 Bacteria 1058
302 Ga0501073_0006933 3300049589 Bacteria 8435
303 Ga0501073_0241327 3300049589 Bacteria 1248
304 Ga0501074_0000154 3300049590 Bacteria 35857
305 Ga0501074_0275600 3300049590 Bacteria 1196
306 Ga0501079_0001763 3300049741 Bacteria 15436
307 Ga0501080_0005032 3300049742 Bacteria 11775
308 Ga0501080_0141828 3300049742 Bacteria 2221
309 Ga0501083_0000323 3300049744 Bacteria 30331
310 Ga0501044_0028237 3300049823 Bacteria 5923
311 Ga0501044_0155307 3300049823 Bacteria 2268
312 nmdc:mga00v17_672451_c1 3300050491 Bacteria 665
313 nmdc:mga0k408_197626_c1 3300050493 Bacteria 1200
314 nmdc:mga05p37_535821_c1 3300050507 Bacteria 1336
315 nmdc:mga0rr50_231637_c1 3300050513 Bacteria 1528
316 nmdc:mga0a205_425471_c1 3300050515 Bacteria 1190
317 Ga0495601_0704373 3300053077 Bacteria 644
318 Ga0495595_0224348 3300053084 Bacteria 938
319 Ga0501084_0189080 3300054114 Bacteria 1737
320 Ga0501084_1119060 3300054114 Bacteria 661
321 Ga0501082_0219208 3300060353 Bacteria 1655
322 Ga0466962_0390367 3300061719 Bacteria 696

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049589 Ga0501073_0241327 Ga0501073_0241327_353_832 133
2 3300049571 Ga0501034_0582432 Ga0501034_0582432_310_720 134
3 3300054114 Ga0501084_1119060 Ga0501084_1119060_50_460 134
4 3300046525 Ga0495663_0145944 Ga0495663_0145944_102_515 135
5 3300048907 Ga0496104_0326624 Ga0496104_0326624_79_549 135
6 3300048908 Ga0496105_0464614 Ga0496105_0464614_507_977 135
7 3300035119 Ga0373956_0326860 Ga0373956_0326860_184_648 136
8 3300046689 Ga0495613_0899951 Ga0495613_0899951_92_556 136
9 3300053077 Ga0495601_0704373 Ga0495601_0704373_157_621 136
10 3300053084 Ga0495595_0224348 Ga0495595_0224348_205_669 136
11 3300009093 Ga0105240_10218937 Ga0105240_102189372 139
12 3300009551 Ga0105238_10113072 Ga0105238_101130723 139
13 3300013104 Ga0157370_11454172 Ga0157370_114541721 139
14 3300013105 Ga0157369_10008819 Ga0157369_100088192 139
15 3300013307 Ga0157372_10003179 Ga0157372_1000317911 139
16 3300046539 Ga0495621_0009892 Ga0495621_0009892_1171_1617 140
17 3300031249 Ga0265339_10150535 Ga0265339_101505352 141
18 3300031250 Ga0265331_10291344 Ga0265331_102913441 141
19 3300031548 Ga0307408_100007603 Ga0307408_1000076033 141
20 3300031711 Ga0265314_10064196 Ga0265314_100641962 141
21 3300031731 Ga0307405_10026779 Ga0307405_100267793 141
22 3300031824 Ga0307413_10031916 Ga0307413_100319163 141
23 3300031852 Ga0307410_10002137 Ga0307410_100021379 141
24 3300031901 Ga0307406_10009643 Ga0307406_100096433 141
25 3300031903 Ga0307407_10055157 Ga0307407_100551574 141
26 3300031911 Ga0307412_10205271 Ga0307412_102052712 141
27 3300031995 Ga0307409_100000504 Ga0307409_10000050417 141
28 3300032005 Ga0307411_10004100 Ga0307411_100041006 141
29 3300005563 Ga0068855_100184688 Ga0068855_1001846882 142
30 3300025949 Ga0207667_10365062 Ga0207667_103650622 142
31 3300037418 Ga0395900_0023944 Ga0395900_0023944_4388_4822 142
32 3300037471 Ga0395905_0053119 Ga0395905_0053119_474_908 142
33 3300038443 Ga0395901_0076280 Ga0395901_0076280_1893_2327 142
34 3300045049 Ga0466959_0205098 Ga0466959_0205098_425_859 142
35 3300045836 Ga0466958_0220268 Ga0466958_0220268_478_912 142
36 3300050515 nmdc:mga0a205_425471_c1 nmdc:mga0a205_425471_c1_589_1023 142
37 3300061719 Ga0466962_0390367 Ga0466962_0390367_125_559 142
38 3300009174 Ga0105241_11245157 Ga0105241_112451572 143
39 3300009176 Ga0105242_10025903 Ga0105242_100259034 143
40 3300009176 Ga0105242_10209473 Ga0105242_102094732 143
41 3300013297 Ga0157378_10501179 Ga0157378_105011792 143
42 3300025934 Ga0207686_10063102 Ga0207686_100631022 143
43 3300009093 Ga0105240_12550329 Ga0105240_125503291 144
44 3300009174 Ga0105241_10032594 Ga0105241_100325946 144
45 3300013104 Ga0157370_11590826 Ga0157370_115908261 144
46 3300013306 Ga0163162_10529361 Ga0163162_105293613 144
47 3300014326 Ga0157380_11739942 Ga0157380_117399421 144
48 3300025900 Ga0207710_10480634 Ga0207710_104806342 144
49 3300049581 Ga0501047_0006119 Ga0501047_0006119_1610_2050 144
50 3300049581 Ga0501047_0683853 Ga0501047_0683853_98_538 144
51 3300049583 Ga0501067_0183623 Ga0501067_0183623_62_502 144
52 3300049585 Ga0501069_0004773 Ga0501069_0004773_2678_3118 144
53 3300049586 Ga0501070_0027840 Ga0501070_0027840_30_470 144
54 3300049586 Ga0501070_0709154 Ga0501070_0709154_90_530 144
55 3300049588 Ga0501072_0421094 Ga0501072_0421094_398_838 144
56 3300049589 Ga0501073_0006933 Ga0501073_0006933_3597_4037 144
57 3300049590 Ga0501074_0000154 Ga0501074_0000154_9083_9523 144
58 3300049741 Ga0501079_0001763 Ga0501079_0001763_729_1169 144
59 3300049742 Ga0501080_0005032 Ga0501080_0005032_5399_5839 144
60 3300049744 Ga0501083_0000323 Ga0501083_0000323_27028_27468 144
61 3300049823 Ga0501044_0028237 Ga0501044_0028237_2757_3197 144
62 3300054114 Ga0501084_0189080 Ga0501084_0189080_879_1319 144
63 3300060353 Ga0501082_0219208 Ga0501082_0219208_1004_1444 144
64 3300009098 Ga0105245_10285838 Ga0105245_102858381 145
65 3300009174 Ga0105241_10935083 Ga0105241_109350832 145
66 3300009177 Ga0105248_10096753 Ga0105248_100967532 145
67 3300013297 Ga0157378_10056005 Ga0157378_100560052 145
68 3300013306 Ga0163162_10023953 Ga0163162_100239536 145
69 3300014325 Ga0163163_11338823 Ga0163163_113388232 145
70 3300014969 Ga0157376_10055172 Ga0157376_100551726 145
71 3300031852 Ga0307410_10861175 Ga0307410_108611752 145
72 3300041407 Ga0439447_060258 Ga0439447_060258_432_875 145
73 3300050513 nmdc:mga0rr50_231637_c1 nmdc:mga0rr50_231637_c1_763_1206 145
74 iso_pu_bacteria 8047673197 8047677101 145
75 3300009553 Ga0105249_10988650 Ga0105249_109886501 146
76 3300021384 Ga0213876_10113448 Ga0213876_101134483 146
77 3300037068 Ga0373925_0038419 Ga0373925_0038419_2609_3061 146
78 3300039437 Ga0436365_0442840 Ga0436365_0442840_1448_1894 146
79 3300014326 Ga0157380_11777423 Ga0157380_117774232 147
80 3300042008 Ga0439450_115053 Ga0439450_115053_16_474 147
81 3300046501 Ga0495607_0001481 Ga0495607_0001481_8423_8881 147
82 3300046522 Ga0495643_0024638 Ga0495643_0024638_478_936 147
83 3300046524 Ga0495648_0038721 Ga0495648_0038721_2473_2931 147
84 3300046665 Ga0495661_0003784 Ga0495661_0003784_6567_7025 147
85 3300048928 Ga0496125_0110640 Ga0496125_0110640_493_951 147
86 3300026075 Ga0207708_10259942 Ga0207708_102599423 149
87 3300028786 Ga0307517_10543439 Ga0307517_105434391 150
88 3300028794 Ga0307515_10000026 Ga0307515_100000261 150
89 3300042876 Ga0451577_0049379 Ga0451577_0049379_758_1216 150
90 3300045051 Ga0451576_0233595 Ga0451576_0233595_804_1262 150
91 3300005435 Ga0070714_100138037 Ga0070714_1001380373 151
92 3300005437 Ga0070710_10383608 Ga0070710_103836082 151
93 3300005458 Ga0070681_10009569 Ga0070681_1000956910 151
94 3300009093 Ga0105240_10942285 Ga0105240_109422851 151
95 3300009551 Ga0105238_10447561 Ga0105238_104475612 151
96 3300025898 Ga0207692_10390833 Ga0207692_103908332 151
97 3300025911 Ga0207654_10904039 Ga0207654_109040392 151
98 3300025921 Ga0207652_10106343 Ga0207652_101063432 151
99 3300005329 Ga0070683_100131909 Ga0070683_1001319094 152
100 3300005344 Ga0070661_100551269 Ga0070661_1005512692 152
101 3300005458 Ga0070681_10182378 Ga0070681_101823784 152
102 3300005518 Ga0070699_100764599 Ga0070699_1007645991 152
103 3300005535 Ga0070684_100267411 Ga0070684_1002674111 152
104 3300005539 Ga0068853_100034419 Ga0068853_1000344196 152
105 3300005547 Ga0070693_100332104 Ga0070693_1003321042 152
106 3300005563 Ga0068855_100006898 Ga0068855_10000689813 152
107 3300005563 Ga0068855_100009692 Ga0068855_1000096927 152
108 3300005563 Ga0068855_100019994 Ga0068855_10001999411 152
109 3300005563 Ga0068855_100086376 Ga0068855_1000863763 152
110 3300005578 Ga0068854_100224022 Ga0068854_1002240223 152
111 3300005614 Ga0068856_100039767 Ga0068856_1000397676 152
112 3300005616 Ga0068852_100090321 Ga0068852_1000903212 152
113 3300005616 Ga0068852_100465558 Ga0068852_1004655583 152
114 3300006051 Ga0075364_10172151 Ga0075364_101721512 152
115 3300007788 Ga0099795_10055784 Ga0099795_100557842 152
116 3300009093 Ga0105240_10108151 Ga0105240_101081512 152
117 3300009093 Ga0105240_10130023 Ga0105240_101300232 152
118 3300010159 Ga0099796_10102756 Ga0099796_101027562 152
119 3300013104 Ga0157370_10020147 Ga0157370_100201476 152
120 3300013105 Ga0157369_11854701 Ga0157369_118547012 152
121 3300013307 Ga0157372_10426867 Ga0157372_104268672 152
122 3300025911 Ga0207654_10026745 Ga0207654_100267456 152
123 3300025912 Ga0207707_10083924 Ga0207707_100839242 152
124 3300025912 Ga0207707_10220727 Ga0207707_102207272 152
125 3300025913 Ga0207695_10010543 Ga0207695_1001054311 152
126 3300025913 Ga0207695_10072503 Ga0207695_100725034 152
127 3300025913 Ga0207695_10210660 Ga0207695_102106603 152
128 3300025913 Ga0207695_11346958 Ga0207695_113469582 152
129 3300025920 Ga0207649_10523094 Ga0207649_105230942 152
130 3300025924 Ga0207694_10107583 Ga0207694_101075832 152
131 3300025944 Ga0207661_10103145 Ga0207661_101031452 152
132 3300025949 Ga0207667_10007028 Ga0207667_100070287 152
133 3300025949 Ga0207667_10017769 Ga0207667_100177698 152
134 3300025949 Ga0207667_10040469 Ga0207667_100404695 152
135 3300025949 Ga0207667_10632680 Ga0207667_106326803 152
136 3300026041 Ga0207639_10107169 Ga0207639_101071692 152
137 3300026078 Ga0207702_10627248 Ga0207702_106272482 152
138 3300026142 Ga0207698_10191024 Ga0207698_101910242 152
139 3300050491 nmdc:mga00v17_672451_c1 nmdc:mga00v17_672451_c1_148_612 152
140 3300050493 nmdc:mga0k408_197626_c1 nmdc:mga0k408_197626_c1_677_1141 152
141 3300005327 Ga0070658_10012401 Ga0070658_100124015 153
142 3300005327 Ga0070658_10053539 Ga0070658_100535395 153
143 3300005329 Ga0070683_100636449 Ga0070683_1006364492 153
144 3300005330 Ga0070690_100581926 Ga0070690_1005819261 153
145 3300005333 Ga0070677_10121284 Ga0070677_101212842 153
146 3300005338 Ga0068868_100329472 Ga0068868_1003294722 153
147 3300005339 Ga0070660_100434443 Ga0070660_1004344432 153
148 3300005340 Ga0070689_100014433 Ga0070689_1000144332 153
149 3300005340 Ga0070689_101564896 Ga0070689_1015648961 153
150 3300005343 Ga0070687_100228409 Ga0070687_1002284093 153
151 3300005354 Ga0070675_100284888 Ga0070675_1002848883 153
152 3300005356 Ga0070674_100763856 Ga0070674_1007638562 153
153 3300005364 Ga0070673_100091291 Ga0070673_1000912914 153
154 3300005364 Ga0070673_100306451 Ga0070673_1003064511 153
155 3300005365 Ga0070688_100172567 Ga0070688_1001725673 153
156 3300005365 Ga0070688_101287339 Ga0070688_1012873391 153
157 3300005366 Ga0070659_100288596 Ga0070659_1002885962 153
158 3300005367 Ga0070667_100915161 Ga0070667_1009151612 153
159 3300005434 Ga0070709_10232733 Ga0070709_102327333 153
160 3300005436 Ga0070713_100026620 Ga0070713_1000266203 153
161 3300005437 Ga0070710_10222648 Ga0070710_102226483 153
162 3300005439 Ga0070711_100210004 Ga0070711_1002100043 153
163 3300005440 Ga0070705_100398935 Ga0070705_1003989352 153
164 3300005441 Ga0070700_100408502 Ga0070700_1004085022 153
165 3300005456 Ga0070678_100305271 Ga0070678_1003052712 153
166 3300005457 Ga0070662_100469994 Ga0070662_1004699942 153
167 3300005459 Ga0068867_100136062 Ga0068867_1001360622 153
168 3300005530 Ga0070679_100103542 Ga0070679_1001035422 153
169 3300005535 Ga0070684_100493983 Ga0070684_1004939832 153
170 3300005535 Ga0070684_100511232 Ga0070684_1005112322 153
171 3300005544 Ga0070686_100516741 Ga0070686_1005167412 153
172 3300005546 Ga0070696_101104286 Ga0070696_1011042861 153
173 3300005547 Ga0070693_100002877 Ga0070693_1000028773 153
174 3300005547 Ga0070693_100070073 Ga0070693_1000700732 153
175 3300005549 Ga0070704_100635791 Ga0070704_1006357911 153
176 3300005563 Ga0068855_100019481 Ga0068855_1000194816 153
177 3300005615 Ga0070702_101235716 Ga0070702_1012357161 153
178 3300005616 Ga0068852_100117252 Ga0068852_1001172523 153
179 3300005616 Ga0068852_100127613 Ga0068852_1001276132 153
180 3300005617 Ga0068859_100287557 Ga0068859_1002875572 153
181 3300005718 Ga0068866_10116302 Ga0068866_101163024 153
182 3300006058 Ga0075432_10479142 Ga0075432_104791421 153
183 3300006237 Ga0097621_100086751 Ga0097621_1000867513 153
184 3300006237 Ga0097621_100184697 Ga0097621_1001846974 153
185 3300006358 Ga0068871_100062179 Ga0068871_1000621792 153
186 3300006852 Ga0075433_10398104 Ga0075433_103981042 153
187 3300006871 Ga0075434_101681887 Ga0075434_1016818872 153
188 3300006914 Ga0075436_100000522 Ga0075436_10000052223 153
189 3300006931 Ga0097620_100287580 Ga0097620_1002875802 153
190 3300009147 Ga0114129_10475941 Ga0114129_104759414 153
191 3300009174 Ga0105241_10173734 Ga0105241_101737344 153
192 3300009176 Ga0105242_11056056 Ga0105242_110560563 153
193 3300013307 Ga0157372_11464663 Ga0157372_114646632 153
194 3300025898 Ga0207692_10150384 Ga0207692_101503843 153
195 3300025907 Ga0207645_10190150 Ga0207645_101901503 153
196 3300025909 Ga0207705_10026611 Ga0207705_100266115 153
197 3300025911 Ga0207654_10528464 Ga0207654_105284642 153
198 3300025913 Ga0207695_10161417 Ga0207695_101614174 153
199 3300025915 Ga0207693_10179468 Ga0207693_101794682 153
200 3300025916 Ga0207663_10044747 Ga0207663_100447472 153
201 3300025919 Ga0207657_10566296 Ga0207657_105662962 153
202 3300025920 Ga0207649_10098246 Ga0207649_100982462 153
203 3300025921 Ga0207652_10059664 Ga0207652_100596643 153
204 3300025924 Ga0207694_10012272 Ga0207694_100122722 153
205 3300025924 Ga0207694_10447934 Ga0207694_104479342 153
206 3300025927 Ga0207687_10367147 Ga0207687_103671472 153
207 3300025932 Ga0207690_10154790 Ga0207690_101547902 153
208 3300025933 Ga0207706_10289728 Ga0207706_102897282 153
209 3300025934 Ga0207686_10313587 Ga0207686_103135872 153
210 3300025935 Ga0207709_10355054 Ga0207709_103550541 153
211 3300025936 Ga0207670_10055935 Ga0207670_100559352 153
212 3300025938 Ga0207704_10401971 Ga0207704_104019712 153
213 3300025941 Ga0207711_10024735 Ga0207711_100247353 153
214 3300025944 Ga0207661_10212238 Ga0207661_102122382 153
215 3300025949 Ga0207667_10015924 Ga0207667_100159246 153
216 3300025960 Ga0207651_10294610 Ga0207651_102946102 153
217 3300026023 Ga0207677_11852007 Ga0207677_118520072 153
218 3300026035 Ga0207703_11141672 Ga0207703_111416721 153
219 3300026041 Ga0207639_10021080 Ga0207639_100210802 153
220 3300026075 Ga0207708_10655810 Ga0207708_106558102 153
221 3300026089 Ga0207648_10015419 Ga0207648_100154199 153
222 3300026089 Ga0207648_10090659 Ga0207648_100906592 153
223 3300026121 Ga0207683_10019538 Ga0207683_100195386 153
224 3300026121 Ga0207683_10394982 Ga0207683_103949823 153
225 3300026142 Ga0207698_10007350 Ga0207698_100073507 153
226 3300026142 Ga0207698_10065524 Ga0207698_100655242 153
227 3300031239 Ga0265328_10022354 Ga0265328_100223543 153
228 3300031251 Ga0265327_10000174 Ga0265327_1000017447 153
229 3300037471 Ga0395905_0693783 Ga0395905_0693783_437_904 153
230 3300039438 Ga0436360_0483908 Ga0436360_0483908_421_888 153
231 3300044684 Ga0466966_0214348 Ga0466966_0214348_406_873 153
232 3300045976 Ga0466967_1185504 Ga0466967_1185504_116_583 153
233 3300046539 Ga0495621_0122553 Ga0495621_0122553_502_972 153
234 3300048915 Ga0496112_0331048 Ga0496112_0331048_385_852 153
235 3300049581 Ga0501047_0225850 Ga0501047_0225850_733_1200 153
236 3300049586 Ga0501070_0235145 Ga0501070_0235145_668_1135 153
237 3300049590 Ga0501074_0275600 Ga0501074_0275600_225_692 153
238 3300049742 Ga0501080_0141828 Ga0501080_0141828_195_662 153
239 3300049823 Ga0501044_0155307 Ga0501044_0155307_642_1109 153
240 3300050507 nmdc:mga05p37_535821_c1 nmdc:mga05p37_535821_c1_114_581 153
241 3300003792 Ga0055540_1016849 Ga0055540_10168492 154
242 3300005295 Ga0065707_10085167 Ga0065707_100851671 154
243 3300005328 Ga0070676_10191311 Ga0070676_101913113 154
244 3300005330 Ga0070690_100382024 Ga0070690_1003820242 154
245 3300005340 Ga0070689_100719855 Ga0070689_1007198552 154
246 3300005347 Ga0070668_100214731 Ga0070668_1002147313 154
247 3300005353 Ga0070669_100151230 Ga0070669_1001512302 154
248 3300005354 Ga0070675_100479152 Ga0070675_1004791521 154
249 3300005365 Ga0070688_101042207 Ga0070688_1010422071 154
250 3300005435 Ga0070714_100078923 Ga0070714_1000789233 154
251 3300005438 Ga0070701_10083122 Ga0070701_100831222 154
252 3300005440 Ga0070705_100632994 Ga0070705_1006329943 154
253 3300005441 Ga0070700_100314486 Ga0070700_1003144863 154
254 3300005459 Ga0068867_100011005 Ga0068867_1000110057 154
255 3300005459 Ga0068867_100406471 Ga0068867_1004064713 154
256 3300005518 Ga0070699_100041083 Ga0070699_1000410836 154
257 3300005543 Ga0070672_100231783 Ga0070672_1002317832 154
258 3300005549 Ga0070704_100205934 Ga0070704_1002059343 154
259 3300005549 Ga0070704_100216825 Ga0070704_1002168254 154
260 3300005578 Ga0068854_101700575 Ga0068854_1017005751 154
261 3300005718 Ga0068866_10029507 Ga0068866_100295075 154
262 3300005719 Ga0068861_100016929 Ga0068861_1000169292 154
263 3300005719 Ga0068861_101112420 Ga0068861_1011124202 154
264 3300005842 Ga0068858_100004779 Ga0068858_1000047796 154
265 3300005842 Ga0068858_100146076 Ga0068858_1001460764 154
266 3300005843 Ga0068860_100002076 Ga0068860_1000020767 154
267 3300006195 Ga0075366_10306518 Ga0075366_103065183 154
268 3300009098 Ga0105245_10691952 Ga0105245_106919521 154
269 3300009176 Ga0105242_10002434 Ga0105242_100024342 154
270 3300009176 Ga0105242_10600397 Ga0105242_106003972 154
271 3300009177 Ga0105248_10800027 Ga0105248_108000272 154
272 3300009551 Ga0105238_10284411 Ga0105238_102844112 154
273 3300009553 Ga0105249_10026569 Ga0105249_100265692 154
274 3300013306 Ga0163162_10005575 Ga0163162_1000557512 154
275 3300013308 Ga0157375_10052688 Ga0157375_100526886 154
276 3300014326 Ga0157380_10535782 Ga0157380_105357822 154
277 3300014326 Ga0157380_11408384 Ga0157380_114083841 154
278 3300014968 Ga0157379_10195591 Ga0157379_101955912 154
279 3300017792 Ga0163161_10353262 Ga0163161_103532623 154
280 3300021361 Ga0213872_10074644 Ga0213872_100746443 154
281 3300025303 Ga0209051_1002911 Ga0209051_100291111 154
282 3300025303 Ga0209051_1015732 Ga0209051_10157321 154
283 3300025893 Ga0207682_10103546 Ga0207682_101035462 154
284 3300025919 Ga0207657_10288182 Ga0207657_102881822 154
285 3300025923 Ga0207681_10126456 Ga0207681_101264561 154
286 3300025924 Ga0207694_10402590 Ga0207694_104025903 154
287 3300025927 Ga0207687_10447090 Ga0207687_104470902 154
288 3300025929 Ga0207664_10128109 Ga0207664_101281092 154
289 3300025931 Ga0207644_10536398 Ga0207644_105363982 154
290 3300025934 Ga0207686_10026438 Ga0207686_100264382 154
291 3300025934 Ga0207686_10105818 Ga0207686_101058182 154
292 3300025936 Ga0207670_10579312 Ga0207670_105793123 154
293 3300025937 Ga0207669_10034806 Ga0207669_100348064 154
294 3300025940 Ga0207691_10015882 Ga0207691_100158822 154
295 3300025942 Ga0207689_11646693 Ga0207689_116466931 154
296 3300025961 Ga0207712_10193485 Ga0207712_101934853 154
297 3300025972 Ga0207668_10068534 Ga0207668_100685342 154
298 3300025981 Ga0207640_10712173 Ga0207640_107121733 154
299 3300026035 Ga0207703_10074906 Ga0207703_100749062 154
300 3300026035 Ga0207703_10436311 Ga0207703_104363113 154
301 3300026041 Ga0207639_11023256 Ga0207639_110232562 154
302 3300026089 Ga0207648_10002634 Ga0207648_1000263421 154
303 3300026089 Ga0207648_10172739 Ga0207648_101727393 154
304 3300026118 Ga0207675_100008746 Ga0207675_1000087468 154
305 3300026118 Ga0207675_100974647 Ga0207675_1009746471 154
306 3300026118 Ga0207675_101279145 Ga0207675_1012791452 154
307 3300026121 Ga0207683_11145158 Ga0207683_111451583 154
308 3300028381 Ga0268264_10005310 Ga0268264_100053108 154
309 3300031239 Ga0265328_10007489 Ga0265328_100074894 154
310 3300031250 Ga0265331_10000055 Ga0265331_10000055109 154
311 3300031251 Ga0265327_10000045 Ga0265327_10000045211 154
312 3300031344 Ga0265316_10000391 Ga0265316_1000039124 154
313 3300031548 Ga0307408_100346593 Ga0307408_1003465933 154
314 3300035089 Ga0373944_0039904 Ga0373944_0039904_269_733 154
315 3300035691 Ga0373931_0021627 Ga0373931_0021627_226_696 154
316 3300035695 Ga0373927_0043199 Ga0373927_0043199_1346_1810 154
317 3300035725 Ga0373947_0128779 Ga0373947_0128779_558_1022 154
318 3300037068 Ga0373925_0077326 Ga0373925_0077326_197_661 154
319 3300039447 Ga0436361_0218235 Ga0436361_0218235_1640_2104 154
320 3300046535 Ga0495586_0375339 Ga0495586_0375339_333_797 154
321 3300046681 Ga0495647_0168060 Ga0495647_0168060_307_771 154
322 3300048911 Ga0496108_0064565 Ga0496108_0064565_1648_2118 154
323 3300048912 Ga0496109_0213802 Ga0496109_0213802_626_1096 154

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03100

CcmE

CcmE

3

130

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1j6q-assembly1.cif.gz_A solution structure and characterization of the heme chaperone ccme 0.8485 32 121
2kct-assembly1.cif.gz_A solution nmr structure of the ob-fold domain of heme chaperone ccme from desulfovibrio vulgaris. northeast structural genomics target dvr115g. 0.8348 47 120
6cqm-assembly2.cif.gz_H-3 crystal structure of mitochondrial single-stranded dna binding proteins from s. cerevisiae, rim1 (form2) 0.7908 51 120
1sr3-assembly1.cif.gz_A solution structure of the heme chaperone ccme of escherichia coli 0.7896 32 133
8x70-assembly4.cif.gz_D the crystal structure of ifi16 from biortus. 0.769 42 122
ID Description Score Start End Superfamily
1j6qA00 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8485 32 121 2.40.50.140
2kctA01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8348 47 120 2.40.50.140
3f8tA02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8242 49 121 2.40.50.140
af_P9WF31_10_105_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8128 52 118 2.40.50.140
af_K7VHZ3_96_226_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8079 29 133 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A1F4BIV1-F1-model_v4 Cytochrome c biogenesis protein CcmE 0.9541 1 123 GO:0005886
GO:0017004
GO:0020037
AF-A0A0S7ZMS0-F1-model_v4 Cytochrome C biogenesis protein CcmE 0.9529 1 119 GO:0005886
GO:0017004
GO:0020037
AF-A0A1F3X805-F1-model_v4 Cytochrome c biogenesis protein CcmE 0.9401 1 127 GO:0005886
GO:0017004
GO:0020037
GO:0046872
AF-A0A836VMP7-F1-model_v4 Cytochrome c maturation protein CcmE 0.9395 1 123 GO:0005886
GO:0017004
GO:0020037
AF-A0A1F4BIV1-F1-model_v4 Cytochrome c biogenesis protein CcmE 0.9322 1 123 GO:0005886
GO:0017004
GO:0020037

Feature Viewer

pLDDT pTM Quality
84.12 0.63 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map