F406805

General Info

Members Datasets Scaffolds Average Seq Length
323 229 323 71

Family's Representative Sequence

Representative Sequence 3300005441|Ga0070700_100658760|Ga0070700_1006587602
Length 77
Sequence MSDPMGKGSVTVELNHTLAELLARLCVELSPDSDSGDDPTGVMSRALGLLELAQRTKRRGGRLVFINERGEMADVVF

Samples

Sample ID Description Type Environment
1 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
2 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
34 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
80 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
116 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
117 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
118 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
119 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
120 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
121 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
122 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
123 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
124 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
125 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
128 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
129 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
130 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
131 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
132 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
133 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
134 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
135 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
138 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
139 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
140 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
141 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
142 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
143 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
144 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
145 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
146 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
147 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
148 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
149 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
150 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
151 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
152 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
153 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
154 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
155 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
156 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
157 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
158 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
159 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
160 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
161 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
162 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
163 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
164 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
165 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
166 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
167 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
168 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
169 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
173 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
174 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
175 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
176 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
177 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
178 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
179 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
180 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
181 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
182 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
183 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
184 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
185 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
186 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
187 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
188 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
189 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
190 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
191 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
192 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
193 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
194 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
195 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
196 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
197 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
198 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
199 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
200 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
201 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
202 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
203 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
204 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
205 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
206 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
207 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
208 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
209 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
210 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
211 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
212 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
213 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
214 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
215 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
216 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
217 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
218 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
219 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
220 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
221 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
222 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
223 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
224 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
225 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
226 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.83
Metatranscriptomes 2.17
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.22
Nodule 0
Rhizoplane 2.79
Rhizosphere 79.26
Stem 0
Stem Tuber 0
Unclassified 7.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0058859_10078124 3300004798 Bacteria 1496
2 Ga0058859_10158040 3300004798 Bacteria 948
3 Ga0058860_10029314 3300004801 Bacteria 1369
4 Ga0058860_10033033 3300004801 Bacteria 682
5 Ga0070683_101475907 3300005329 Bacteria 654
6 Ga0070690_100335396 3300005330 Bacteria 1094
7 Ga0070670_100675230 3300005331 Bacteria 928
8 Ga0068869_100267111 3300005334 Bacteria 1371
9 Ga0068869_100299272 3300005334 Bacteria 1298
10 Ga0070666_10735402 3300005335 Bacteria 725
11 Ga0070666_10747401 3300005335 Bacteria 719
12 Ga0070680_100470020 3300005336 Bacteria 1074
13 Ga0070680_101352368 3300005336 Bacteria 617
14 Ga0070682_100180663 3300005337 Bacteria 1473
15 Ga0070682_100751009 3300005337 Bacteria 787
16 Ga0068868_101463121 3300005338 Bacteria 639
17 Ga0070689_100182198 3300005340 Bacteria 1706
18 Ga0070689_100381147 3300005340 Bacteria 1188
19 Ga0070689_101942780 3300005340 Bacteria 538
20 Ga0070687_100213717 3300005343 Bacteria 1176
21 Ga0070687_101270575 3300005343 Bacteria 545
22 Ga0070692_10077019 3300005345 Bacteria 1788
23 Ga0070692_10494215 3300005345 Bacteria 792
24 Ga0070668_101044198 3300005347 Bacteria 736
25 Ga0070671_101719641 3300005355 Bacteria 557
26 Ga0070674_100190542 3300005356 Bacteria 1577
27 Ga0070688_101221352 3300005365 Bacteria 604
28 Ga0070667_100957415 3300005367 Bacteria 798
29 Ga0070710_10189443 3300005437 Bacteria 1293
30 Ga0070701_10874541 3300005438 Bacteria 618
31 Ga0070705_100354669 3300005440 Bacteria 1071
32 Ga0070705_101079855 3300005440 Bacteria 656
33 Ga0070700_100658760 3300005441 Bacteria 827
34 Ga0070694_101077296 3300005444 Bacteria 670
35 Ga0070708_102135643 3300005445 Bacteria 518
36 Ga0070678_100006050 3300005456 Bacteria 7059
37 Ga0070685_10607820 3300005466 Unclassified 788
38 Ga0070706_100631218 3300005467 Bacteria 995
39 Ga0070706_101902838 3300005467 Bacteria 540
40 Ga0070707_101713330 3300005468 Bacteria 596
41 Ga0070698_100006791 3300005471 Bacteria 12405
42 Ga0070698_102014387 3300005471 Bacteria 531
43 Ga0070679_100333817 3300005530 Bacteria 1464
44 Ga0070684_101318092 3300005535 Bacteria 680
45 Ga0070697_100386486 3300005536 Bacteria 1213
46 Ga0070695_101786701 3300005545 Bacteria 516
47 Ga0070696_100402025 3300005546 Bacteria 1072
48 Ga0070693_101540045 3300005547 Bacteria 521
49 Ga0070665_100004396 3300005548 Bacteria 14825
50 Ga0070704_100996490 3300005549 Bacteria 758
51 Ga0070704_101256482 3300005549 Bacteria 677
52 Ga0070702_100152358 3300005615 Bacteria 1485
53 Ga0070702_101260459 3300005615 Bacteria 598
54 Ga0068859_102836631 3300005617 Bacteria 531
55 Ga0068864_100716108 3300005618 Bacteria 979
56 Ga0068864_100843343 3300005618 Bacteria 903
57 Ga0068866_10279552 3300005718 Bacteria 1033
58 Ga0068861_100820250 3300005719 Bacteria 875
59 Ga0068851_10570675 3300005834 Bacteria 686
60 Ga0068870_10991240 3300005840 Unclassified 599
61 Ga0068863_100235335 3300005841 Bacteria 1767
62 Ga0068863_100769222 3300005841 Bacteria 959
63 Ga0068863_102428897 3300005841 Bacteria 534
64 Ga0068858_100630976 3300005842 Bacteria 1040
65 Ga0068860_100759750 3300005843 Bacteria 981
66 Ga0068862_100350500 3300005844 Bacteria 1369
67 Ga0068862_101731261 3300005844 Bacteria 634
68 Ga0070717_10095258 3300006028 Bacteria 2519
69 Ga0070717_10120330 3300006028 Bacteria 2249
70 Ga0075363_100813257 3300006048 Bacteria 569
71 Ga0097621_101238612 3300006237 Bacteria 703
72 Ga0075428_101111307 3300006844 Bacteria 835
73 Ga0075430_101037124 3300006846 Bacteria 676
74 Ga0075431_100256095 3300006847 Bacteria 1777
75 Ga0075431_101016143 3300006847 Bacteria 796
76 Ga0075431_102201680 3300006847 Bacteria 506
77 Ga0075433_10937982 3300006852 Bacteria 754
78 Ga0075429_100171306 3300006880 Bacteria 1901
79 Ga0075429_100340034 3300006880 Bacteria 1314
80 Ga0075429_100777688 3300006880 Bacteria 838
81 Ga0075429_101306298 3300006880 Bacteria 632
82 Ga0075429_101309415 3300006880 Bacteria 632
83 Ga0068865_100125443 3300006881 Bacteria 1915
84 Ga0097620_101990271 3300006931 Bacteria 641
85 Ga0097620_102836658 3300006931 Bacteria 531
86 Ga0075435_100505988 3300007076 Bacteria 1044
87 Ga0075435_100606357 3300007076 Bacteria 949
88 Ga0105250_10445457 3300009092 Bacteria 580
89 Ga0105240_10789697 3300009093 Bacteria 1029
90 Ga0111539_10813716 3300009094 Bacteria 1087
91 Ga0105245_10000243 3300009098 Bacteria 52026
92 Ga0105245_10304988 3300009098 Bacteria 1563
93 Ga0105245_10797752 3300009098 Bacteria 982
94 Ga0105247_11396984 3300009101 Unclassified 566
95 Ga0105243_10472286 3300009148 Bacteria 1182
96 Ga0105241_10224017 3300009174 Bacteria 1582
97 Ga0105242_10484725 3300009176 Bacteria 1173
98 Ga0105248_11277183 3300009177 Bacteria 830
99 Ga0105248_11977245 3300009177 Bacteria 662
100 Ga0105248_12012565 3300009177 Bacteria 656
101 Ga0105249_10131225 3300009553 Bacteria 2392
102 Ga0105249_10572886 3300009553 Bacteria 1182
103 Ga0105239_10157400 3300010375 Bacteria 2538
104 Ga0105246_10582420 3300011119 Bacteria 964
105 Ga0157374_11170349 3300013296 Bacteria 790
106 Ga0157374_11404859 3300013296 Bacteria 721
107 Ga0157378_10105601 3300013297 Bacteria 2576
108 Ga0157378_12088239 3300013297 Bacteria 617
109 Ga0157378_12656069 3300013297 Bacteria 553
110 Ga0157372_11130111 3300013307 Bacteria 906
111 Ga0163163_11520901 3300014325 Bacteria 731
112 Ga0163163_12134355 3300014325 Bacteria 620
113 Ga0157380_11485993 3300014326 Bacteria 730
114 Ga0157380_13366241 3300014326 Unclassified 511
115 Ga0157379_11375374 3300014968 Bacteria 683
116 Ga0157376_10391334 3300014969 Bacteria 1342
117 Ga0157376_11467309 3300014969 Bacteria 715
118 Ga0157376_11802456 3300014969 Bacteria 648
119 Ga0157376_12993658 3300014969 Bacteria 511
120 Ga0182007_10163997 3300015262 Bacteria 761
121 Ga0207692_10206737 3300025898 Bacteria 1157
122 Ga0207642_10657007 3300025899 Bacteria 657
123 Ga0207643_10089326 3300025908 Bacteria 1794
124 Ga0207705_10955254 3300025909 Bacteria 663
125 Ga0207684_10351020 3300025910 Bacteria 1270
126 Ga0207660_10816099 3300025917 Bacteria 761
127 Ga0207660_10881305 3300025917 Bacteria 730
128 Ga0207662_10076807 3300025918 Bacteria 2031
129 Ga0207652_10107914 3300025921 Bacteria 2466
130 Ga0207646_10363200 3300025922 Bacteria 1308
131 Ga0207646_10872579 3300025922 Bacteria 799
132 Ga0207694_11821925 3300025924 Bacteria 511
133 Ga0207659_10258047 3300025926 Bacteria 1417
134 Ga0207687_10000298 3300025927 Bacteria 33998
135 Ga0207687_10019761 3300025927 Bacteria 4465
136 Ga0207687_10658458 3300025927 Bacteria 886
137 Ga0207690_10475288 3300025932 Bacteria 1008
138 Ga0207686_10455196 3300025934 Bacteria 985
139 Ga0207709_10060337 3300025935 Bacteria 2364
140 Ga0207670_10119721 3300025936 Bacteria 1912
141 Ga0207670_10133810 3300025936 Bacteria 1820
142 Ga0207670_10165714 3300025936 Bacteria 1653
143 Ga0207670_10505380 3300025936 Bacteria 982
144 Ga0207669_10968843 3300025937 Bacteria 713
145 Ga0207704_10120597 3300025938 Bacteria 1794
146 Ga0207711_10244803 3300025941 Bacteria 1645
147 Ga0207689_10196944 3300025942 Bacteria 1663
148 Ga0207689_10429606 3300025942 Bacteria 1103
149 Ga0207689_10908503 3300025942 Bacteria 743
150 Ga0207661_11041500 3300025944 Unclassified 754
151 Ga0207667_10638263 3300025949 Bacteria 1071
152 Ga0207712_10024296 3300025961 Bacteria 4011
153 Ga0207712_10617820 3300025961 Bacteria 939
154 Ga0207668_10611573 3300025972 Bacteria 950
155 Ga0207658_10256223 3300025986 Bacteria 1489
156 Ga0207708_10626900 3300026075 Bacteria 913
157 Ga0207702_10428507 3300026078 Bacteria 1280
158 Ga0207641_10564198 3300026088 Bacteria 1111
159 Ga0207676_10130474 3300026095 Bacteria 2136
160 Ga0207676_10803488 3300026095 Bacteria 918
161 Ga0207676_11521681 3300026095 Bacteria 666
162 Ga0207674_11433977 3300026116 Unclassified 660
163 Ga0207675_100323571 3300026118 Bacteria 1506
164 Ga0207683_10009029 3300026121 Bacteria 8492
165 Ga0268266_10009749 3300028379 Bacteria 8447
166 Ga0268266_12375551 3300028379 Bacteria 501
167 Ga0268265_10293279 3300028380 Bacteria 1461
168 Ga0268264_10159564 3300028381 Bacteria 2030
169 Ga0268264_12286356 3300028381 Bacteria 548
170 Ga0307517_10135229 3300028786 Bacteria 1756
171 Ga0307515_10010801 3300028794 Bacteria 17424
172 Ga0265338_10049527 3300028800 Bacteria 3807
173 Ga0265338_10066151 3300028800 Bacteria 3130
174 Ga0265320_10546490 3300031240 Bacteria 512
175 Ga0265331_10084484 3300031250 Bacteria 1471
176 Ga0307513_10027339 3300031456 Bacteria 6553
177 Ga0307513_10584690 3300031456 Bacteria 827
178 Ga0307509_10000010 3300031507 Bacteria 307427
179 Ga0307509_10148750 3300031507 Bacteria 2262
180 Ga0307509_10327887 3300031507 Bacteria 1264
181 Ga0307509_10354809 3300031507 Bacteria 1188
182 Ga0307509_10502121 3300031507 Bacteria 897
183 Ga0307509_10744407 3300031507 Bacteria 646
184 Ga0307508_10195087 3300031616 Bacteria 1626
185 Ga0307516_10275314 3300031730 Bacteria 1367
186 Ga0307406_10005751 3300031901 Bacteria 6794
187 Ga0307406_10781006 3300031901 Bacteria 804
188 Ga0307412_10812439 3300031911 Bacteria 813
189 Ga0307416_101194443 3300032002 Bacteria 866
190 Ga0307411_11700792 3300032005 Bacteria 584
191 Ga0307415_100551180 3300032126 Bacteria 1017
192 Ga0307507_10201640 3300033179 Bacteria 1375
193 Ga0373949_0001625 3300035090 Bacteria 6278
194 Ga0373941_0011886 3300035115 Bacteria 2262
195 Ga0373954_0107670 3300035118 Bacteria 1347
196 Ga0373956_0132929 3300035119 Bacteria 1166
197 Ga0373955_0341893 3300035172 Bacteria 906
198 Ga0373961_0000001 3300035241 Bacteria 199721
199 Ga0373937_1449053 3300036401 Bacteria 634
200 Ga0395899_0171144 3300037312 Bacteria 1529
201 Ga0395899_0184667 3300037312 Bacteria 1462
202 Ga0395900_0119764 3300037418 Bacteria 2701
203 Ga0395900_0691168 3300037418 Bacteria 954
204 Ga0395900_0894682 3300037418 Bacteria 811
205 Ga0395898_0286486 3300037466 Bacteria 1571
206 Ga0395898_0615145 3300037466 Bacteria 1029
207 Ga0395905_0379506 3300037471 Bacteria 1307
208 Ga0395905_0677547 3300037471 Bacteria 933
209 Ga0395905_1088611 3300037471 Bacteria 702
210 Ga0395901_0427355 3300038443 Bacteria 1357
211 Ga0395901_0716091 3300038443 Bacteria 997
212 Ga0436365_1736647 3300039437 Bacteria 1235
213 Ga0436363_0099087 3300039450 Bacteria 841
214 Ga0451789_1073330 3300041443 Bacteria 590
215 Ga0451793_1324066 3300041452 Bacteria 864
216 Ga0451797_0441516 3300041453 Bacteria 593
217 Ga0451798_0009019 3300041458 Bacteria 611
218 Ga0451802_0187384 3300041460 Bacteria 641
219 Ga0451802_2195014 3300041460 Bacteria 676
220 Ga0451807_0057988 3300041486 Bacteria 525
221 Ga0451833_0205676 3300041491 Bacteria 530
222 Ga0451837_1024304 3300041494 Bacteria 560
223 Ga0451855_1030520 3300041511 Bacteria 590
224 Ga0451853_1073962 3300041512 Bacteria 561
225 Ga0451853_1942291 3300041512 Bacteria 769
226 Ga0451853_2349798 3300041512 Bacteria 1642
227 Ga0453683_1048857 3300044673 Unclassified 542
228 Ga0453683_1189363 3300044673 Bacteria 510
229 Ga0466963_0832850 3300044694 Bacteria 651
230 Ga0466967_0979970 3300045976 Bacteria 842
231 Ga0495594_0195756 3300046499 Bacteria 1152
232 Ga0495596_0379033 3300046500 Bacteria 551
233 Ga0495630_0747832 3300046517 Bacteria 747
234 Ga0495632_0135268 3300046519 Bacteria 1146
235 Ga0495598_0371640 3300046537 Bacteria 554
236 Ga0495622_0206987 3300046557 Bacteria 873
237 Ga0495668_0322256 3300046616 Bacteria 848
238 Ga0495676_0566255 3300047321 Bacteria 742
239 Ga0495686_0017690 3300047472 Bacteria 4797
240 Ga0495686_0198837 3300047472 Bacteria 1151
241 Ga0496115_0471156 3300048918 Bacteria 1012
242 Ga0496115_0970231 3300048918 Bacteria 651
243 Ga0501292_019671 3300049515 Bacteria 1082
244 Ga0501295_188651 3300049518 Bacteria 518
245 Ga0501032_0165569 3300049569 Bacteria 1451
246 Ga0501033_1110839 3300049570 Bacteria 526
247 Ga0501047_1191761 3300049581 Bacteria 575
248 Ga0501067_0420557 3300049583 Bacteria 746
249 Ga0501068_0094367 3300049584 Bacteria 1849
250 Ga0501069_0273808 3300049585 Bacteria 987
251 Ga0501069_0641984 3300049585 Bacteria 638
252 Ga0501070_0114572 3300049586 Bacteria 2227
253 Ga0501070_0175723 3300049586 Bacteria 1763
254 Ga0501070_0380894 3300049586 Bacteria 1143
255 Ga0501070_1395099 3300049586 Bacteria 532
256 Ga0501070_1430946 3300049586 Bacteria 524
257 Ga0501071_0524133 3300049587 Bacteria 909
258 Ga0501073_0172154 3300049589 Bacteria 1499
259 Ga0501075_0608800 3300049591 Bacteria 833
260 Ga0501207_081751 3300049654 Bacteria 623
261 Ga0501209_007106 3300049656 Bacteria 2128
262 Ga0501216_003079 3300049660 Bacteria 2413
263 Ga0501217_003905 3300049661 Bacteria 3037
264 Ga0501227_001077 3300049665 Bacteria 6067
265 Ga0501227_140362 3300049665 Bacteria 662
266 Ga0501228_003789 3300049666 Bacteria 1266
267 Ga0501230_001017 3300049667 Bacteria 3200
268 Ga0501233_002675 3300049668 Bacteria 3156
269 Ga0501235_098379 3300049669 Bacteria 712
270 Ga0501236_001810 3300049670 Bacteria 2441
271 Ga0501249_092316 3300049679 Bacteria 719
272 Ga0501260_028355 3300049689 Bacteria 635
273 Ga0501225_0020964 3300049705 Bacteria 1806
274 Ga0501229_009805 3300049706 Bacteria 1205
275 Ga0501080_0951893 3300049742 Bacteria 746
276 Ga0501083_0172729 3300049744 Bacteria 1412
277 Ga0501267_025402 3300049764 Bacteria 673
278 nmdc:mga03n38_722384_c1 3300050490 Bacteria 575
279 nmdc:mga09592_1539735_c1 3300050508 Bacteria 540
280 nmdc:mga09592_288578_c1 3300050508 Bacteria 1423
281 nmdc:mga09592_309616_c1 3300050508 Bacteria 1369
282 nmdc:mga09592_97808_c1 3300050508 Bacteria 2512
283 nmdc:mga0qj67_745944_c1 3300050509 Bacteria 777
284 nmdc:mga0qj67_896772_c1 3300050509 Bacteria 699
285 nmdc:mga06r32_1141552_c1 3300050510 Bacteria 727
286 nmdc:mga06r32_502175_c1 3300050510 Bacteria 1190
287 nmdc:mga0rr50_1201822_c1 3300050513 Bacteria 644
288 nmdc:mga0rr50_420144_c1 3300050513 Bacteria 1131
289 Ga0500635_0051869 3300053080 Bacteria 1407
290 Ga0500578_0387084 3300053086 Bacteria 809
291 Ga0500646_0077676 3300053090 Bacteria 1007
292 Ga0500566_0088382 3300053094 Bacteria 1715
293 Ga0500566_0127172 3300053094 Bacteria 1367
294 Ga0500566_0211978 3300053094 Bacteria 969
295 Ga0500566_0321656 3300053094 Unclassified 720
296 Ga0500640_008454 3300053095 Bacteria 4076
297 Ga0500650_0124440 3300053098 Bacteria 1201
298 Ga0500654_188687 3300053099 Bacteria 643
299 Ga0500554_046647 3300053102 Bacteria 1349
300 Ga0500572_005851 3300053111 Bacteria 2797
301 Ga0500594_0015718 3300053118 Bacteria 1830
302 Ga0500595_000273 3300053119 Bacteria 34052
303 Ga0500597_050261 3300053120 Bacteria 1774
304 Ga0500597_162349 3300053120 Bacteria 955
305 Ga0500614_054080 3300053123 Bacteria 1062
306 Ga0500614_183063 3300053123 Bacteria 641
307 Ga0500642_0013946 3300053130 Bacteria 2974
308 Ga0500642_0288686 3300053130 Bacteria 743
309 Ga0500652_206609 3300053131 Bacteria 795
310 Ga0500559_0067611 3300053136 Bacteria 1604
311 Ga0500564_264634 3300053138 Bacteria 675
312 Ga0500568_0017205 3300053139 Bacteria 3196
313 Ga0500579_139212 3300053143 Bacteria 1103
314 Ga0500585_250311 3300053144 Unclassified 563
315 Ga0500603_062805 3300053150 Bacteria 1042
316 Ga0500622_0026580 3300053156 Bacteria 3054
317 Ga0500630_308082 3300053159 Bacteria 504
318 Ga0500636_0189104 3300053177 Bacteria 1098
319 Ga0500637_0213827 3300053178 Bacteria 1093
320 Ga0587066_111784 3300059490 Bacteria 634
321 Ga0587062_097786 3300059639 Bacteria 567
322 Ga0587076_169748 3300059645 Bacteria 542
323 Ga0501082_1157392 3300060353 Bacteria 676

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047472 Ga0495686_0017690 Ga0495686_0017690_4520_4711 63
2 3300047472 Ga0495686_0198837 Ga0495686_0198837_683_874 63
3 3300053159 Ga0500630_308082 Ga0500630_308082_40_231 63
4 3300006847 Ga0075431_102201680 Ga0075431_1022016801 64
5 3300041460 Ga0451802_2195014 Ga0451802_2195014_96_290 64
6 3300025927 Ga0207687_10658458 Ga0207687_106584582 65
7 3300028794 Ga0307515_10010801 Ga0307515_1001080117 66
8 3300031507 Ga0307509_10744407 Ga0307509_107444072 66
9 3300035115 Ga0373941_0011886 Ga0373941_0011886_686_886 66
10 3300046499 Ga0495594_0195756 Ga0495594_0195756_22_222 66
11 3300049764 Ga0501267_025402 Ga0501267_025402_280_480 66
12 3300053130 Ga0500642_0013946 Ga0500642_0013946_1688_1888 66
13 3300053130 Ga0500642_0288686 Ga0500642_0288686_519_719 66
14 3300053144 Ga0500585_250311 Ga0500585_250311_23_223 66
15 3300053177 Ga0500636_0189104 Ga0500636_0189104_876_1076 66
16 3300005340 Ga0070689_101942780 Ga0070689_1019427801 67
17 3300005467 Ga0070706_100631218 Ga0070706_1006312182 67
18 3300005471 Ga0070698_102014387 Ga0070698_1020143871 67
19 3300006846 Ga0075430_101037124 Ga0075430_1010371242 67
20 3300014326 Ga0157380_11485993 Ga0157380_114859932 67
21 3300025936 Ga0207670_10505380 Ga0207670_105053802 67
22 3300044673 Ga0453683_1048857 Ga0453683_1048857_324_527 67
23 3300050509 nmdc:mga0qj67_896772_c1 nmdc:mga0qj67_896772_c1_81_284 67
24 3300004801 Ga0058860_10029314 Ga0058860_100293142 68
25 3300005334 Ga0068869_100299272 Ga0068869_1002992722 68
26 3300005367 Ga0070667_100957415 Ga0070667_1009574152 68
27 3300005466 Ga0070685_10607820 Ga0070685_106078202 68
28 3300005547 Ga0070693_101540045 Ga0070693_1015400452 68
29 3300005618 Ga0068864_100716108 Ga0068864_1007161082 68
30 3300005718 Ga0068866_10279552 Ga0068866_102795522 68
31 3300005841 Ga0068863_100235335 Ga0068863_1002353352 68
32 3300005843 Ga0068860_100759750 Ga0068860_1007597501 68
33 3300006881 Ga0068865_100125443 Ga0068865_1001254432 68
34 3300025927 Ga0207687_10019761 Ga0207687_100197612 68
35 3300025935 Ga0207709_10060337 Ga0207709_100603372 68
36 3300025938 Ga0207704_10120597 Ga0207704_101205972 68
37 3300025986 Ga0207658_10256223 Ga0207658_102562232 68
38 3300026088 Ga0207641_10564198 Ga0207641_105641982 68
39 3300026095 Ga0207676_11521681 Ga0207676_115216812 68
40 3300053094 Ga0500566_0321656 Ga0500566_0321656_349_555 68
41 3300053120 Ga0500597_050261 Ga0500597_050261_1016_1222 68
42 3300053123 Ga0500614_183063 Ga0500614_183063_214_420 68
43 3300049679 Ga0501249_092316 Ga0501249_092316_215_424 69
44 3300005330 Ga0070690_100335396 Ga0070690_1003353962 71
45 3300005335 Ga0070666_10735402 Ga0070666_107354022 71
46 3300005335 Ga0070666_10747401 Ga0070666_107474012 71
47 3300005336 Ga0070680_101352368 Ga0070680_1013523682 71
48 3300005343 Ga0070687_101270575 Ga0070687_1012705752 71
49 3300005345 Ga0070692_10494215 Ga0070692_104942152 71
50 3300005347 Ga0070668_101044198 Ga0070668_1010441982 71
51 3300005356 Ga0070674_100190542 Ga0070674_1001905422 71
52 3300005440 Ga0070705_101079855 Ga0070705_1010798551 71
53 3300005444 Ga0070694_101077296 Ga0070694_1010772962 71
54 3300005445 Ga0070708_102135643 Ga0070708_1021356431 71
55 3300005456 Ga0070678_100006050 Ga0070678_1000060507 71
56 3300005467 Ga0070706_101902838 Ga0070706_1019028381 71
57 3300005468 Ga0070707_101713330 Ga0070707_1017133301 71
58 3300005535 Ga0070684_101318092 Ga0070684_1013180922 71
59 3300005545 Ga0070695_101786701 Ga0070695_1017867012 71
60 3300005549 Ga0070704_100996490 Ga0070704_1009964901 71
61 3300005719 Ga0068861_100820250 Ga0068861_1008202502 71
62 3300005834 Ga0068851_10570675 Ga0068851_105706752 71
63 3300005841 Ga0068863_102428897 Ga0068863_1024288972 71
64 3300006048 Ga0075363_100813257 Ga0075363_1008132572 71
65 3300006844 Ga0075428_101111307 Ga0075428_1011113072 71
66 3300006847 Ga0075431_100256095 Ga0075431_1002560952 71
67 3300006847 Ga0075431_101016143 Ga0075431_1010161432 71
68 3300006852 Ga0075433_10937982 Ga0075433_109379822 71
69 3300006880 Ga0075429_100171306 Ga0075429_1001713062 71
70 3300006880 Ga0075429_100340034 Ga0075429_1003400342 71
71 3300006880 Ga0075429_100777688 Ga0075429_1007776882 71
72 3300006880 Ga0075429_101309415 Ga0075429_1013094152 71
73 3300007076 Ga0075435_100505988 Ga0075435_1005059882 71
74 3300009101 Ga0105247_11396984 Ga0105247_113969841 71
75 3300009176 Ga0105242_10484725 Ga0105242_104847252 71
76 3300009177 Ga0105248_11277183 Ga0105248_112771832 71
77 3300009553 Ga0105249_10131225 Ga0105249_101312252 71
78 3300009553 Ga0105249_10572886 Ga0105249_105728862 71
79 3300013296 Ga0157374_11170349 Ga0157374_111703492 71
80 3300013296 Ga0157374_11404859 Ga0157374_114048592 71
81 3300013297 Ga0157378_12088239 Ga0157378_120882392 71
82 3300014325 Ga0163163_11520901 Ga0163163_115209012 71
83 3300014326 Ga0157380_13366241 Ga0157380_133662412 71
84 3300014969 Ga0157376_11802456 Ga0157376_118024562 71
85 3300014969 Ga0157376_12993658 Ga0157376_129936582 71
86 3300015262 Ga0182007_10163997 Ga0182007_101639972 71
87 3300025899 Ga0207642_10657007 Ga0207642_106570072 71
88 3300025917 Ga0207660_10881305 Ga0207660_108813052 71
89 3300025922 Ga0207646_10872579 Ga0207646_108725792 71
90 3300025926 Ga0207659_10258047 Ga0207659_102580472 71
91 3300025934 Ga0207686_10455196 Ga0207686_104551962 71
92 3300025937 Ga0207669_10968843 Ga0207669_109688432 71
93 3300025941 Ga0207711_10244803 Ga0207711_102448032 71
94 3300025944 Ga0207661_11041500 Ga0207661_110415002 71
95 3300025961 Ga0207712_10024296 Ga0207712_100242962 71
96 3300025961 Ga0207712_10617820 Ga0207712_106178202 71
97 3300025972 Ga0207668_10611573 Ga0207668_106115732 71
98 3300026078 Ga0207702_10428507 Ga0207702_104285071 71
99 3300026095 Ga0207676_10130474 Ga0207676_101304743 71
100 3300026118 Ga0207675_100323571 Ga0207675_1003235712 71
101 3300026121 Ga0207683_10009029 Ga0207683_100090297 71
102 3300028379 Ga0268266_12375551 Ga0268266_123755512 71
103 3300031616 Ga0307508_10195087 Ga0307508_101950872 71
104 3300032002 Ga0307416_101194443 Ga0307416_1011944432 71
105 3300033179 Ga0307507_10201640 Ga0307507_102016402 71
106 3300035172 Ga0373955_0341893 Ga0373955_0341893_458_673 71
107 3300036401 Ga0373937_1449053 Ga0373937_1449053_146_361 71
108 3300037312 Ga0395899_0171144 Ga0395899_0171144_1179_1394 71
109 3300037312 Ga0395899_0184667 Ga0395899_0184667_410_625 71
110 3300037418 Ga0395900_0119764 Ga0395900_0119764_905_1120 71
111 3300037418 Ga0395900_0691168 Ga0395900_0691168_68_283 71
112 3300037466 Ga0395898_0286486 Ga0395898_0286486_415_630 71
113 3300037466 Ga0395898_0615145 Ga0395898_0615145_499_714 71
114 3300037471 Ga0395905_1088611 Ga0395905_1088611_250_465 71
115 3300038443 Ga0395901_0427355 Ga0395901_0427355_748_963 71
116 3300038443 Ga0395901_0716091 Ga0395901_0716091_393_608 71
117 3300039437 Ga0436365_1736647 Ga0436365_1736647_341_556 71
118 3300039450 Ga0436363_0099087 Ga0436363_0099087_68_283 71
119 3300041453 Ga0451797_0441516 Ga0451797_0441516_311_526 71
120 3300041460 Ga0451802_0187384 Ga0451802_0187384_388_603 71
121 3300041486 Ga0451807_0057988 Ga0451807_0057988_81_296 71
122 3300041491 Ga0451833_0205676 Ga0451833_0205676_10_225 71
123 3300041511 Ga0451855_1030520 Ga0451855_1030520_17_232 71
124 3300041512 Ga0451853_1073962 Ga0451853_1073962_168_383 71
125 3300041512 Ga0451853_2349798 Ga0451853_2349798_265_480 71
126 3300044694 Ga0466963_0832850 Ga0466963_0832850_426_641 71
127 3300045976 Ga0466967_0979970 Ga0466967_0979970_432_647 71
128 3300046519 Ga0495632_0135268 Ga0495632_0135268_755_970 71
129 3300046537 Ga0495598_0371640 Ga0495598_0371640_193_408 71
130 3300049515 Ga0501292_019671 Ga0501292_019671_370_585 71
131 3300049518 Ga0501295_188651 Ga0501295_188651_30_245 71
132 3300049569 Ga0501032_0165569 Ga0501032_0165569_1057_1272 71
133 3300049570 Ga0501033_1110839 Ga0501033_1110839_162_377 71
134 3300049583 Ga0501067_0420557 Ga0501067_0420557_367_582 71
135 3300049584 Ga0501068_0094367 Ga0501068_0094367_123_338 71
136 3300049585 Ga0501069_0641984 Ga0501069_0641984_313_528 71
137 3300049586 Ga0501070_0114572 Ga0501070_0114572_853_1068 71
138 3300049586 Ga0501070_1395099 Ga0501070_1395099_252_467 71
139 3300049586 Ga0501070_1430946 Ga0501070_1430946_244_459 71
140 3300049589 Ga0501073_0172154 Ga0501073_0172154_978_1193 71
141 3300049665 Ga0501227_140362 Ga0501227_140362_385_600 71
142 3300049689 Ga0501260_028355 Ga0501260_028355_325_540 71
143 3300049742 Ga0501080_0951893 Ga0501080_0951893_397_612 71
144 3300049744 Ga0501083_0172729 Ga0501083_0172729_1094_1309 71
145 3300050490 nmdc:mga03n38_722384_c1 nmdc:mga03n38_722384_c1_265_480 71
146 3300050508 nmdc:mga09592_1539735_c1 nmdc:mga09592_1539735_c1_189_404 71
147 3300050508 nmdc:mga09592_288578_c1 nmdc:mga09592_288578_c1_258_473 71
148 3300050508 nmdc:mga09592_309616_c1 nmdc:mga09592_309616_c1_1068_1283 71
149 3300050508 nmdc:mga09592_97808_c1 nmdc:mga09592_97808_c1_792_1007 71
150 3300050510 nmdc:mga06r32_502175_c1 nmdc:mga06r32_502175_c1_492_707 71
151 3300050513 nmdc:mga0rr50_420144_c1 nmdc:mga0rr50_420144_c1_474_689 71
152 3300059645 Ga0587076_169748 Ga0587076_169748_54_269 71
153 3300060353 Ga0501082_1157392 Ga0501082_1157392_331_546 71
154 3300004798 Ga0058859_10158040 Ga0058859_101580402 72
155 3300004801 Ga0058860_10033033 Ga0058860_100330332 72
156 3300005329 Ga0070683_101475907 Ga0070683_1014759071 72
157 3300005331 Ga0070670_100675230 Ga0070670_1006752302 72
158 3300005334 Ga0068869_100267111 Ga0068869_1002671112 72
159 3300005336 Ga0070680_100470020 Ga0070680_1004700201 72
160 3300005337 Ga0070682_100180663 Ga0070682_1001806632 72
161 3300005337 Ga0070682_100751009 Ga0070682_1007510092 72
162 3300005338 Ga0068868_101463121 Ga0068868_1014631212 72
163 3300005340 Ga0070689_100182198 Ga0070689_1001821982 72
164 3300005340 Ga0070689_100381147 Ga0070689_1003811472 72
165 3300005343 Ga0070687_100213717 Ga0070687_1002137172 72
166 3300005355 Ga0070671_101719641 Ga0070671_1017196412 72
167 3300005365 Ga0070688_101221352 Ga0070688_1012213522 72
168 3300005437 Ga0070710_10189443 Ga0070710_101894432 72
169 3300005438 Ga0070701_10874541 Ga0070701_108745412 72
170 3300005440 Ga0070705_100354669 Ga0070705_1003546692 72
171 3300005441 Ga0070700_100658760 Ga0070700_1006587602 72
172 3300005471 Ga0070698_100006791 Ga0070698_1000067917 72
173 3300005530 Ga0070679_100333817 Ga0070679_1003338172 72
174 3300005536 Ga0070697_100386486 Ga0070697_1003864862 72
175 3300005546 Ga0070696_100402025 Ga0070696_1004020252 72
176 3300005548 Ga0070665_100004396 Ga0070665_10000439614 72
177 3300005549 Ga0070704_101256482 Ga0070704_1012564822 72
178 3300005615 Ga0070702_100152358 Ga0070702_1001523582 72
179 3300005615 Ga0070702_101260459 Ga0070702_1012604592 72
180 3300005617 Ga0068859_102836631 Ga0068859_1028366312 72
181 3300005618 Ga0068864_100843343 Ga0068864_1008433432 72
182 3300005840 Ga0068870_10991240 Ga0068870_109912401 72
183 3300005841 Ga0068863_100769222 Ga0068863_1007692222 72
184 3300005842 Ga0068858_100630976 Ga0068858_1006309761 72
185 3300005844 Ga0068862_100350500 Ga0068862_1003505002 72
186 3300005844 Ga0068862_101731261 Ga0068862_1017312612 72
187 3300006028 Ga0070717_10095258 Ga0070717_100952582 72
188 3300006028 Ga0070717_10120330 Ga0070717_101203302 72
189 3300006237 Ga0097621_101238612 Ga0097621_1012386122 72
190 3300006931 Ga0097620_101990271 Ga0097620_1019902712 72
191 3300006931 Ga0097620_102836658 Ga0097620_1028366582 72
192 3300007076 Ga0075435_100606357 Ga0075435_1006063572 72
193 3300009092 Ga0105250_10445457 Ga0105250_104454572 72
194 3300009093 Ga0105240_10789697 Ga0105240_107896972 72
195 3300009098 Ga0105245_10000243 Ga0105245_1000024347 72
196 3300009098 Ga0105245_10304988 Ga0105245_103049882 72
197 3300009098 Ga0105245_10797752 Ga0105245_107977522 72
198 3300009148 Ga0105243_10472286 Ga0105243_104722862 72
199 3300009174 Ga0105241_10224017 Ga0105241_102240172 72
200 3300009177 Ga0105248_11977245 Ga0105248_119772452 72
201 3300009177 Ga0105248_12012565 Ga0105248_120125652 72
202 3300010375 Ga0105239_10157400 Ga0105239_101574002 72
203 3300011119 Ga0105246_10582420 Ga0105246_105824202 72
204 3300013297 Ga0157378_12656069 Ga0157378_126560692 72
205 3300013307 Ga0157372_11130111 Ga0157372_111301112 72
206 3300014325 Ga0163163_12134355 Ga0163163_121343552 72
207 3300014968 Ga0157379_11375374 Ga0157379_113753742 72
208 3300014969 Ga0157376_10391334 Ga0157376_103913341 72
209 3300014969 Ga0157376_11467309 Ga0157376_114673092 72
210 3300025898 Ga0207692_10206737 Ga0207692_102067372 72
211 3300025908 Ga0207643_10089326 Ga0207643_100893262 72
212 3300025909 Ga0207705_10955254 Ga0207705_109552541 72
213 3300025917 Ga0207660_10816099 Ga0207660_108160992 72
214 3300025918 Ga0207662_10076807 Ga0207662_100768072 72
215 3300025921 Ga0207652_10107914 Ga0207652_101079142 72
216 3300025922 Ga0207646_10363200 Ga0207646_103632002 72
217 3300025924 Ga0207694_11821925 Ga0207694_118219252 72
218 3300025927 Ga0207687_10000298 Ga0207687_1000029830 72
219 3300025932 Ga0207690_10475288 Ga0207690_104752882 72
220 3300025936 Ga0207670_10119721 Ga0207670_101197212 72
221 3300025936 Ga0207670_10133810 Ga0207670_101338102 72
222 3300025936 Ga0207670_10165714 Ga0207670_101657142 72
223 3300025942 Ga0207689_10196944 Ga0207689_101969442 72
224 3300025942 Ga0207689_10429606 Ga0207689_104296062 72
225 3300025942 Ga0207689_10908503 Ga0207689_109085032 72
226 3300025949 Ga0207667_10638263 Ga0207667_106382632 72
227 3300026075 Ga0207708_10626900 Ga0207708_106269002 72
228 3300026095 Ga0207676_10803488 Ga0207676_108034882 72
229 3300026116 Ga0207674_11433977 Ga0207674_114339771 72
230 3300028379 Ga0268266_10009749 Ga0268266_100097496 72
231 3300028380 Ga0268265_10293279 Ga0268265_102932792 72
232 3300028381 Ga0268264_10159564 Ga0268264_101595643 72
233 3300028381 Ga0268264_12286356 Ga0268264_122863562 72
234 3300028786 Ga0307517_10135229 Ga0307517_101352292 72
235 3300028800 Ga0265338_10049527 Ga0265338_100495272 72
236 3300028800 Ga0265338_10066151 Ga0265338_100661515 72
237 3300031240 Ga0265320_10546490 Ga0265320_105464902 72
238 3300031250 Ga0265331_10084484 Ga0265331_100844842 72
239 3300031456 Ga0307513_10027339 Ga0307513_100273394 72
240 3300031456 Ga0307513_10584690 Ga0307513_105846902 72
241 3300031507 Ga0307509_10000010 Ga0307509_10000010104 72
242 3300031507 Ga0307509_10148750 Ga0307509_101487502 72
243 3300031507 Ga0307509_10354809 Ga0307509_103548092 72
244 3300031730 Ga0307516_10275314 Ga0307516_102753142 72
245 3300031901 Ga0307406_10005751 Ga0307406_100057514 72
246 3300031901 Ga0307406_10781006 Ga0307406_107810062 72
247 3300031911 Ga0307412_10812439 Ga0307412_108124392 72
248 3300032005 Ga0307411_11700792 Ga0307411_117007921 72
249 3300032126 Ga0307415_100551180 Ga0307415_1005511802 72
250 3300035090 Ga0373949_0001625 Ga0373949_0001625_987_1205 72
251 3300035118 Ga0373954_0107670 Ga0373954_0107670_169_387 72
252 3300035241 Ga0373961_0000001 Ga0373961_0000001_114267_114485 72
253 3300037418 Ga0395900_0894682 Ga0395900_0894682_305_529 72
254 3300037471 Ga0395905_0677547 Ga0395905_0677547_276_500 72
255 3300041443 Ga0451789_1073330 Ga0451789_1073330_305_523 72
256 3300041452 Ga0451793_1324066 Ga0451793_1324066_364_582 72
257 3300041458 Ga0451798_0009019 Ga0451798_0009019_204_422 72
258 3300041494 Ga0451837_1024304 Ga0451837_1024304_114_332 72
259 3300041512 Ga0451853_1942291 Ga0451853_1942291_369_587 72
260 3300044673 Ga0453683_1189363 Ga0453683_1189363_282_500 72
261 3300046500 Ga0495596_0379033 Ga0495596_0379033_199_417 72
262 3300046517 Ga0495630_0747832 Ga0495630_0747832_11_229 72
263 3300046557 Ga0495622_0206987 Ga0495622_0206987_87_305 72
264 3300046616 Ga0495668_0322256 Ga0495668_0322256_369_587 72
265 3300047321 Ga0495676_0566255 Ga0495676_0566255_160_378 72
266 3300048918 Ga0496115_0471156 Ga0496115_0471156_168_386 72
267 3300048918 Ga0496115_0970231 Ga0496115_0970231_66_284 72
268 3300049581 Ga0501047_1191761 Ga0501047_1191761_202_429 72
269 3300049586 Ga0501070_0175723 Ga0501070_0175723_1272_1490 72
270 3300049591 Ga0501075_0608800 Ga0501075_0608800_328_546 72
271 3300049654 Ga0501207_081751 Ga0501207_081751_273_491 72
272 3300049656 Ga0501209_007106 Ga0501209_007106_1309_1527 72
273 3300049660 Ga0501216_003079 Ga0501216_003079_198_416 72
274 3300049661 Ga0501217_003905 Ga0501217_003905_1696_1914 72
275 3300049665 Ga0501227_001077 Ga0501227_001077_802_1020 72
276 3300049666 Ga0501228_003789 Ga0501228_003789_624_842 72
277 3300049667 Ga0501230_001017 Ga0501230_001017_2022_2240 72
278 3300049668 Ga0501233_002675 Ga0501233_002675_2117_2335 72
279 3300049669 Ga0501235_098379 Ga0501235_098379_375_593 72
280 3300049670 Ga0501236_001810 Ga0501236_001810_242_460 72
281 3300049705 Ga0501225_0020964 Ga0501225_0020964_1306_1524 72
282 3300049706 Ga0501229_009805 Ga0501229_009805_30_248 72
283 3300050509 nmdc:mga0qj67_745944_c1 nmdc:mga0qj67_745944_c1_407_625 72
284 3300050513 nmdc:mga0rr50_1201822_c1 nmdc:mga0rr50_1201822_c1_272_499 72
285 3300053090 Ga0500646_0077676 Ga0500646_0077676_37_255 72
286 3300053094 Ga0500566_0088382 Ga0500566_0088382_632_850 72
287 3300053094 Ga0500566_0211978 Ga0500566_0211978_607_825 72
288 3300053095 Ga0500640_008454 Ga0500640_008454_199_417 72
289 3300053098 Ga0500650_0124440 Ga0500650_0124440_186_404 72
290 3300053099 Ga0500654_188687 Ga0500654_188687_27_245 72
291 3300053102 Ga0500554_046647 Ga0500554_046647_414_632 72
292 3300053111 Ga0500572_005851 Ga0500572_005851_2319_2537 72
293 3300053118 Ga0500594_0015718 Ga0500594_0015718_456_674 72
294 3300053119 Ga0500595_000273 Ga0500595_000273_3671_3889 72
295 3300053120 Ga0500597_162349 Ga0500597_162349_530_748 72
296 3300053123 Ga0500614_054080 Ga0500614_054080_11_229 72
297 3300053131 Ga0500652_206609 Ga0500652_206609_370_588 72
298 3300053136 Ga0500559_0067611 Ga0500559_0067611_671_889 72
299 3300053139 Ga0500568_0017205 Ga0500568_0017205_324_542 72
300 3300053143 Ga0500579_139212 Ga0500579_139212_283_501 72
301 3300053156 Ga0500622_0026580 Ga0500622_0026580_303_521 72
302 3300053178 Ga0500637_0213827 Ga0500637_0213827_687_905 72
303 3300059490 Ga0587066_111784 Ga0587066_111784_295_513 72
304 3300005345 Ga0070692_10077019 Ga0070692_100770192 73
305 3300006880 Ga0075429_101306298 Ga0075429_1013062982 73
306 3300009094 Ga0111539_10813716 Ga0111539_108137162 73
307 3300013297 Ga0157378_10105601 Ga0157378_101056012 73
308 3300025910 Ga0207684_10351020 Ga0207684_103510202 73
309 3300031507 Ga0307509_10327887 Ga0307509_103278872 73
310 3300031507 Ga0307509_10502121 Ga0307509_105021212 73
311 3300035119 Ga0373956_0132929 Ga0373956_0132929_620_841 73
312 3300037471 Ga0395905_0379506 Ga0395905_0379506_703_924 73
313 3300049585 Ga0501069_0273808 Ga0501069_0273808_182_403 73
314 3300049586 Ga0501070_0380894 Ga0501070_0380894_241_462 73
315 3300049587 Ga0501071_0524133 Ga0501071_0524133_415_636 73
316 3300050510 nmdc:mga06r32_1141552_c1 nmdc:mga06r32_1141552_c1_237_458 73
317 3300053080 Ga0500635_0051869 Ga0500635_0051869_843_1064 73
318 3300053086 Ga0500578_0387084 Ga0500578_0387084_166_387 73
319 3300053094 Ga0500566_0127172 Ga0500566_0127172_725_946 73
320 3300053138 Ga0500564_264634 Ga0500564_264634_245_466 73
321 3300053150 Ga0500603_062805 Ga0500603_062805_555_776 73
322 3300059639 Ga0587062_097786 Ga0587062_097786_77_298 73
323 3300004798 Ga0058859_10078124 Ga0058859_100781242 74

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ca9-assembly1.cif.gz_A apo-nikr from helicobacter pylori in closed trans-conformation 0.8605 11 49
6a6x-assembly1.cif.gz_D the crystal structure of the mtb maze-mazf-mt9 complex 0.8598 11 56
6kyt-assembly1.cif.gz_P the structure of the m. tb toxin mazef-mt1 complex 0.853 11 48
1p94-assembly1.cif.gz_B nmr structure of parg symmetric dimer 0.8504 11 45
3od2-assembly1.cif.gz_B-2 e. coli nikr soaked with excess nickel ions 0.8497 11 53
ID Description Score Start End Superfamily
af_Q8I2Q2_12_119_2.170.150.20 Mainly Beta;Beta Complex;Metal Binding Protein, Guanine Nucleotide Exchange Factor; Chain A;Peptide methionine sulfoxide reductase. 0.869 59 72 2.170.150.20
1q5vC01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant;Met repressor-like 0.8603 11 47 1.10.1220.10
1ea4K00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant;Met repressor-like 0.8532 11 49 1.10.1220.10
af_Q9VAC5_28_164_2.40.128.200 Mainly Beta;Beta Barrel;Lipocalin;C-type lysozyme inhibitor 0.8507 59 74 2.40.128.200
1p94B00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant;Met repressor-like 0.8504 11 45 1.10.1220.10
ID Description Score Start End GO Terms
AF-A0A0F9RVT4-F1-model_v4 Ribbon-helix-helix protein CopG domain-containing protein 0.9059 11 74
AF-A0A2D6KXC9-F1-model_v4 CopG family transcriptional regulator 0.897 11 74
AF-A0A0R0C7L1-F1-model_v4 Ribbon-helix-helix protein CopG domain-containing protein 0.885 11 74 GO:0006355
AF-A0A2H0KE44-F1-model_v4 Uncharacterized protein 0.8571 11 74
AF-A0A5Q4GXM3-F1-model_v4 Ribbon-helix-helix protein CopG domain-containing protein 0.8551 11 74

Feature Viewer

pLDDT pTM Quality
89.39 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map