F406691

General Info

Members Datasets Scaffolds Average Seq Length
322 219 642 331

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2517572101|2517764320
Length 392
Sequence DLLLGVMVAGLTAYALLAGADFGGGVWDLLARSHEAGDVRTLVAGALGPVWEANHVWLIFVIVAMFSGFPPAFGVVGSTLELPLALALVGIVLRGAAYVYRAYGDGGAGPDHWWGHVFAAASTITPFALGISGAALATGDLSPDDPAAPLTSPFGLVAGVFAVVATAFLAAVYLCRDAASSPAAEHLVPYFRRRALGGAVTAGALATVLLPLLWRDAPVVASRFTERALPFVALSAAGGIAALALVWRRRFTLARLAAGLAVAAVLWGWAAAQYPDLVVGHTTVTDAAAPTANIHALLLAIGGGIVALVPALLTLFRLFSHPEPPTPPPAPNHQHAAEHQQKPTHHRKRRRRPRGCGAVPELAEDTDEALTAQCVDLVEEQDQRPGAGPRPG

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
40 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
43 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
54 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
61 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
62 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
71 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
102 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
104 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
105 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
106 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
107 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
108 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
109 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
110 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
111 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
112 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
113 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
114 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
115 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
116 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
117 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
118 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
119 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
120 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
121 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
122 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
123 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
124 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
125 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
126 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
127 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
128 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
129 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
130 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
131 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
132 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
133 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
134 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
135 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
136 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
137 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
138 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
139 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
140 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
141 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
142 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
143 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
144 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
145 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
146 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
147 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
148 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
149 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
150 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
160 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
161 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
162 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
163 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
164 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
165 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
166 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
167 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
168 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
169 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
170 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
171 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
172 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
175 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
176 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
177 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
178 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
179 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
180 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
181 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
182 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
183 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
184 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
185 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
186 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
187 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
188 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
189 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
190 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
191 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
192 2517572101 Frankia sp. DC12 Isolate Nodule
193 2506783011 Frankia datiscae Dg1 Isolate Nodule
194 2508501039 Frankia saprophytica CN3 Isolate Nodule
195 2527291627 Frankia casuarinae Thr Isolate Nodule
196 2527291629 Frankia sp. BMG5.23 Isolate Nodule
197 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
198 2576861822 Frankia sp. CeD Isolate Nodule
199 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
200 2619618881 Frankia sp. ACN1ag Isolate Unclassified
201 2619619003 Frankia sp. CpI1-P Isolate Nodule
202 2626541554 Frankia sp. AvcI.1 Isolate Nodule
203 2671180195 Frankia sp. CcI49 Isolate Nodule
204 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
205 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
206 2684623036 Frankia sp. CgIM4 Isolate Nodule
207 2687453737 Frankia sp. BMG5.36 Isolate Nodule
208 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
209 2710264753 Frankia sp. KB5 Isolate Nodule
210 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
211 2773857922 Frankia sp. CcI49 Isolate Nodule
212 2773857924 Frankia sp. CgIS1 Isolate Nodule
213 2773857933 Frankia sp. BMG5.30 Isolate Nodule
214 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
215 637000116 Frankia casuarinae CcI3 Isolate Nodule
216 8002775197 Frankia nepalensis CN7 Isolate Nodule
217 8054913762 Frankia gtarii Agncl-10 Isolate Nodule
218 8054920844 Frankia tisae Agncl-8 Isolate Nodule
219 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.99
Metatranscriptomes 0.31
Isolates 8.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.93
Nodule 7.14
Rhizoplane 0.62
Rhizosphere 88.2
Stem 0
Stem Tuber 0
Unclassified 8.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10000220 3300005290 Bacteria 23138
2 Ga0065715_10135648 3300005293 Bacteria 1935
3 Ga0065707_10120214 3300005295 Bacteria 2140
4 Ga0070658_10016746 3300005327 Bacteria 5868
5 Ga0070683_100043302 3300005329 Bacteria 4149
6 Ga0070683_100221062 3300005329 Bacteria 1800
7 Ga0070690_100024734 3300005330 Bacteria 3694
8 Ga0070680_100001994 3300005336 Bacteria 15028
9 Ga0068868_100046567 3300005338 Bacteria 3395
10 Ga0070689_100231211 3300005340 Bacteria 1520
11 Ga0070668_100141007 3300005347 Bacteria 1942
12 Ga0070668_100419919 3300005347 Bacteria 1145
13 Ga0070675_100061172 3300005354 Bacteria 3109
14 Ga0070673_100005724 3300005364 Bacteria 7991
15 Ga0070714_100006261 3300005435 Bacteria 9167
16 Ga0070711_100280040 3300005439 Bacteria 1319
17 Ga0070705_100107166 3300005440 Unclassified 1778
18 Ga0070708_100066804 3300005445 Bacteria 3228
19 Ga0070662_100375859 3300005457 Unclassified 1169
20 Ga0070681_10009697 3300005458 Bacteria 9475
21 Ga0070706_100012195 3300005467 Bacteria 7966
22 Ga0070706_100262461 3300005467 Bacteria 1612
23 Ga0070707_100161379 3300005468 Bacteria 2184
24 Ga0070698_100000705 3300005471 Bacteria 35680
25 Ga0070699_100001806 3300005518 Bacteria 19452
26 Ga0070679_100079660 3300005530 Bacteria 3265
27 Ga0070679_100171691 3300005530 Bacteria 2141
28 Ga0070684_100030459 3300005535 Bacteria 4584
29 Ga0070684_100143851 3300005535 Bacteria 2158
30 Ga0070697_100012117 3300005536 Bacteria 6751
31 Ga0070697_100018585 3300005536 Bacteria 5481
32 Ga0070697_100041805 3300005536 Bacteria 3711
33 Ga0068853_100061781 3300005539 Bacteria 3241
34 Ga0070672_100011116 3300005543 Bacteria 6269
35 Ga0070672_100035983 3300005543 Unclassified 3768
36 Ga0070665_100023327 3300005548 Bacteria 6229
37 Ga0068855_100016303 3300005563 Bacteria 8937
38 Ga0068855_100129992 3300005563 Bacteria 2876
39 Ga0070664_100042580 3300005564 Bacteria 3833
40 Ga0070664_100225134 3300005564 Bacteria 1679
41 Ga0068857_100004590 3300005577 Bacteria 11694
42 Ga0068857_100240536 3300005577 Bacteria 1657
43 Ga0068854_100004988 3300005578 Bacteria 8372
44 Ga0068856_100048948 3300005614 Bacteria 4166
45 Ga0068856_100158373 3300005614 Bacteria 2274
46 Ga0068859_100018467 3300005617 Bacteria 7009
47 Ga0068859_100037109 3300005617 Bacteria 4891
48 Ga0068859_100074562 3300005617 Bacteria 3432
49 Ga0068859_100356687 3300005617 Bacteria 1557
50 Ga0068863_100003844 3300005841 Bacteria 14853
51 Ga0068863_100133178 3300005841 Bacteria 2374
52 Ga0068858_100033341 3300005842 Bacteria 4780
53 Ga0068858_100082365 3300005842 Bacteria 2991
54 Ga0068858_100165865 3300005842 Bacteria 2081
55 Ga0068860_100383352 3300005843 Bacteria 1388
56 Ga0068862_100134883 3300005844 Unclassified 2187
57 Ga0081455_10054806 3300005937 Bacteria 3396
58 Ga0081539_10003277 3300005985 Bacteria 20309
59 Ga0081539_10068254 3300005985 Bacteria 1919
60 Ga0070717_10178933 3300006028 Bacteria 1847
61 Ga0075367_10015614 3300006178 Bacteria 4133
62 Ga0068871_100098785 3300006358 Bacteria 2442
63 Ga0068871_100271070 3300006358 Unclassified 1483
64 Ga0075430_100122849 3300006846 Bacteria 2165
65 Ga0075430_100148142 3300006846 Bacteria 1954
66 Ga0075433_10026109 3300006852 Bacteria 4942
67 Ga0075429_100027051 3300006880 Bacteria 4981
68 Ga0075429_100086705 3300006880 Bacteria 2729
69 Ga0075436_100009776 3300006914 Bacteria 6561
70 Ga0097620_100018467 3300006931 Bacteria 7009
71 Ga0097620_100037109 3300006931 Bacteria 4891
72 Ga0097620_100074565 3300006931 Bacteria 3432
73 Ga0097620_100356692 3300006931 Bacteria 1557
74 Ga0099794_10044249 3300007265 Bacteria 2127
75 Ga0105240_10022179 3300009093 Bacteria 8423
76 Ga0105240_10447017 3300009093 Bacteria 1447
77 Ga0111539_10005373 3300009094 Bacteria 16565
78 Ga0111539_10047484 3300009094 Bacteria 5130
79 Ga0105245_10002124 3300009098 Bacteria 17956
80 Ga0105245_10010350 3300009098 Bacteria 8124
81 Ga0105245_10301881 3300009098 Bacteria 1571
82 Ga0105247_10000156 3300009101 Bacteria 67016
83 Ga0105247_10000255 3300009101 Bacteria 49266
84 Ga0114129_10001014 3300009147 Bacteria 36622
85 Ga0114129_10001587 3300009147 Bacteria 30857
86 Ga0114129_10294914 3300009147 Bacteria 2163
87 Ga0105243_10209365 3300009148 Bacteria 1716
88 Ga0105241_10003560 3300009174 Bacteria 11584
89 Ga0105241_10248205 3300009174 Bacteria 1508
90 Ga0105242_10062238 3300009176 Unclassified 3071
91 Ga0105242_10062675 3300009176 Bacteria 3060
92 Ga0105242_10102441 3300009176 Unclassified 2428
93 Ga0105248_10001256 3300009177 Bacteria 28350
94 Ga0105248_10001503 3300009177 Bacteria 25938
95 Ga0105248_10122054 3300009177 Bacteria 2939
96 Ga0105248_10177518 3300009177 Bacteria 2400
97 Ga0105237_10162012 3300009545 Bacteria 2235
98 Ga0105238_10000241 3300009551 Bacteria 61118
99 Ga0105238_10006425 3300009551 Bacteria 11692
100 Ga0105238_10053937 3300009551 Bacteria 4039
101 Ga0105238_10147141 3300009551 Bacteria 2332
102 Ga0105239_10012480 3300010375 Bacteria 9462
103 Ga0105239_10076400 3300010375 Unclassified 3684
104 Ga0157374_10026033 3300013296 Bacteria 5259
105 Ga0157378_10025654 3300013297 Bacteria 5189
106 Ga0163162_10008426 3300013306 Bacteria 10053
107 Ga0157375_10141923 3300013308 Unclassified 2529
108 Ga0157375_10196346 3300013308 Unclassified 2173
109 Ga0163163_10039237 3300014325 Bacteria 4621
110 Ga0157377_10054447 3300014745 Bacteria 2265
111 Ga0157376_10272435 3300014969 Bacteria 1591
112 Ga0206353_11085181 3300020082 Bacteria 3198
113 Ga0213875_10056528 3300021388 Bacteria 1838
114 Ga0207710_10000130 3300025900 Bacteria 90509
115 Ga0207710_10000170 3300025900 Bacteria 67024
116 Ga0207647_10005406 3300025904 Bacteria 9376
117 Ga0207645_10167096 3300025907 Bacteria 1441
118 Ga0207684_10009285 3300025910 Bacteria 8687
119 Ga0207654_10005946 3300025911 Bacteria 6142
120 Ga0207707_10027207 3300025912 Bacteria 5001
121 Ga0207695_10003308 3300025913 Bacteria 22844
122 Ga0207671_10000910 3300025914 Bacteria 37314
123 Ga0207671_10098694 3300025914 Bacteria 2209
124 Ga0207663_10223491 3300025916 Bacteria 1371
125 Ga0207660_10001898 3300025917 Bacteria 13917
126 Ga0207652_10254241 3300025921 Unclassified 1585
127 Ga0207694_10000405 3300025924 Bacteria 40220
128 Ga0207694_10022664 3300025924 Bacteria 4764
129 Ga0207694_10140538 3300025924 Bacteria 1941
130 Ga0207659_10146443 3300025926 Bacteria 1839
131 Ga0207687_10007092 3300025927 Bacteria 7386
132 Ga0207664_10073660 3300025929 Bacteria 2756
133 Ga0207706_10407379 3300025933 Unclassified 1179
134 Ga0207686_10036683 3300025934 Bacteria 2953
135 Ga0207670_10026781 3300025936 Bacteria 3638
136 Ga0207711_10000066 3300025941 Bacteria 119066
137 Ga0207711_10010607 3300025941 Bacteria 7662
138 Ga0207711_10094683 3300025941 Bacteria 2632
139 Ga0207711_10229752 3300025941 Unclassified 1699
140 Ga0207661_10309852 3300025944 Bacteria 1417
141 Ga0207667_10107544 3300025949 Bacteria 2878
142 Ga0207640_10137976 3300025981 Bacteria 1773
143 Ga0207658_10275586 3300025986 Unclassified 1440
144 Ga0207658_10306595 3300025986 Unclassified 1370
145 Ga0207703_10010661 3300026035 Bacteria 7178
146 Ga0207703_10105224 3300026035 Bacteria 2398
147 Ga0207703_10138021 3300026035 Bacteria 2113
148 Ga0207639_10060659 3300026041 Bacteria 2918
149 Ga0207702_10014643 3300026078 Bacteria 6509
150 Ga0207641_10000646 3300026088 Bacteria 37941
151 Ga0207641_10117648 3300026088 Unclassified 2367
152 Ga0207674_10014553 3300026116 Bacteria 8683
153 Ga0207675_100295920 3300026118 Unclassified 1575
154 Ga0207698_10061855 3300026142 Bacteria 2920
155 Ga0207698_10151210 3300026142 Unclassified 2015
156 Ga0207428_10053084 3300027907 Bacteria 3233
157 Ga0268266_10056924 3300028379 Bacteria 3363
158 Ga0265336_10011631 3300028666 Bacteria 2985
159 Ga0265320_10029146 3300031240 Bacteria 2858
160 Ga0265339_10006539 3300031249 Bacteria 7637
161 Ga0265342_10000349 3300031712 Bacteria 51668
162 Ga0307406_10113227 3300031901 Bacteria 1872
163 Ga0307507_10000013 3300033179 Bacteria 242708
164 Ga0373929_0000001 3300035085 Bacteria 956023
165 Ga0373934_0030345 3300035086 Bacteria 2114
166 Ga0373954_0064667 3300035118 Bacteria 1730
167 Ga0373955_0001154 3300035172 Bacteria 11204
168 Ga0373955_0079368 3300035172 Bacteria 1851
169 Ga0373935_0105898 3300035692 Bacteria 1860
170 Ga0373933_0137453 3300035724 Bacteria 1540
171 Ga0373937_0029588 3300036401 Bacteria 4961
172 Ga0373937_0079787 3300036401 Bacteria 3025
173 Ga0436364_0683334 3300037853 Bacteria 2222
174 Ga0439435_0009915 3300042436 Bacteria 2247
175 Ga0451577_0000001 3300042876 Bacteria 2461803
176 Ga0451577_0000041 3300042876 Bacteria 335318
177 Ga0451577_0170900 3300042876 Bacteria 1958
178 Ga0466969_0003913 3300044656 Bacteria 7908
179 Ga0466972_0053903 3300044658 Bacteria 1936
180 Ga0453683_0000056 3300044673 Bacteria 192299
181 Ga0453683_0000591 3300044673 Bacteria 40145
182 Ga0453683_0145607 3300044673 Unclassified 1496
183 Ga0466966_0003546 3300044684 Bacteria 10302
184 Ga0466961_0006216 3300044693 Bacteria 7585
185 Ga0466963_0015525 3300044694 Bacteria 4719
186 Ga0466963_0018960 3300044694 Bacteria 4308
187 Ga0453684_0000066 3300044712 Bacteria 465545
188 Ga0453684_0198904 3300044712 Bacteria 2337
189 Ga0466971_0000616 3300044719 Bacteria 14158
190 Ga0466971_0006775 3300044719 Bacteria 4985
191 Ga0466971_0042430 3300044719 Bacteria 2044
192 Ga0466971_0137433 3300044719 Bacteria 1137
193 Ga0466968_0080598 3300044735 Bacteria 1429
194 Ga0466959_0000507 3300045049 Bacteria 22618
195 Ga0466959_0080157 3300045049 Bacteria 2354
196 Ga0451576_0000207 3300045051 Bacteria 147627
197 Ga0451576_0045594 3300045051 Bacteria 4616
198 Ga0451576_0204584 3300045051 Bacteria 2061
199 Ga0466967_0085963 3300045976 Bacteria 2849
200 Ga0495603_0109485 3300046455 Bacteria 1612
201 Ga0495651_0000079 3300046462 Bacteria 71581
202 Ga0495651_0001189 3300046462 Bacteria 20109
203 Ga0495651_0058319 3300046462 Bacteria 2962
204 Ga0495651_0189372 3300046462 Bacteria 1449
205 Ga0495664_0194581 3300046477 Bacteria 1229
206 Ga0495608_0149241 3300046511 Bacteria 1490
207 Ga0495618_0032918 3300046514 Bacteria 3249
208 Ga0495628_0004113 3300046516 Bacteria 12945
209 Ga0495628_0181569 3300046516 Bacteria 1591
210 Ga0495648_0102229 3300046524 Bacteria 1579
211 Ga0495652_0000639 3300046529 Bacteria 40668
212 Ga0495652_0001359 3300046529 Bacteria 27221
213 Ga0495587_0034837 3300046536 Bacteria 3035
214 Ga0495645_0091885 3300046543 Bacteria 2167
215 Ga0495645_0112675 3300046543 Bacteria 1923
216 Ga0495667_0002129 3300046559 Bacteria 13185
217 Ga0495599_0078751 3300046678 Bacteria 2058
218 Ga0495623_0019461 3300046679 Bacteria 4387
219 Ga0495646_0025559 3300046680 Bacteria 3714
220 Ga0495600_0023862 3300046809 Bacteria 3935
221 Ga0495600_0029629 3300046809 Bacteria 3544
222 Ga0495604_0014949 3300047317 Bacteria 6191
223 Ga0495604_0099727 3300047317 Bacteria 2137
224 Ga0496109_0120789 3300048912 Bacteria 2441
225 Ga0496119_0002250 3300048922 Bacteria 21471
226 Ga0496119_0002436 3300048922 Bacteria 20424
227 Ga0496120_0000779 3300048923 Bacteria 46103
228 Ga0496120_0000912 3300048923 Bacteria 41157
229 Ga0501036_0052079 3300049572 Bacteria 3467
230 Ga0501036_0083134 3300049572 Bacteria 2706
231 Ga0501036_0333438 3300049572 Bacteria 1267
232 Ga0501037_0080183 3300049573 Bacteria 2369
233 Ga0501039_0005739 3300049575 Bacteria 9400
234 Ga0501040_0009949 3300049576 Bacteria 6210
235 Ga0501040_0181530 3300049576 Bacteria 1492
236 Ga0501041_0007304 3300049577 Bacteria 6484
237 Ga0501041_0014217 3300049577 Unclassified 4725
238 Ga0501042_0005067 3300049578 Bacteria 8454
239 Ga0501043_0239022 3300049579 Bacteria 1401
240 Ga0501046_0006629 3300049580 Bacteria 10224
241 Ga0501048_0012946 3300049582 Bacteria 6198
242 Ga0501048_0286069 3300049582 Unclassified 1172
243 Ga0501068_0000934 3300049584 Bacteria 15302
244 Ga0501070_0075817 3300049586 Bacteria 2784
245 Ga0501071_0187834 3300049587 Bacteria 1549
246 Ga0501072_0005964 3300049588 Bacteria 9287
247 Ga0501072_0050461 3300049588 Unclassified 3276
248 Ga0501073_0025897 3300049589 Bacteria 4202
249 Ga0501074_0009031 3300049590 Bacteria 7238
250 Ga0501075_0001905 3300049591 Bacteria 13762
251 Ga0501075_0018133 3300049591 Bacteria 5090
252 Ga0501076_0008760 3300049592 Bacteria 7433
253 Ga0501077_0080294 3300049593 Unclassified 2066
254 Ga0501235_017773 3300049669 Unclassified 1574
255 Ga0501080_0006381 3300049742 Bacteria 10581
256 Ga0501080_0453318 3300049742 Bacteria 1150
257 Ga0501081_0000945 3300049743 Bacteria 17260
258 Ga0501081_0040314 3300049743 Bacteria 3198
259 Ga0501081_0135878 3300049743 Bacteria 1760
260 Ga0501083_0009766 3300049744 Bacteria 6776
261 Ga0501035_0483983 3300049822 Bacteria 1020
262 Ga0501044_0032065 3300049823 Bacteria 5524
263 Ga0501045_0001624 3300049824 Bacteria 15074
264 Ga0501045_0024302 3300049824 Bacteria 4350
265 nmdc:mga05p37_34_c1 3300050507 Bacteria 111954
266 nmdc:mga05p37_5746_c1 3300050507 Bacteria 14592
267 nmdc:mga09592_23333_c1 3300050508 Bacteria 5110
268 nmdc:mga09592_46192_c1 3300050508 Bacteria 3668
269 nmdc:mga0qj67_179916_c1 3300050509 Bacteria 1717
270 nmdc:mga0qj67_272891_c1 3300050509 Bacteria 1371
271 nmdc:mga0qj67_54497_c1 3300050509 Unclassified 3167
272 nmdc:mga08y16_3280_c1 3300050511 Bacteria 16769
273 nmdc:mga0n895_137543_c1 3300050512 Bacteria 2470
274 nmdc:mga0rr50_296459_c1 3300050513 Bacteria 1352
275 nmdc:mga08x19_10816_c1 3300050514 Bacteria 5488
276 Ga0495612_0002569 3300053078 Bacteria 7485
277 Ga0495612_0017183 3300053078 Bacteria 2898
278 Ga0495619_0049824 3300053085 Bacteria 2763
279 Ga0500608_129197 3300053122 Bacteria 1135
280 Ga0500573_0019003 3300053140 Bacteria 3929
281 Ga0501084_0025609 3300054114 Unclassified 4920
282 Ga0501084_0136013 3300054114 Bacteria 2069
283 Ga0590071_028771 3300059421 Bacteria 1320
284 Ga0590077_002554 3300059426 Bacteria 3860
285 Ga0590077_002973 3300059426 Bacteria 3552
286 Ga0501082_0003287 3300060353 Bacteria 14109
287 Ga0501082_0045076 3300060353 Bacteria 3803
288 Ga0501082_0103628 3300060353 Bacteria 2461
289 Ga0466962_0000100 3300061719 Bacteria 34830
290 Ga0466962_0002993 3300061719 Bacteria 8060
291 Ga0466962_0051744 3300061719 Bacteria 1964
292 Ga0530510_0001890 3300061734 Bacteria 14306
293 Ga0530510_0003162 3300061734 Bacteria 11310
294 2517764320 2517572101 Bacteria 6884336
295 2506865118 2506783011 Bacteria 5323186
296 2508671715 2508501039 Bacteria 9978592
297 2528202872 2527291627 Bacteria 5309833
298 2528213250 2527291629 Bacteria 5267418
299 2546947613 2546825537 Bacteria 5389291
300 2579748399 2576861822 Bacteria 5004595
301 2579857871 2579778521 Bacteria 7624758
302 2619858525 2619618881 Bacteria 7521104
303 2620353760 2619619003 Bacteria 7619552
304 2626634473 2626541554 Bacteria 7741902
305 2671839547 2671180195 Bacteria 9757215
306 2676204725 2675902999 Bacteria 9438463
307 2686534375 2684623035 Bacteria 8032739
308 2686541115 2684623036 Bacteria 5199090
309 2689964278 2687453737 Bacteria 11203906
310 2689990502 2687453743 Bacteria 8361025
311 2710604300 2710264753 Bacteria 5455564
312 2774849300 2773857921 Bacteria 9435764
313 2774857703 2773857922 Bacteria 9757215
314 2774864282 2773857924 Bacteria 5256821
315 2774904611 2773857933 Bacteria 5818019
316 2895883763 2895880812 Bacteria 11255272
317 637877585 637000116 Bacteria 5433628
318 8002779140 8002775197 Bacteria 10728764
319 8054915559 8054913762 Bacteria 7713009
320 8054922132 8054920844 Bacteria 7068637
321 8055162194 8055157932 Bacteria 6429399
322 Ga0065712_10000220
323 Ga0065715_10135648
324 Ga0065707_10120214
325 Ga0070658_10016746
326 Ga0070683_100043302
327 Ga0070683_100221062
328 Ga0070690_100024734
329 Ga0070680_100001994
330 Ga0068868_100046567
331 Ga0070689_100231211
332 Ga0070668_100141007
333 Ga0070668_100419919
334 Ga0070675_100061172
335 Ga0070673_100005724
336 Ga0070714_100006261
337 Ga0070711_100280040
338 Ga0070705_100107166
339 Ga0070708_100066804
340 Ga0070662_100375859
341 Ga0070681_10009697
342 Ga0070706_100012195
343 Ga0070706_100262461
344 Ga0070707_100161379
345 Ga0070698_100000705
346 Ga0070699_100001806
347 Ga0070679_100079660
348 Ga0070679_100171691
349 Ga0070684_100030459
350 Ga0070684_100143851
351 Ga0070697_100012117
352 Ga0070697_100018585
353 Ga0070697_100041805
354 Ga0068853_100061781
355 Ga0070672_100011116
356 Ga0070672_100035983
357 Ga0070665_100023327
358 Ga0068855_100016303
359 Ga0068855_100129992
360 Ga0070664_100042580
361 Ga0070664_100225134
362 Ga0068857_100004590
363 Ga0068857_100240536
364 Ga0068854_100004988
365 Ga0068856_100048948
366 Ga0068856_100158373
367 Ga0068859_100018467
368 Ga0068859_100037109
369 Ga0068859_100074562
370 Ga0068859_100356687
371 Ga0068863_100003844
372 Ga0068863_100133178
373 Ga0068858_100033341
374 Ga0068858_100082365
375 Ga0068858_100165865
376 Ga0068860_100383352
377 Ga0068862_100134883
378 Ga0081455_10054806
379 Ga0081539_10003277
380 Ga0081539_10068254
381 Ga0070717_10178933
382 Ga0075367_10015614
383 Ga0068871_100098785
384 Ga0068871_100271070
385 Ga0075430_100122849
386 Ga0075430_100148142
387 Ga0075433_10026109
388 Ga0075429_100027051
389 Ga0075429_100086705
390 Ga0075436_100009776
391 Ga0097620_100018467
392 Ga0097620_100037109
393 Ga0097620_100074565
394 Ga0097620_100356692
395 Ga0099794_10044249
396 Ga0105240_10022179
397 Ga0105240_10447017
398 Ga0111539_10005373
399 Ga0111539_10047484
400 Ga0105245_10002124
401 Ga0105245_10010350
402 Ga0105245_10301881
403 Ga0105247_10000156
404 Ga0105247_10000255
405 Ga0114129_10001014
406 Ga0114129_10001587
407 Ga0114129_10294914
408 Ga0105243_10209365
409 Ga0105241_10003560
410 Ga0105241_10248205
411 Ga0105242_10062238
412 Ga0105242_10062675
413 Ga0105242_10102441
414 Ga0105248_10001256
415 Ga0105248_10001503
416 Ga0105248_10122054
417 Ga0105248_10177518
418 Ga0105237_10162012
419 Ga0105238_10000241
420 Ga0105238_10006425
421 Ga0105238_10053937
422 Ga0105238_10147141
423 Ga0105239_10012480
424 Ga0105239_10076400
425 Ga0157374_10026033
426 Ga0157378_10025654
427 Ga0163162_10008426
428 Ga0157375_10141923
429 Ga0157375_10196346
430 Ga0163163_10039237
431 Ga0157377_10054447
432 Ga0157376_10272435
433 Ga0206353_11085181
434 Ga0213875_10056528
435 Ga0207710_10000130
436 Ga0207710_10000170
437 Ga0207647_10005406
438 Ga0207645_10167096
439 Ga0207684_10009285
440 Ga0207654_10005946
441 Ga0207707_10027207
442 Ga0207695_10003308
443 Ga0207671_10000910
444 Ga0207671_10098694
445 Ga0207663_10223491
446 Ga0207660_10001898
447 Ga0207652_10254241
448 Ga0207694_10000405
449 Ga0207694_10022664
450 Ga0207694_10140538
451 Ga0207659_10146443
452 Ga0207687_10007092
453 Ga0207664_10073660
454 Ga0207706_10407379
455 Ga0207686_10036683
456 Ga0207670_10026781
457 Ga0207711_10000066
458 Ga0207711_10010607
459 Ga0207711_10094683
460 Ga0207711_10229752
461 Ga0207661_10309852
462 Ga0207667_10107544
463 Ga0207640_10137976
464 Ga0207658_10275586
465 Ga0207658_10306595
466 Ga0207703_10010661
467 Ga0207703_10105224
468 Ga0207703_10138021
469 Ga0207639_10060659
470 Ga0207702_10014643
471 Ga0207641_10000646
472 Ga0207641_10117648
473 Ga0207674_10014553
474 Ga0207675_100295920
475 Ga0207698_10061855
476 Ga0207698_10151210
477 Ga0207428_10053084
478 Ga0268266_10056924
479 Ga0265336_10011631
480 Ga0265320_10029146
481 Ga0265339_10006539
482 Ga0265342_10000349
483 Ga0307406_10113227
484 Ga0307507_10000013
485 Ga0373929_0000001
486 Ga0373934_0030345
487 Ga0373954_0064667
488 Ga0373955_0001154
489 Ga0373955_0079368
490 Ga0373935_0105898
491 Ga0373933_0137453
492 Ga0373937_0029588
493 Ga0373937_0079787
494 Ga0436364_0683334
495 Ga0439435_0009915
496 Ga0451577_0000001
497 Ga0451577_0000041
498 Ga0451577_0170900
499 Ga0466969_0003913
500 Ga0466972_0053903
501 Ga0453683_0000056
502 Ga0453683_0000591
503 Ga0453683_0145607
504 Ga0466966_0003546
505 Ga0466961_0006216
506 Ga0466963_0015525
507 Ga0466963_0018960
508 Ga0453684_0000066
509 Ga0453684_0198904
510 Ga0466971_0000616
511 Ga0466971_0006775
512 Ga0466971_0042430
513 Ga0466971_0137433
514 Ga0466968_0080598
515 Ga0466959_0000507
516 Ga0466959_0080157
517 Ga0451576_0000207
518 Ga0451576_0045594
519 Ga0451576_0204584
520 Ga0466967_0085963
521 Ga0495603_0109485
522 Ga0495651_0000079
523 Ga0495651_0001189
524 Ga0495651_0058319
525 Ga0495651_0189372
526 Ga0495664_0194581
527 Ga0495608_0149241
528 Ga0495618_0032918
529 Ga0495628_0004113
530 Ga0495628_0181569
531 Ga0495648_0102229
532 Ga0495652_0000639
533 Ga0495652_0001359
534 Ga0495587_0034837
535 Ga0495645_0091885
536 Ga0495645_0112675
537 Ga0495667_0002129
538 Ga0495599_0078751
539 Ga0495623_0019461
540 Ga0495646_0025559
541 Ga0495600_0023862
542 Ga0495600_0029629
543 Ga0495604_0014949
544 Ga0495604_0099727
545 Ga0496109_0120789
546 Ga0496119_0002250
547 Ga0496119_0002436
548 Ga0496120_0000779
549 Ga0496120_0000912
550 Ga0501036_0052079
551 Ga0501036_0083134
552 Ga0501036_0333438
553 Ga0501037_0080183
554 Ga0501039_0005739
555 Ga0501040_0009949
556 Ga0501040_0181530
557 Ga0501041_0007304
558 Ga0501041_0014217
559 Ga0501042_0005067
560 Ga0501043_0239022
561 Ga0501046_0006629
562 Ga0501048_0012946
563 Ga0501048_0286069
564 Ga0501068_0000934
565 Ga0501070_0075817
566 Ga0501071_0187834
567 Ga0501072_0005964
568 Ga0501072_0050461
569 Ga0501073_0025897
570 Ga0501074_0009031
571 Ga0501075_0001905
572 Ga0501075_0018133
573 Ga0501076_0008760
574 Ga0501077_0080294
575 Ga0501235_017773
576 Ga0501080_0006381
577 Ga0501080_0453318
578 Ga0501081_0000945
579 Ga0501081_0040314
580 Ga0501081_0135878
581 Ga0501083_0009766
582 Ga0501035_0483983
583 Ga0501044_0032065
584 Ga0501045_0001624
585 Ga0501045_0024302
586 nmdc:mga05p37_34_c1
587 nmdc:mga05p37_5746_c1
588 nmdc:mga09592_23333_c1
589 nmdc:mga09592_46192_c1
590 nmdc:mga0qj67_179916_c1
591 nmdc:mga0qj67_272891_c1
592 nmdc:mga0qj67_54497_c1
593 nmdc:mga08y16_3280_c1
594 nmdc:mga0n895_137543_c1
595 nmdc:mga0rr50_296459_c1
596 nmdc:mga08x19_10816_c1
597 Ga0495612_0002569
598 Ga0495612_0017183
599 Ga0495619_0049824
600 Ga0500608_129197
601 Ga0500573_0019003
602 Ga0501084_0025609
603 Ga0501084_0136013
604 Ga0590071_028771
605 Ga0590077_002554
606 Ga0590077_002973
607 Ga0501082_0003287
608 Ga0501082_0045076
609 Ga0501082_0103628
610 Ga0466962_0000100
611 Ga0466962_0002993
612 Ga0466962_0051744
613 Ga0530510_0001890
614 Ga0530510_0003162
615 2517764320
616 2506865118
617 2508671715
618 2528202872
619 2528213250
620 2546947613
621 2579748399
622 2579857871
623 2619858525
624 2620353760
625 2626634473
626 2671839547
627 2676204725
628 2686534375
629 2686541115
630 2689964278
631 2689990502
632 2710604300
633 2774849300
634 2774857703
635 2774864282
636 2774904611
637 2895883763
638 637877585
639 8002779140
640 8054915559
641 8054922132
642 8055162194

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02322

Cyt_bd_oxida_II

Cytochrome bd terminal oxidase subunit II

1

319

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
7nkz-assembly1.cif.gz_B cryo-em structure of the cytochrome bd oxidase from m. tuberculosis at 2.5 a resolution 0.8986 4 326
7nkz-assembly1.cif.gz_B cryo-em structure of the cytochrome bd oxidase from m. tuberculosis at 2.5 a resolution 0.8478 4 326
6rko-assembly1.cif.gz_B cryo-em structure of the e. coli cytochrome bd-i oxidase at 2.68 a resolution 0.8471 4 321
7ose-assembly1.cif.gz_B cytochrome bd-ii type oxidase with bound aurachin d 0.8395 4 337
8b4o-assembly1.cif.gz_B cryo-em structure of cytochrome bd oxidase from c. glutamicum 0.837 2 326
ID Description Score Start End Superfamily
af_Q4FZV2_37_153_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.7521 173 283 1.10.10.1740
af_Q4FZV2_37_153_1.10.10.1740 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like 0.6702 173 283 1.10.10.1740
af_P32709_7_307_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.66 15 273 1.20.1630.10
af_K7LU78_450_565_1.20.58.390 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain 0.6226 128 221 1.20.58.390
af_P76173_1_274_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.6103 14 278 1.20.1630.10
ID Description Score Start End GO Terms
AF-A0A2V7RXB8-F1-model_v4 Cytochrome BD ubiquinol oxidase subunit II 0.9755 7 265 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0070069
AF-A0A2V6R7M0-F1-model_v4 Cytochrome BD ubiquinol oxidase subunit II 0.9745 1 328 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0070069
AF-A0A7W1UDR8-F1-model_v4 Cytochrome d ubiquinol oxidase subunit II 0.9729 1 326 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0070069
AF-A0A838SCA8-F1-model_v4 Cytochrome d ubiquinol oxidase subunit II 0.9722 1 327 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0070069
AF-A0A5N7YX57-F1-model_v4 deleted 0.9691 5 136

Map