F406691
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 322 | 219 | 642 | 331 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2517572101|2517764320 |
| Length | 392 |
| Sequence | DLLLGVMVAGLTAYALLAGADFGGGVWDLLARSHEAGDVRTLVAGALGPVWEANHVWLIFVIVAMFSGFPPAFGVVGSTLELPLALALVGIVLRGAAYVYRAYGDGGAGPDHWWGHVFAAASTITPFALGISGAALATGDLSPDDPAAPLTSPFGLVAGVFAVVATAFLAAVYLCRDAASSPAAEHLVPYFRRRALGGAVTAGALATVLLPLLWRDAPVVASRFTERALPFVALSAAGGIAALALVWRRRFTLARLAAGLAVAAVLWGWAAAQYPDLVVGHTTVTDAAAPTANIHALLLAIGGGIVALVPALLTLFRLFSHPEPPTPPPAPNHQHAAEHQQKPTHHRKRRRRPRGCGAVPELAEDTDEALTAQCVDLVEEQDQRPGAGPRPG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 2 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 27 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 30 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 32 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 33 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 34 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 35 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 36 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 37 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 38 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 39 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 40 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 41 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 43 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 44 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 45 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 46 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 47 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 48 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 50 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 70 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 71 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 102 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 104 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 105 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 106 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 107 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 108 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 109 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 110 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 111 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 112 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 113 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 114 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 115 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 116 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 117 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 118 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 119 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 120 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 121 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 122 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 123 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 124 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 125 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 126 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 127 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 128 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 129 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 130 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 131 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 148 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 149 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 150 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 151 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 152 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 153 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 154 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 155 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 156 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 157 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 158 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 159 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 160 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 161 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 162 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 163 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 164 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 165 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 166 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 167 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 168 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 169 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 170 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 171 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 173 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 174 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 175 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 176 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 177 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 178 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 179 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 180 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 181 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 182 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 185 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 186 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 187 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 188 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 189 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 191 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 192 | 2517572101 | Frankia sp. DC12 | Isolate | Nodule |
| 193 | 2506783011 | Frankia datiscae Dg1 | Isolate | Nodule |
| 194 | 2508501039 | Frankia saprophytica CN3 | Isolate | Nodule |
| 195 | 2527291627 | Frankia casuarinae Thr | Isolate | Nodule |
| 196 | 2527291629 | Frankia sp. BMG5.23 | Isolate | Nodule |
| 197 | 2546825537 | Frankia sp. CcI6 | Isolate | Rhizoplane |
| 198 | 2576861822 | Frankia sp. CeD | Isolate | Nodule |
| 199 | 2579778521 | Frankia torreyi CpI1-S | Isolate | Unclassified |
| 200 | 2619618881 | Frankia sp. ACN1ag | Isolate | Unclassified |
| 201 | 2619619003 | Frankia sp. CpI1-P | Isolate | Nodule |
| 202 | 2626541554 | Frankia sp. AvcI.1 | Isolate | Nodule |
| 203 | 2671180195 | Frankia sp. CcI49 | Isolate | Nodule |
| 204 | 2675902999 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 205 | 2684623035 | Frankia sp. NRRL B-16219 | Isolate | Rhizosphere |
| 206 | 2684623036 | Frankia sp. CgIM4 | Isolate | Nodule |
| 207 | 2687453737 | Frankia sp. BMG5.36 | Isolate | Nodule |
| 208 | 2687453743 | Frankia colletiae Cc1.17 | Isolate | Nodule |
| 209 | 2710264753 | Frankia sp. KB5 | Isolate | Nodule |
| 210 | 2773857921 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 211 | 2773857922 | Frankia sp. CcI49 | Isolate | Nodule |
| 212 | 2773857924 | Frankia sp. CgIS1 | Isolate | Nodule |
| 213 | 2773857933 | Frankia sp. BMG5.30 | Isolate | Nodule |
| 214 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 215 | 637000116 | Frankia casuarinae CcI3 | Isolate | Nodule |
| 216 | 8002775197 | Frankia nepalensis CN7 | Isolate | Nodule |
| 217 | 8054913762 | Frankia gtarii Agncl-10 | Isolate | Nodule |
| 218 | 8054920844 | Frankia tisae Agncl-8 | Isolate | Nodule |
| 219 | 8055157932 | Frankia umida Ag45/Mut15 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.99 |
| Metatranscriptomes | 0.31 |
| Isolates | 8.7 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.93 |
| Nodule | 7.14 |
| Rhizoplane | 0.62 |
| Rhizosphere | 88.2 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.07 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065712_10000220 | 3300005290 | Bacteria | 23138 |
| 2 | Ga0065715_10135648 | 3300005293 | Bacteria | 1935 |
| 3 | Ga0065707_10120214 | 3300005295 | Bacteria | 2140 |
| 4 | Ga0070658_10016746 | 3300005327 | Bacteria | 5868 |
| 5 | Ga0070683_100043302 | 3300005329 | Bacteria | 4149 |
| 6 | Ga0070683_100221062 | 3300005329 | Bacteria | 1800 |
| 7 | Ga0070690_100024734 | 3300005330 | Bacteria | 3694 |
| 8 | Ga0070680_100001994 | 3300005336 | Bacteria | 15028 |
| 9 | Ga0068868_100046567 | 3300005338 | Bacteria | 3395 |
| 10 | Ga0070689_100231211 | 3300005340 | Bacteria | 1520 |
| 11 | Ga0070668_100141007 | 3300005347 | Bacteria | 1942 |
| 12 | Ga0070668_100419919 | 3300005347 | Bacteria | 1145 |
| 13 | Ga0070675_100061172 | 3300005354 | Bacteria | 3109 |
| 14 | Ga0070673_100005724 | 3300005364 | Bacteria | 7991 |
| 15 | Ga0070714_100006261 | 3300005435 | Bacteria | 9167 |
| 16 | Ga0070711_100280040 | 3300005439 | Bacteria | 1319 |
| 17 | Ga0070705_100107166 | 3300005440 | Unclassified | 1778 |
| 18 | Ga0070708_100066804 | 3300005445 | Bacteria | 3228 |
| 19 | Ga0070662_100375859 | 3300005457 | Unclassified | 1169 |
| 20 | Ga0070681_10009697 | 3300005458 | Bacteria | 9475 |
| 21 | Ga0070706_100012195 | 3300005467 | Bacteria | 7966 |
| 22 | Ga0070706_100262461 | 3300005467 | Bacteria | 1612 |
| 23 | Ga0070707_100161379 | 3300005468 | Bacteria | 2184 |
| 24 | Ga0070698_100000705 | 3300005471 | Bacteria | 35680 |
| 25 | Ga0070699_100001806 | 3300005518 | Bacteria | 19452 |
| 26 | Ga0070679_100079660 | 3300005530 | Bacteria | 3265 |
| 27 | Ga0070679_100171691 | 3300005530 | Bacteria | 2141 |
| 28 | Ga0070684_100030459 | 3300005535 | Bacteria | 4584 |
| 29 | Ga0070684_100143851 | 3300005535 | Bacteria | 2158 |
| 30 | Ga0070697_100012117 | 3300005536 | Bacteria | 6751 |
| 31 | Ga0070697_100018585 | 3300005536 | Bacteria | 5481 |
| 32 | Ga0070697_100041805 | 3300005536 | Bacteria | 3711 |
| 33 | Ga0068853_100061781 | 3300005539 | Bacteria | 3241 |
| 34 | Ga0070672_100011116 | 3300005543 | Bacteria | 6269 |
| 35 | Ga0070672_100035983 | 3300005543 | Unclassified | 3768 |
| 36 | Ga0070665_100023327 | 3300005548 | Bacteria | 6229 |
| 37 | Ga0068855_100016303 | 3300005563 | Bacteria | 8937 |
| 38 | Ga0068855_100129992 | 3300005563 | Bacteria | 2876 |
| 39 | Ga0070664_100042580 | 3300005564 | Bacteria | 3833 |
| 40 | Ga0070664_100225134 | 3300005564 | Bacteria | 1679 |
| 41 | Ga0068857_100004590 | 3300005577 | Bacteria | 11694 |
| 42 | Ga0068857_100240536 | 3300005577 | Bacteria | 1657 |
| 43 | Ga0068854_100004988 | 3300005578 | Bacteria | 8372 |
| 44 | Ga0068856_100048948 | 3300005614 | Bacteria | 4166 |
| 45 | Ga0068856_100158373 | 3300005614 | Bacteria | 2274 |
| 46 | Ga0068859_100018467 | 3300005617 | Bacteria | 7009 |
| 47 | Ga0068859_100037109 | 3300005617 | Bacteria | 4891 |
| 48 | Ga0068859_100074562 | 3300005617 | Bacteria | 3432 |
| 49 | Ga0068859_100356687 | 3300005617 | Bacteria | 1557 |
| 50 | Ga0068863_100003844 | 3300005841 | Bacteria | 14853 |
| 51 | Ga0068863_100133178 | 3300005841 | Bacteria | 2374 |
| 52 | Ga0068858_100033341 | 3300005842 | Bacteria | 4780 |
| 53 | Ga0068858_100082365 | 3300005842 | Bacteria | 2991 |
| 54 | Ga0068858_100165865 | 3300005842 | Bacteria | 2081 |
| 55 | Ga0068860_100383352 | 3300005843 | Bacteria | 1388 |
| 56 | Ga0068862_100134883 | 3300005844 | Unclassified | 2187 |
| 57 | Ga0081455_10054806 | 3300005937 | Bacteria | 3396 |
| 58 | Ga0081539_10003277 | 3300005985 | Bacteria | 20309 |
| 59 | Ga0081539_10068254 | 3300005985 | Bacteria | 1919 |
| 60 | Ga0070717_10178933 | 3300006028 | Bacteria | 1847 |
| 61 | Ga0075367_10015614 | 3300006178 | Bacteria | 4133 |
| 62 | Ga0068871_100098785 | 3300006358 | Bacteria | 2442 |
| 63 | Ga0068871_100271070 | 3300006358 | Unclassified | 1483 |
| 64 | Ga0075430_100122849 | 3300006846 | Bacteria | 2165 |
| 65 | Ga0075430_100148142 | 3300006846 | Bacteria | 1954 |
| 66 | Ga0075433_10026109 | 3300006852 | Bacteria | 4942 |
| 67 | Ga0075429_100027051 | 3300006880 | Bacteria | 4981 |
| 68 | Ga0075429_100086705 | 3300006880 | Bacteria | 2729 |
| 69 | Ga0075436_100009776 | 3300006914 | Bacteria | 6561 |
| 70 | Ga0097620_100018467 | 3300006931 | Bacteria | 7009 |
| 71 | Ga0097620_100037109 | 3300006931 | Bacteria | 4891 |
| 72 | Ga0097620_100074565 | 3300006931 | Bacteria | 3432 |
| 73 | Ga0097620_100356692 | 3300006931 | Bacteria | 1557 |
| 74 | Ga0099794_10044249 | 3300007265 | Bacteria | 2127 |
| 75 | Ga0105240_10022179 | 3300009093 | Bacteria | 8423 |
| 76 | Ga0105240_10447017 | 3300009093 | Bacteria | 1447 |
| 77 | Ga0111539_10005373 | 3300009094 | Bacteria | 16565 |
| 78 | Ga0111539_10047484 | 3300009094 | Bacteria | 5130 |
| 79 | Ga0105245_10002124 | 3300009098 | Bacteria | 17956 |
| 80 | Ga0105245_10010350 | 3300009098 | Bacteria | 8124 |
| 81 | Ga0105245_10301881 | 3300009098 | Bacteria | 1571 |
| 82 | Ga0105247_10000156 | 3300009101 | Bacteria | 67016 |
| 83 | Ga0105247_10000255 | 3300009101 | Bacteria | 49266 |
| 84 | Ga0114129_10001014 | 3300009147 | Bacteria | 36622 |
| 85 | Ga0114129_10001587 | 3300009147 | Bacteria | 30857 |
| 86 | Ga0114129_10294914 | 3300009147 | Bacteria | 2163 |
| 87 | Ga0105243_10209365 | 3300009148 | Bacteria | 1716 |
| 88 | Ga0105241_10003560 | 3300009174 | Bacteria | 11584 |
| 89 | Ga0105241_10248205 | 3300009174 | Bacteria | 1508 |
| 90 | Ga0105242_10062238 | 3300009176 | Unclassified | 3071 |
| 91 | Ga0105242_10062675 | 3300009176 | Bacteria | 3060 |
| 92 | Ga0105242_10102441 | 3300009176 | Unclassified | 2428 |
| 93 | Ga0105248_10001256 | 3300009177 | Bacteria | 28350 |
| 94 | Ga0105248_10001503 | 3300009177 | Bacteria | 25938 |
| 95 | Ga0105248_10122054 | 3300009177 | Bacteria | 2939 |
| 96 | Ga0105248_10177518 | 3300009177 | Bacteria | 2400 |
| 97 | Ga0105237_10162012 | 3300009545 | Bacteria | 2235 |
| 98 | Ga0105238_10000241 | 3300009551 | Bacteria | 61118 |
| 99 | Ga0105238_10006425 | 3300009551 | Bacteria | 11692 |
| 100 | Ga0105238_10053937 | 3300009551 | Bacteria | 4039 |
| 101 | Ga0105238_10147141 | 3300009551 | Bacteria | 2332 |
| 102 | Ga0105239_10012480 | 3300010375 | Bacteria | 9462 |
| 103 | Ga0105239_10076400 | 3300010375 | Unclassified | 3684 |
| 104 | Ga0157374_10026033 | 3300013296 | Bacteria | 5259 |
| 105 | Ga0157378_10025654 | 3300013297 | Bacteria | 5189 |
| 106 | Ga0163162_10008426 | 3300013306 | Bacteria | 10053 |
| 107 | Ga0157375_10141923 | 3300013308 | Unclassified | 2529 |
| 108 | Ga0157375_10196346 | 3300013308 | Unclassified | 2173 |
| 109 | Ga0163163_10039237 | 3300014325 | Bacteria | 4621 |
| 110 | Ga0157377_10054447 | 3300014745 | Bacteria | 2265 |
| 111 | Ga0157376_10272435 | 3300014969 | Bacteria | 1591 |
| 112 | Ga0206353_11085181 | 3300020082 | Bacteria | 3198 |
| 113 | Ga0213875_10056528 | 3300021388 | Bacteria | 1838 |
| 114 | Ga0207710_10000130 | 3300025900 | Bacteria | 90509 |
| 115 | Ga0207710_10000170 | 3300025900 | Bacteria | 67024 |
| 116 | Ga0207647_10005406 | 3300025904 | Bacteria | 9376 |
| 117 | Ga0207645_10167096 | 3300025907 | Bacteria | 1441 |
| 118 | Ga0207684_10009285 | 3300025910 | Bacteria | 8687 |
| 119 | Ga0207654_10005946 | 3300025911 | Bacteria | 6142 |
| 120 | Ga0207707_10027207 | 3300025912 | Bacteria | 5001 |
| 121 | Ga0207695_10003308 | 3300025913 | Bacteria | 22844 |
| 122 | Ga0207671_10000910 | 3300025914 | Bacteria | 37314 |
| 123 | Ga0207671_10098694 | 3300025914 | Bacteria | 2209 |
| 124 | Ga0207663_10223491 | 3300025916 | Bacteria | 1371 |
| 125 | Ga0207660_10001898 | 3300025917 | Bacteria | 13917 |
| 126 | Ga0207652_10254241 | 3300025921 | Unclassified | 1585 |
| 127 | Ga0207694_10000405 | 3300025924 | Bacteria | 40220 |
| 128 | Ga0207694_10022664 | 3300025924 | Bacteria | 4764 |
| 129 | Ga0207694_10140538 | 3300025924 | Bacteria | 1941 |
| 130 | Ga0207659_10146443 | 3300025926 | Bacteria | 1839 |
| 131 | Ga0207687_10007092 | 3300025927 | Bacteria | 7386 |
| 132 | Ga0207664_10073660 | 3300025929 | Bacteria | 2756 |
| 133 | Ga0207706_10407379 | 3300025933 | Unclassified | 1179 |
| 134 | Ga0207686_10036683 | 3300025934 | Bacteria | 2953 |
| 135 | Ga0207670_10026781 | 3300025936 | Bacteria | 3638 |
| 136 | Ga0207711_10000066 | 3300025941 | Bacteria | 119066 |
| 137 | Ga0207711_10010607 | 3300025941 | Bacteria | 7662 |
| 138 | Ga0207711_10094683 | 3300025941 | Bacteria | 2632 |
| 139 | Ga0207711_10229752 | 3300025941 | Unclassified | 1699 |
| 140 | Ga0207661_10309852 | 3300025944 | Bacteria | 1417 |
| 141 | Ga0207667_10107544 | 3300025949 | Bacteria | 2878 |
| 142 | Ga0207640_10137976 | 3300025981 | Bacteria | 1773 |
| 143 | Ga0207658_10275586 | 3300025986 | Unclassified | 1440 |
| 144 | Ga0207658_10306595 | 3300025986 | Unclassified | 1370 |
| 145 | Ga0207703_10010661 | 3300026035 | Bacteria | 7178 |
| 146 | Ga0207703_10105224 | 3300026035 | Bacteria | 2398 |
| 147 | Ga0207703_10138021 | 3300026035 | Bacteria | 2113 |
| 148 | Ga0207639_10060659 | 3300026041 | Bacteria | 2918 |
| 149 | Ga0207702_10014643 | 3300026078 | Bacteria | 6509 |
| 150 | Ga0207641_10000646 | 3300026088 | Bacteria | 37941 |
| 151 | Ga0207641_10117648 | 3300026088 | Unclassified | 2367 |
| 152 | Ga0207674_10014553 | 3300026116 | Bacteria | 8683 |
| 153 | Ga0207675_100295920 | 3300026118 | Unclassified | 1575 |
| 154 | Ga0207698_10061855 | 3300026142 | Bacteria | 2920 |
| 155 | Ga0207698_10151210 | 3300026142 | Unclassified | 2015 |
| 156 | Ga0207428_10053084 | 3300027907 | Bacteria | 3233 |
| 157 | Ga0268266_10056924 | 3300028379 | Bacteria | 3363 |
| 158 | Ga0265336_10011631 | 3300028666 | Bacteria | 2985 |
| 159 | Ga0265320_10029146 | 3300031240 | Bacteria | 2858 |
| 160 | Ga0265339_10006539 | 3300031249 | Bacteria | 7637 |
| 161 | Ga0265342_10000349 | 3300031712 | Bacteria | 51668 |
| 162 | Ga0307406_10113227 | 3300031901 | Bacteria | 1872 |
| 163 | Ga0307507_10000013 | 3300033179 | Bacteria | 242708 |
| 164 | Ga0373929_0000001 | 3300035085 | Bacteria | 956023 |
| 165 | Ga0373934_0030345 | 3300035086 | Bacteria | 2114 |
| 166 | Ga0373954_0064667 | 3300035118 | Bacteria | 1730 |
| 167 | Ga0373955_0001154 | 3300035172 | Bacteria | 11204 |
| 168 | Ga0373955_0079368 | 3300035172 | Bacteria | 1851 |
| 169 | Ga0373935_0105898 | 3300035692 | Bacteria | 1860 |
| 170 | Ga0373933_0137453 | 3300035724 | Bacteria | 1540 |
| 171 | Ga0373937_0029588 | 3300036401 | Bacteria | 4961 |
| 172 | Ga0373937_0079787 | 3300036401 | Bacteria | 3025 |
| 173 | Ga0436364_0683334 | 3300037853 | Bacteria | 2222 |
| 174 | Ga0439435_0009915 | 3300042436 | Bacteria | 2247 |
| 175 | Ga0451577_0000001 | 3300042876 | Bacteria | 2461803 |
| 176 | Ga0451577_0000041 | 3300042876 | Bacteria | 335318 |
| 177 | Ga0451577_0170900 | 3300042876 | Bacteria | 1958 |
| 178 | Ga0466969_0003913 | 3300044656 | Bacteria | 7908 |
| 179 | Ga0466972_0053903 | 3300044658 | Bacteria | 1936 |
| 180 | Ga0453683_0000056 | 3300044673 | Bacteria | 192299 |
| 181 | Ga0453683_0000591 | 3300044673 | Bacteria | 40145 |
| 182 | Ga0453683_0145607 | 3300044673 | Unclassified | 1496 |
| 183 | Ga0466966_0003546 | 3300044684 | Bacteria | 10302 |
| 184 | Ga0466961_0006216 | 3300044693 | Bacteria | 7585 |
| 185 | Ga0466963_0015525 | 3300044694 | Bacteria | 4719 |
| 186 | Ga0466963_0018960 | 3300044694 | Bacteria | 4308 |
| 187 | Ga0453684_0000066 | 3300044712 | Bacteria | 465545 |
| 188 | Ga0453684_0198904 | 3300044712 | Bacteria | 2337 |
| 189 | Ga0466971_0000616 | 3300044719 | Bacteria | 14158 |
| 190 | Ga0466971_0006775 | 3300044719 | Bacteria | 4985 |
| 191 | Ga0466971_0042430 | 3300044719 | Bacteria | 2044 |
| 192 | Ga0466971_0137433 | 3300044719 | Bacteria | 1137 |
| 193 | Ga0466968_0080598 | 3300044735 | Bacteria | 1429 |
| 194 | Ga0466959_0000507 | 3300045049 | Bacteria | 22618 |
| 195 | Ga0466959_0080157 | 3300045049 | Bacteria | 2354 |
| 196 | Ga0451576_0000207 | 3300045051 | Bacteria | 147627 |
| 197 | Ga0451576_0045594 | 3300045051 | Bacteria | 4616 |
| 198 | Ga0451576_0204584 | 3300045051 | Bacteria | 2061 |
| 199 | Ga0466967_0085963 | 3300045976 | Bacteria | 2849 |
| 200 | Ga0495603_0109485 | 3300046455 | Bacteria | 1612 |
| 201 | Ga0495651_0000079 | 3300046462 | Bacteria | 71581 |
| 202 | Ga0495651_0001189 | 3300046462 | Bacteria | 20109 |
| 203 | Ga0495651_0058319 | 3300046462 | Bacteria | 2962 |
| 204 | Ga0495651_0189372 | 3300046462 | Bacteria | 1449 |
| 205 | Ga0495664_0194581 | 3300046477 | Bacteria | 1229 |
| 206 | Ga0495608_0149241 | 3300046511 | Bacteria | 1490 |
| 207 | Ga0495618_0032918 | 3300046514 | Bacteria | 3249 |
| 208 | Ga0495628_0004113 | 3300046516 | Bacteria | 12945 |
| 209 | Ga0495628_0181569 | 3300046516 | Bacteria | 1591 |
| 210 | Ga0495648_0102229 | 3300046524 | Bacteria | 1579 |
| 211 | Ga0495652_0000639 | 3300046529 | Bacteria | 40668 |
| 212 | Ga0495652_0001359 | 3300046529 | Bacteria | 27221 |
| 213 | Ga0495587_0034837 | 3300046536 | Bacteria | 3035 |
| 214 | Ga0495645_0091885 | 3300046543 | Bacteria | 2167 |
| 215 | Ga0495645_0112675 | 3300046543 | Bacteria | 1923 |
| 216 | Ga0495667_0002129 | 3300046559 | Bacteria | 13185 |
| 217 | Ga0495599_0078751 | 3300046678 | Bacteria | 2058 |
| 218 | Ga0495623_0019461 | 3300046679 | Bacteria | 4387 |
| 219 | Ga0495646_0025559 | 3300046680 | Bacteria | 3714 |
| 220 | Ga0495600_0023862 | 3300046809 | Bacteria | 3935 |
| 221 | Ga0495600_0029629 | 3300046809 | Bacteria | 3544 |
| 222 | Ga0495604_0014949 | 3300047317 | Bacteria | 6191 |
| 223 | Ga0495604_0099727 | 3300047317 | Bacteria | 2137 |
| 224 | Ga0496109_0120789 | 3300048912 | Bacteria | 2441 |
| 225 | Ga0496119_0002250 | 3300048922 | Bacteria | 21471 |
| 226 | Ga0496119_0002436 | 3300048922 | Bacteria | 20424 |
| 227 | Ga0496120_0000779 | 3300048923 | Bacteria | 46103 |
| 228 | Ga0496120_0000912 | 3300048923 | Bacteria | 41157 |
| 229 | Ga0501036_0052079 | 3300049572 | Bacteria | 3467 |
| 230 | Ga0501036_0083134 | 3300049572 | Bacteria | 2706 |
| 231 | Ga0501036_0333438 | 3300049572 | Bacteria | 1267 |
| 232 | Ga0501037_0080183 | 3300049573 | Bacteria | 2369 |
| 233 | Ga0501039_0005739 | 3300049575 | Bacteria | 9400 |
| 234 | Ga0501040_0009949 | 3300049576 | Bacteria | 6210 |
| 235 | Ga0501040_0181530 | 3300049576 | Bacteria | 1492 |
| 236 | Ga0501041_0007304 | 3300049577 | Bacteria | 6484 |
| 237 | Ga0501041_0014217 | 3300049577 | Unclassified | 4725 |
| 238 | Ga0501042_0005067 | 3300049578 | Bacteria | 8454 |
| 239 | Ga0501043_0239022 | 3300049579 | Bacteria | 1401 |
| 240 | Ga0501046_0006629 | 3300049580 | Bacteria | 10224 |
| 241 | Ga0501048_0012946 | 3300049582 | Bacteria | 6198 |
| 242 | Ga0501048_0286069 | 3300049582 | Unclassified | 1172 |
| 243 | Ga0501068_0000934 | 3300049584 | Bacteria | 15302 |
| 244 | Ga0501070_0075817 | 3300049586 | Bacteria | 2784 |
| 245 | Ga0501071_0187834 | 3300049587 | Bacteria | 1549 |
| 246 | Ga0501072_0005964 | 3300049588 | Bacteria | 9287 |
| 247 | Ga0501072_0050461 | 3300049588 | Unclassified | 3276 |
| 248 | Ga0501073_0025897 | 3300049589 | Bacteria | 4202 |
| 249 | Ga0501074_0009031 | 3300049590 | Bacteria | 7238 |
| 250 | Ga0501075_0001905 | 3300049591 | Bacteria | 13762 |
| 251 | Ga0501075_0018133 | 3300049591 | Bacteria | 5090 |
| 252 | Ga0501076_0008760 | 3300049592 | Bacteria | 7433 |
| 253 | Ga0501077_0080294 | 3300049593 | Unclassified | 2066 |
| 254 | Ga0501235_017773 | 3300049669 | Unclassified | 1574 |
| 255 | Ga0501080_0006381 | 3300049742 | Bacteria | 10581 |
| 256 | Ga0501080_0453318 | 3300049742 | Bacteria | 1150 |
| 257 | Ga0501081_0000945 | 3300049743 | Bacteria | 17260 |
| 258 | Ga0501081_0040314 | 3300049743 | Bacteria | 3198 |
| 259 | Ga0501081_0135878 | 3300049743 | Bacteria | 1760 |
| 260 | Ga0501083_0009766 | 3300049744 | Bacteria | 6776 |
| 261 | Ga0501035_0483983 | 3300049822 | Bacteria | 1020 |
| 262 | Ga0501044_0032065 | 3300049823 | Bacteria | 5524 |
| 263 | Ga0501045_0001624 | 3300049824 | Bacteria | 15074 |
| 264 | Ga0501045_0024302 | 3300049824 | Bacteria | 4350 |
| 265 | nmdc:mga05p37_34_c1 | 3300050507 | Bacteria | 111954 |
| 266 | nmdc:mga05p37_5746_c1 | 3300050507 | Bacteria | 14592 |
| 267 | nmdc:mga09592_23333_c1 | 3300050508 | Bacteria | 5110 |
| 268 | nmdc:mga09592_46192_c1 | 3300050508 | Bacteria | 3668 |
| 269 | nmdc:mga0qj67_179916_c1 | 3300050509 | Bacteria | 1717 |
| 270 | nmdc:mga0qj67_272891_c1 | 3300050509 | Bacteria | 1371 |
| 271 | nmdc:mga0qj67_54497_c1 | 3300050509 | Unclassified | 3167 |
| 272 | nmdc:mga08y16_3280_c1 | 3300050511 | Bacteria | 16769 |
| 273 | nmdc:mga0n895_137543_c1 | 3300050512 | Bacteria | 2470 |
| 274 | nmdc:mga0rr50_296459_c1 | 3300050513 | Bacteria | 1352 |
| 275 | nmdc:mga08x19_10816_c1 | 3300050514 | Bacteria | 5488 |
| 276 | Ga0495612_0002569 | 3300053078 | Bacteria | 7485 |
| 277 | Ga0495612_0017183 | 3300053078 | Bacteria | 2898 |
| 278 | Ga0495619_0049824 | 3300053085 | Bacteria | 2763 |
| 279 | Ga0500608_129197 | 3300053122 | Bacteria | 1135 |
| 280 | Ga0500573_0019003 | 3300053140 | Bacteria | 3929 |
| 281 | Ga0501084_0025609 | 3300054114 | Unclassified | 4920 |
| 282 | Ga0501084_0136013 | 3300054114 | Bacteria | 2069 |
| 283 | Ga0590071_028771 | 3300059421 | Bacteria | 1320 |
| 284 | Ga0590077_002554 | 3300059426 | Bacteria | 3860 |
| 285 | Ga0590077_002973 | 3300059426 | Bacteria | 3552 |
| 286 | Ga0501082_0003287 | 3300060353 | Bacteria | 14109 |
| 287 | Ga0501082_0045076 | 3300060353 | Bacteria | 3803 |
| 288 | Ga0501082_0103628 | 3300060353 | Bacteria | 2461 |
| 289 | Ga0466962_0000100 | 3300061719 | Bacteria | 34830 |
| 290 | Ga0466962_0002993 | 3300061719 | Bacteria | 8060 |
| 291 | Ga0466962_0051744 | 3300061719 | Bacteria | 1964 |
| 292 | Ga0530510_0001890 | 3300061734 | Bacteria | 14306 |
| 293 | Ga0530510_0003162 | 3300061734 | Bacteria | 11310 |
| 294 | 2517764320 | 2517572101 | Bacteria | 6884336 |
| 295 | 2506865118 | 2506783011 | Bacteria | 5323186 |
| 296 | 2508671715 | 2508501039 | Bacteria | 9978592 |
| 297 | 2528202872 | 2527291627 | Bacteria | 5309833 |
| 298 | 2528213250 | 2527291629 | Bacteria | 5267418 |
| 299 | 2546947613 | 2546825537 | Bacteria | 5389291 |
| 300 | 2579748399 | 2576861822 | Bacteria | 5004595 |
| 301 | 2579857871 | 2579778521 | Bacteria | 7624758 |
| 302 | 2619858525 | 2619618881 | Bacteria | 7521104 |
| 303 | 2620353760 | 2619619003 | Bacteria | 7619552 |
| 304 | 2626634473 | 2626541554 | Bacteria | 7741902 |
| 305 | 2671839547 | 2671180195 | Bacteria | 9757215 |
| 306 | 2676204725 | 2675902999 | Bacteria | 9438463 |
| 307 | 2686534375 | 2684623035 | Bacteria | 8032739 |
| 308 | 2686541115 | 2684623036 | Bacteria | 5199090 |
| 309 | 2689964278 | 2687453737 | Bacteria | 11203906 |
| 310 | 2689990502 | 2687453743 | Bacteria | 8361025 |
| 311 | 2710604300 | 2710264753 | Bacteria | 5455564 |
| 312 | 2774849300 | 2773857921 | Bacteria | 9435764 |
| 313 | 2774857703 | 2773857922 | Bacteria | 9757215 |
| 314 | 2774864282 | 2773857924 | Bacteria | 5256821 |
| 315 | 2774904611 | 2773857933 | Bacteria | 5818019 |
| 316 | 2895883763 | 2895880812 | Bacteria | 11255272 |
| 317 | 637877585 | 637000116 | Bacteria | 5433628 |
| 318 | 8002779140 | 8002775197 | Bacteria | 10728764 |
| 319 | 8054915559 | 8054913762 | Bacteria | 7713009 |
| 320 | 8054922132 | 8054920844 | Bacteria | 7068637 |
| 321 | 8055162194 | 8055157932 | Bacteria | 6429399 |
| 322 | Ga0065712_10000220 | |||
| 323 | Ga0065715_10135648 | |||
| 324 | Ga0065707_10120214 | |||
| 325 | Ga0070658_10016746 | |||
| 326 | Ga0070683_100043302 | |||
| 327 | Ga0070683_100221062 | |||
| 328 | Ga0070690_100024734 | |||
| 329 | Ga0070680_100001994 | |||
| 330 | Ga0068868_100046567 | |||
| 331 | Ga0070689_100231211 | |||
| 332 | Ga0070668_100141007 | |||
| 333 | Ga0070668_100419919 | |||
| 334 | Ga0070675_100061172 | |||
| 335 | Ga0070673_100005724 | |||
| 336 | Ga0070714_100006261 | |||
| 337 | Ga0070711_100280040 | |||
| 338 | Ga0070705_100107166 | |||
| 339 | Ga0070708_100066804 | |||
| 340 | Ga0070662_100375859 | |||
| 341 | Ga0070681_10009697 | |||
| 342 | Ga0070706_100012195 | |||
| 343 | Ga0070706_100262461 | |||
| 344 | Ga0070707_100161379 | |||
| 345 | Ga0070698_100000705 | |||
| 346 | Ga0070699_100001806 | |||
| 347 | Ga0070679_100079660 | |||
| 348 | Ga0070679_100171691 | |||
| 349 | Ga0070684_100030459 | |||
| 350 | Ga0070684_100143851 | |||
| 351 | Ga0070697_100012117 | |||
| 352 | Ga0070697_100018585 | |||
| 353 | Ga0070697_100041805 | |||
| 354 | Ga0068853_100061781 | |||
| 355 | Ga0070672_100011116 | |||
| 356 | Ga0070672_100035983 | |||
| 357 | Ga0070665_100023327 | |||
| 358 | Ga0068855_100016303 | |||
| 359 | Ga0068855_100129992 | |||
| 360 | Ga0070664_100042580 | |||
| 361 | Ga0070664_100225134 | |||
| 362 | Ga0068857_100004590 | |||
| 363 | Ga0068857_100240536 | |||
| 364 | Ga0068854_100004988 | |||
| 365 | Ga0068856_100048948 | |||
| 366 | Ga0068856_100158373 | |||
| 367 | Ga0068859_100018467 | |||
| 368 | Ga0068859_100037109 | |||
| 369 | Ga0068859_100074562 | |||
| 370 | Ga0068859_100356687 | |||
| 371 | Ga0068863_100003844 | |||
| 372 | Ga0068863_100133178 | |||
| 373 | Ga0068858_100033341 | |||
| 374 | Ga0068858_100082365 | |||
| 375 | Ga0068858_100165865 | |||
| 376 | Ga0068860_100383352 | |||
| 377 | Ga0068862_100134883 | |||
| 378 | Ga0081455_10054806 | |||
| 379 | Ga0081539_10003277 | |||
| 380 | Ga0081539_10068254 | |||
| 381 | Ga0070717_10178933 | |||
| 382 | Ga0075367_10015614 | |||
| 383 | Ga0068871_100098785 | |||
| 384 | Ga0068871_100271070 | |||
| 385 | Ga0075430_100122849 | |||
| 386 | Ga0075430_100148142 | |||
| 387 | Ga0075433_10026109 | |||
| 388 | Ga0075429_100027051 | |||
| 389 | Ga0075429_100086705 | |||
| 390 | Ga0075436_100009776 | |||
| 391 | Ga0097620_100018467 | |||
| 392 | Ga0097620_100037109 | |||
| 393 | Ga0097620_100074565 | |||
| 394 | Ga0097620_100356692 | |||
| 395 | Ga0099794_10044249 | |||
| 396 | Ga0105240_10022179 | |||
| 397 | Ga0105240_10447017 | |||
| 398 | Ga0111539_10005373 | |||
| 399 | Ga0111539_10047484 | |||
| 400 | Ga0105245_10002124 | |||
| 401 | Ga0105245_10010350 | |||
| 402 | Ga0105245_10301881 | |||
| 403 | Ga0105247_10000156 | |||
| 404 | Ga0105247_10000255 | |||
| 405 | Ga0114129_10001014 | |||
| 406 | Ga0114129_10001587 | |||
| 407 | Ga0114129_10294914 | |||
| 408 | Ga0105243_10209365 | |||
| 409 | Ga0105241_10003560 | |||
| 410 | Ga0105241_10248205 | |||
| 411 | Ga0105242_10062238 | |||
| 412 | Ga0105242_10062675 | |||
| 413 | Ga0105242_10102441 | |||
| 414 | Ga0105248_10001256 | |||
| 415 | Ga0105248_10001503 | |||
| 416 | Ga0105248_10122054 | |||
| 417 | Ga0105248_10177518 | |||
| 418 | Ga0105237_10162012 | |||
| 419 | Ga0105238_10000241 | |||
| 420 | Ga0105238_10006425 | |||
| 421 | Ga0105238_10053937 | |||
| 422 | Ga0105238_10147141 | |||
| 423 | Ga0105239_10012480 | |||
| 424 | Ga0105239_10076400 | |||
| 425 | Ga0157374_10026033 | |||
| 426 | Ga0157378_10025654 | |||
| 427 | Ga0163162_10008426 | |||
| 428 | Ga0157375_10141923 | |||
| 429 | Ga0157375_10196346 | |||
| 430 | Ga0163163_10039237 | |||
| 431 | Ga0157377_10054447 | |||
| 432 | Ga0157376_10272435 | |||
| 433 | Ga0206353_11085181 | |||
| 434 | Ga0213875_10056528 | |||
| 435 | Ga0207710_10000130 | |||
| 436 | Ga0207710_10000170 | |||
| 437 | Ga0207647_10005406 | |||
| 438 | Ga0207645_10167096 | |||
| 439 | Ga0207684_10009285 | |||
| 440 | Ga0207654_10005946 | |||
| 441 | Ga0207707_10027207 | |||
| 442 | Ga0207695_10003308 | |||
| 443 | Ga0207671_10000910 | |||
| 444 | Ga0207671_10098694 | |||
| 445 | Ga0207663_10223491 | |||
| 446 | Ga0207660_10001898 | |||
| 447 | Ga0207652_10254241 | |||
| 448 | Ga0207694_10000405 | |||
| 449 | Ga0207694_10022664 | |||
| 450 | Ga0207694_10140538 | |||
| 451 | Ga0207659_10146443 | |||
| 452 | Ga0207687_10007092 | |||
| 453 | Ga0207664_10073660 | |||
| 454 | Ga0207706_10407379 | |||
| 455 | Ga0207686_10036683 | |||
| 456 | Ga0207670_10026781 | |||
| 457 | Ga0207711_10000066 | |||
| 458 | Ga0207711_10010607 | |||
| 459 | Ga0207711_10094683 | |||
| 460 | Ga0207711_10229752 | |||
| 461 | Ga0207661_10309852 | |||
| 462 | Ga0207667_10107544 | |||
| 463 | Ga0207640_10137976 | |||
| 464 | Ga0207658_10275586 | |||
| 465 | Ga0207658_10306595 | |||
| 466 | Ga0207703_10010661 | |||
| 467 | Ga0207703_10105224 | |||
| 468 | Ga0207703_10138021 | |||
| 469 | Ga0207639_10060659 | |||
| 470 | Ga0207702_10014643 | |||
| 471 | Ga0207641_10000646 | |||
| 472 | Ga0207641_10117648 | |||
| 473 | Ga0207674_10014553 | |||
| 474 | Ga0207675_100295920 | |||
| 475 | Ga0207698_10061855 | |||
| 476 | Ga0207698_10151210 | |||
| 477 | Ga0207428_10053084 | |||
| 478 | Ga0268266_10056924 | |||
| 479 | Ga0265336_10011631 | |||
| 480 | Ga0265320_10029146 | |||
| 481 | Ga0265339_10006539 | |||
| 482 | Ga0265342_10000349 | |||
| 483 | Ga0307406_10113227 | |||
| 484 | Ga0307507_10000013 | |||
| 485 | Ga0373929_0000001 | |||
| 486 | Ga0373934_0030345 | |||
| 487 | Ga0373954_0064667 | |||
| 488 | Ga0373955_0001154 | |||
| 489 | Ga0373955_0079368 | |||
| 490 | Ga0373935_0105898 | |||
| 491 | Ga0373933_0137453 | |||
| 492 | Ga0373937_0029588 | |||
| 493 | Ga0373937_0079787 | |||
| 494 | Ga0436364_0683334 | |||
| 495 | Ga0439435_0009915 | |||
| 496 | Ga0451577_0000001 | |||
| 497 | Ga0451577_0000041 | |||
| 498 | Ga0451577_0170900 | |||
| 499 | Ga0466969_0003913 | |||
| 500 | Ga0466972_0053903 | |||
| 501 | Ga0453683_0000056 | |||
| 502 | Ga0453683_0000591 | |||
| 503 | Ga0453683_0145607 | |||
| 504 | Ga0466966_0003546 | |||
| 505 | Ga0466961_0006216 | |||
| 506 | Ga0466963_0015525 | |||
| 507 | Ga0466963_0018960 | |||
| 508 | Ga0453684_0000066 | |||
| 509 | Ga0453684_0198904 | |||
| 510 | Ga0466971_0000616 | |||
| 511 | Ga0466971_0006775 | |||
| 512 | Ga0466971_0042430 | |||
| 513 | Ga0466971_0137433 | |||
| 514 | Ga0466968_0080598 | |||
| 515 | Ga0466959_0000507 | |||
| 516 | Ga0466959_0080157 | |||
| 517 | Ga0451576_0000207 | |||
| 518 | Ga0451576_0045594 | |||
| 519 | Ga0451576_0204584 | |||
| 520 | Ga0466967_0085963 | |||
| 521 | Ga0495603_0109485 | |||
| 522 | Ga0495651_0000079 | |||
| 523 | Ga0495651_0001189 | |||
| 524 | Ga0495651_0058319 | |||
| 525 | Ga0495651_0189372 | |||
| 526 | Ga0495664_0194581 | |||
| 527 | Ga0495608_0149241 | |||
| 528 | Ga0495618_0032918 | |||
| 529 | Ga0495628_0004113 | |||
| 530 | Ga0495628_0181569 | |||
| 531 | Ga0495648_0102229 | |||
| 532 | Ga0495652_0000639 | |||
| 533 | Ga0495652_0001359 | |||
| 534 | Ga0495587_0034837 | |||
| 535 | Ga0495645_0091885 | |||
| 536 | Ga0495645_0112675 | |||
| 537 | Ga0495667_0002129 | |||
| 538 | Ga0495599_0078751 | |||
| 539 | Ga0495623_0019461 | |||
| 540 | Ga0495646_0025559 | |||
| 541 | Ga0495600_0023862 | |||
| 542 | Ga0495600_0029629 | |||
| 543 | Ga0495604_0014949 | |||
| 544 | Ga0495604_0099727 | |||
| 545 | Ga0496109_0120789 | |||
| 546 | Ga0496119_0002250 | |||
| 547 | Ga0496119_0002436 | |||
| 548 | Ga0496120_0000779 | |||
| 549 | Ga0496120_0000912 | |||
| 550 | Ga0501036_0052079 | |||
| 551 | Ga0501036_0083134 | |||
| 552 | Ga0501036_0333438 | |||
| 553 | Ga0501037_0080183 | |||
| 554 | Ga0501039_0005739 | |||
| 555 | Ga0501040_0009949 | |||
| 556 | Ga0501040_0181530 | |||
| 557 | Ga0501041_0007304 | |||
| 558 | Ga0501041_0014217 | |||
| 559 | Ga0501042_0005067 | |||
| 560 | Ga0501043_0239022 | |||
| 561 | Ga0501046_0006629 | |||
| 562 | Ga0501048_0012946 | |||
| 563 | Ga0501048_0286069 | |||
| 564 | Ga0501068_0000934 | |||
| 565 | Ga0501070_0075817 | |||
| 566 | Ga0501071_0187834 | |||
| 567 | Ga0501072_0005964 | |||
| 568 | Ga0501072_0050461 | |||
| 569 | Ga0501073_0025897 | |||
| 570 | Ga0501074_0009031 | |||
| 571 | Ga0501075_0001905 | |||
| 572 | Ga0501075_0018133 | |||
| 573 | Ga0501076_0008760 | |||
| 574 | Ga0501077_0080294 | |||
| 575 | Ga0501235_017773 | |||
| 576 | Ga0501080_0006381 | |||
| 577 | Ga0501080_0453318 | |||
| 578 | Ga0501081_0000945 | |||
| 579 | Ga0501081_0040314 | |||
| 580 | Ga0501081_0135878 | |||
| 581 | Ga0501083_0009766 | |||
| 582 | Ga0501035_0483983 | |||
| 583 | Ga0501044_0032065 | |||
| 584 | Ga0501045_0001624 | |||
| 585 | Ga0501045_0024302 | |||
| 586 | nmdc:mga05p37_34_c1 | |||
| 587 | nmdc:mga05p37_5746_c1 | |||
| 588 | nmdc:mga09592_23333_c1 | |||
| 589 | nmdc:mga09592_46192_c1 | |||
| 590 | nmdc:mga0qj67_179916_c1 | |||
| 591 | nmdc:mga0qj67_272891_c1 | |||
| 592 | nmdc:mga0qj67_54497_c1 | |||
| 593 | nmdc:mga08y16_3280_c1 | |||
| 594 | nmdc:mga0n895_137543_c1 | |||
| 595 | nmdc:mga0rr50_296459_c1 | |||
| 596 | nmdc:mga08x19_10816_c1 | |||
| 597 | Ga0495612_0002569 | |||
| 598 | Ga0495612_0017183 | |||
| 599 | Ga0495619_0049824 | |||
| 600 | Ga0500608_129197 | |||
| 601 | Ga0500573_0019003 | |||
| 602 | Ga0501084_0025609 | |||
| 603 | Ga0501084_0136013 | |||
| 604 | Ga0590071_028771 | |||
| 605 | Ga0590077_002554 | |||
| 606 | Ga0590077_002973 | |||
| 607 | Ga0501082_0003287 | |||
| 608 | Ga0501082_0045076 | |||
| 609 | Ga0501082_0103628 | |||
| 610 | Ga0466962_0000100 | |||
| 611 | Ga0466962_0002993 | |||
| 612 | Ga0466962_0051744 | |||
| 613 | Ga0530510_0001890 | |||
| 614 | Ga0530510_0003162 | |||
| 615 | 2517764320 | |||
| 616 | 2506865118 | |||
| 617 | 2508671715 | |||
| 618 | 2528202872 | |||
| 619 | 2528213250 | |||
| 620 | 2546947613 | |||
| 621 | 2579748399 | |||
| 622 | 2579857871 | |||
| 623 | 2619858525 | |||
| 624 | 2620353760 | |||
| 625 | 2626634473 | |||
| 626 | 2671839547 | |||
| 627 | 2676204725 | |||
| 628 | 2686534375 | |||
| 629 | 2686541115 | |||
| 630 | 2689964278 | |||
| 631 | 2689990502 | |||
| 632 | 2710604300 | |||
| 633 | 2774849300 | |||
| 634 | 2774857703 | |||
| 635 | 2774864282 | |||
| 636 | 2774904611 | |||
| 637 | 2895883763 | |||
| 638 | 637877585 | |||
| 639 | 8002779140 | |||
| 640 | 8054915559 | |||
| 641 | 8054922132 | |||
| 642 | 8055162194 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7nkz-assembly1.cif.gz_B | cryo-em structure of the cytochrome bd oxidase from m. tuberculosis at 2.5 a resolution | 0.8986 | 4 | 326 |
| 7nkz-assembly1.cif.gz_B | cryo-em structure of the cytochrome bd oxidase from m. tuberculosis at 2.5 a resolution | 0.8478 | 4 | 326 |
| 6rko-assembly1.cif.gz_B | cryo-em structure of the e. coli cytochrome bd-i oxidase at 2.68 a resolution | 0.8471 | 4 | 321 |
| 7ose-assembly1.cif.gz_B | cytochrome bd-ii type oxidase with bound aurachin d | 0.8395 | 4 | 337 |
| 8b4o-assembly1.cif.gz_B | cryo-em structure of cytochrome bd oxidase from c. glutamicum | 0.837 | 2 | 326 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q4FZV2_37_153_1.10.10.1740 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like | 0.7521 | 173 | 283 | 1.10.10.1740 |
| af_Q4FZV2_37_153_1.10.10.1740 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Transmembrane protein 14-like | 0.6702 | 173 | 283 | 1.10.10.1740 |
| af_P32709_7_307_1.20.1630.10 | Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain | 0.66 | 15 | 273 | 1.20.1630.10 |
| af_K7LU78_450_565_1.20.58.390 | Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Neurotransmitter-gated ion-channel transmembrane domain | 0.6226 | 128 | 221 | 1.20.58.390 |
| af_P76173_1_274_1.20.1630.10 | Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain | 0.6103 | 14 | 278 | 1.20.1630.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V7RXB8-F1-model_v4 | Cytochrome BD ubiquinol oxidase subunit II | 0.9755 | 7 | 265 |
GO:0005886
GO:0009055 GO:0016682 GO:0019646 GO:0070069 |
| AF-A0A2V6R7M0-F1-model_v4 | Cytochrome BD ubiquinol oxidase subunit II | 0.9745 | 1 | 328 |
GO:0005886
GO:0009055 GO:0016682 GO:0019646 GO:0070069 |
| AF-A0A7W1UDR8-F1-model_v4 | Cytochrome d ubiquinol oxidase subunit II | 0.9729 | 1 | 326 |
GO:0005886
GO:0009055 GO:0016682 GO:0019646 GO:0070069 |
| AF-A0A838SCA8-F1-model_v4 | Cytochrome d ubiquinol oxidase subunit II | 0.9722 | 1 | 327 |
GO:0005886
GO:0009055 GO:0016682 GO:0019646 GO:0070069 |
| AF-A0A5N7YX57-F1-model_v4 | deleted | 0.9691 | 5 | 136 |
|