F406196

General Info

Members Datasets Scaffolds Average Seq Length
321 218 642 285

Family's Representative Sequence

Representative Sequence 3300053109|Ga0500569_014369|Ga0500569_014369_923_1909
Length 328
Sequence VGDDRLDDRAVDGQHANNTNVLPTFQRRGSAHARTGRGLGYEEDMKQRSIANVQVGAIGLGGMPMSIEGRPGTDRSVATIHAALDAGVTLIDTADAYHLHADEVGHNEILIAQALASWGGDTSGVLVATKGGHLRPGDGSWYVDGDPAYLKQAAEASLKRLGVEAIGLYQFHRPDPRVPFEESVGAVRDLLDEGKIRLAGISNANPAQIRQAQQILGGRLASVQNQFSPAFRSSEPELRLCDELGIAFLPYSPLGGISRAGQLGDRFAEFATVAQAHGVSPQQVALAWMLAKSPRVIPIPGASRPESIQDSARSAELTLTPAELLDLG

Samples

Sample ID Description Type Environment
1 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
2 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
7 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
8 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
9 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
10 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
11 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
12 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
45 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
46 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
47 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
50 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
55 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
59 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
61 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
62 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
65 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
66 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
69 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
86 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
87 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
88 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
89 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
90 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
91 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
92 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
93 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
94 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
95 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
96 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
97 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
98 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
99 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
100 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
101 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
102 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
103 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
104 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
105 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
106 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
107 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
108 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
109 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
110 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
111 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
112 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
113 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
118 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
119 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
120 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
121 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
122 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
123 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
124 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
125 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
126 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
127 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
128 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
129 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
130 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
131 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
132 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
133 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
134 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
135 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
136 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
137 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
138 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
139 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
140 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
141 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
142 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
143 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
144 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
145 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
146 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
147 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
148 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
149 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
150 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
151 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
152 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
153 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
154 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
155 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
156 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
157 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
158 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
159 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
160 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
161 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
162 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
163 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
164 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
165 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
166 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
167 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
168 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
171 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
172 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
173 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
174 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
175 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
176 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
177 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
178 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
179 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
180 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
181 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
182 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
183 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
184 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
185 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
186 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
189 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
190 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
191 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
192 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
193 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
194 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
195 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
196 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
197 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
198 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
199 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
200 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
201 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
202 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
203 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
204 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
205 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
206 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
207 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
208 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
209 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
210 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
211 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
212 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
213 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
214 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
215 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
216 2891562705 Microbispora tritici MT50 Isolate Unclassified
217 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
218 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 94.39
Metatranscriptomes 1.56
Isolates 4.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.79
Nodule 0
Rhizoplane 9.03
Rhizosphere 69.78
Stem 0
Stem Tuber 0.31
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500569_014369 3300053109 Bacteria 1958
2 JGI25164J39214_1002206 3300002772 Bacteria 3212
3 JGI25406J46586_10011231 3300003203 Bacteria 3937
4 JGI25406J46586_10065024 3300003203 Bacteria 1164
5 JGI25406J46586_10081938 3300003203 Bacteria 988
6 JGI25165J46597_1000092 3300003214 Bacteria 165407
7 rootL2_10126546 3300003322 Bacteria 3400
8 Ga0055539_1000006 3300003752 Bacteria 580055
9 Ga0055533_1000002 3300003756 Bacteria 1196393
10 Ga0055525_1000205 3300003759 Bacteria 67917
11 Ga0055527_1000004 3300003760 Bacteria 570634
12 Ga0055542_1000055 3300003762 Bacteria 171477
13 Ga0055529_1000066 3300003763 Bacteria 170902
14 Ga0055541_1002873 3300003841 Bacteria 3334
15 Ga0070658_10118789 3300005327 Bacteria 2196
16 Ga0070658_10236714 3300005327 Bacteria 1547
17 Ga0068869_100094524 3300005334 Bacteria 2254
18 Ga0070660_100224901 3300005339 Bacteria 1526
19 Ga0070675_100210727 3300005354 Bacteria 1689
20 Ga0070714_100123691 3300005435 Bacteria 2304
21 Ga0070714_100134309 3300005435 Bacteria 2214
22 Ga0070711_100358437 3300005439 Bacteria 1174
23 Ga0070708_100055865 3300005445 Bacteria 3511
24 Ga0070678_100332633 3300005456 Bacteria 1300
25 Ga0070706_100032754 3300005467 Bacteria 4795
26 Ga0070707_100000213 3300005468 Bacteria 58009
27 Ga0070698_100001139 3300005471 Bacteria 29426
28 Ga0070698_100001372 3300005471 Bacteria 27070
29 Ga0070698_100074664 3300005471 Bacteria 3396
30 Ga0070679_100044486 3300005530 Bacteria 4423
31 Ga0070684_100094327 3300005535 Bacteria 2665
32 Ga0070684_100423497 3300005535 Bacteria 1229
33 Ga0068853_100212925 3300005539 Bacteria 1762
34 Ga0070665_100191749 3300005548 Bacteria 2044
35 Ga0070665_100215070 3300005548 Bacteria 1923
36 Ga0068855_100075318 3300005563 Bacteria 3919
37 Ga0068854_100026713 3300005578 Bacteria 3971
38 Ga0068856_100060984 3300005614 Bacteria 3726
39 Ga0068856_100897373 3300005614 Bacteria 905
40 Ga0068852_100013884 3300005616 Bacteria 6177
41 Ga0068861_100302915 3300005719 Bacteria 1385
42 Ga0081540_1016362 3300005983 Bacteria 4645
43 Ga0081539_10003394 3300005985 Bacteria 19669
44 Ga0081539_10003768 3300005985 Bacteria 17950
45 Ga0081539_10014603 3300005985 Bacteria 5792
46 Ga0081539_10043677 3300005985 Bacteria 2595
47 Ga0070717_10503324 3300006028 Bacteria 1095
48 Ga0075428_100004406 3300006844 Bacteria 15544
49 Ga0075434_100011898 3300006871 Bacteria 8229
50 Ga0075429_100005125 3300006880 Bacteria 11266
51 Ga0075436_100019142 3300006914 Bacteria 4690
52 Ga0075435_100050305 3300007076 Bacteria 3353
53 Ga0105240_10163831 3300009093 Bacteria 2639
54 Ga0105245_10083550 3300009098 Bacteria 2923
55 Ga0114129_10003796 3300009147 Bacteria 21298
56 Ga0105243_10180883 3300009148 Bacteria 1833
57 Ga0105241_10010787 3300009174 Bacteria 6703
58 Ga0105248_10115642 3300009177 Bacteria 3025
59 Ga0105237_10113430 3300009545 Bacteria 2703
60 Ga0105249_10796106 3300009553 Bacteria 1009
61 Ga0105246_10224588 3300011119 Bacteria 1474
62 Ga0157370_10142528 3300013104 Bacteria 2233
63 Ga0157372_10019201 3300013307 Bacteria 7360
64 Ga0157375_10074440 3300013308 Bacteria 3417
65 Ga0157375_10092274 3300013308 Bacteria 3092
66 Ga0163163_10006580 3300014325 Bacteria 10177
67 Ga0182008_10109887 3300014497 Bacteria 1366
68 Ga0197907_11450923 3300020069 Bacteria 2840
69 Ga0206356_11749057 3300020070 Bacteria 1165
70 Ga0206349_1662847 3300020075 Bacteria 964
71 Ga0206354_10678980 3300020081 Bacteria 1340
72 Ga0206353_11193312 3300020082 Bacteria 13526
73 Ga0213875_10019837 3300021388 Bacteria 3230
74 Ga0224572_1000928 3300024225 Bacteria 3996
75 Ga0209672_100011 3300025228 Bacteria 856297
76 Ga0209147_100787 3300025229 Bacteria 15411
77 Ga0207427_100182 3300025231 Bacteria 64661
78 Ga0209437_100523 3300025233 Bacteria 26718
79 Ga0209258_103052 3300025242 Bacteria 3839
80 Ga0209148_1000132 3300025254 Bacteria 171529
81 Ga0209233_1000014 3300025261 Bacteria 996641
82 Ga0209455_1000122 3300025272 Bacteria 170954
83 Ga0207647_10008456 3300025904 Bacteria 7378
84 Ga0207699_10196679 3300025906 Bacteria 1364
85 Ga0207705_10078792 3300025909 Bacteria 2398
86 Ga0207684_10078588 3300025910 Bacteria 2806
87 Ga0207646_10000105 3300025922 Bacteria 114126
88 Ga0207700_10079693 3300025928 Bacteria 2551
89 Ga0207664_10002190 3300025929 Bacteria 12866
90 Ga0207664_10015533 3300025929 Bacteria 5530
91 Ga0207709_10045749 3300025935 Bacteria 2652
92 Ga0207711_10281150 3300025941 Bacteria 1533
93 Ga0207689_10074645 3300025942 Bacteria 2786
94 Ga0207661_10157273 3300025944 Bacteria 1970
95 Ga0207678_10621406 3300026067 Bacteria 948
96 Ga0207708_10335248 3300026075 Bacteria 1237
97 Ga0207702_10803485 3300026078 Bacteria 930
98 Ga0207675_100430850 3300026118 Bacteria 1304
99 Ga0265336_10002526 3300028666 Bacteria 7489
100 Ga0307517_10069776 3300028786 Bacteria 3177
101 Ga0307515_10011322 3300028794 Bacteria 16929
102 Ga0307515_10294046 3300028794 Bacteria 1317
103 Ga0265338_10003697 3300028800 Bacteria 21293
104 Ga0307512_10012947 3300030522 Bacteria 7841
105 Ga0307512_10214964 3300030522 Bacteria 1015
106 Ga0307513_10003176 3300031456 Bacteria 22437
107 Ga0307509_10040283 3300031507 Bacteria 5081
108 Ga0307509_10082441 3300031507 Bacteria 3318
109 Ga0307408_100377715 3300031548 Bacteria 1211
110 Ga0307508_10005866 3300031616 Bacteria 11590
111 Ga0307508_10212431 3300031616 Bacteria 1535
112 Ga0307514_10055188 3300031649 Bacteria 3056
113 Ga0316576_10063823 3300031727 Bacteria 2704
114 Ga0307516_10000514 3300031730 Bacteria 51755
115 Ga0307405_10033292 3300031731 Bacteria 3055
116 Ga0307413_10031130 3300031824 Bacteria 3006
117 Ga0307413_10203642 3300031824 Bacteria 1431
118 Ga0307413_10271538 3300031824 Bacteria 1270
119 Ga0307518_10035794 3300031838 Bacteria 3606
120 Ga0307406_10011630 3300031901 Bacteria 4998
121 Ga0307406_10075348 3300031901 Bacteria 2226
122 Ga0307409_100008158 3300031995 Bacteria 6330
123 Ga0307409_100196363 3300031995 Bacteria 1801
124 Ga0307416_100302025 3300032002 Bacteria 1592
125 Ga0307414_10052806 3300032004 Bacteria 2831
126 Ga0307411_10004513 3300032005 Bacteria 6679
127 Ga0307411_10087387 3300032005 Bacteria 2165
128 Ga0307415_100028117 3300032126 Bacteria 3573
129 Ga0307415_100046673 3300032126 Bacteria 2911
130 Ga0307415_100076058 3300032126 Bacteria 2379
131 Ga0307415_100199138 3300032126 Bacteria 1587
132 Ga0307415_100229039 3300032126 Bacteria 1495
133 Ga0307507_10000025 3300033179 Bacteria 205842
134 Ga0307507_10110892 3300033179 Bacteria 2243
135 Ga0307510_10016269 3300033180 Bacteria 8782
136 Ga0373934_0083002 3300035086 Bacteria 1288
137 Ga0373955_0123313 3300035172 Bacteria 1508
138 Ga0373924_0197434 3300035410 Bacteria 887
139 Ga0373935_0395373 3300035692 Bacteria 992
140 Ga0373933_0026673 3300035724 Bacteria 3319
141 Ga0373933_0267833 3300035724 Bacteria 1102
142 Ga0373937_0004180 3300036401 Bacteria 12243
143 Ga0373937_0767466 3300036401 Bacteria 912
144 Ga0373925_0008213 3300037068 Bacteria 7600
145 Ga0395899_0064854 3300037312 Bacteria 2684
146 Ga0395899_0143460 3300037312 Bacteria 1697
147 Ga0395900_0164562 3300037418 Bacteria 2261
148 Ga0436364_0184510 3300037853 Bacteria 4361
149 Ga0436364_0780939 3300037853 Bacteria 2034
150 Ga0436364_1265507 3300037853 Bacteria 48294
151 Ga0451791_0175243 3300041451 Bacteria 1015
152 Ga0451791_0425205 3300041451 Bacteria 3405
153 Ga0451791_1708147 3300041451 Bacteria 1501
154 Ga0451833_1031829 3300041491 Bacteria 1045
155 Ga0451841_0643718 3300041498 Bacteria 1869
156 Ga0451851_0248816 3300041507 Bacteria 1108
157 Ga0466969_0001615 3300044656 Bacteria 12072
158 Ga0466969_0004327 3300044656 Bacteria 7557
159 Ga0466969_0010580 3300044656 Bacteria 4889
160 Ga0466969_0024110 3300044656 Bacteria 3129
161 Ga0466966_0007982 3300044684 Bacteria 7015
162 Ga0466966_0026817 3300044684 Bacteria 3760
163 Ga0466961_0011743 3300044693 Bacteria 5597
164 Ga0466961_0013050 3300044693 Bacteria 5315
165 Ga0466961_0030629 3300044693 Bacteria 3457
166 Ga0466961_0093722 3300044693 Bacteria 1895
167 Ga0466961_0136371 3300044693 Bacteria 1537
168 Ga0466961_0195797 3300044693 Bacteria 1251
169 Ga0466971_0010413 3300044719 Bacteria 4063
170 Ga0466971_0020097 3300044719 Bacteria 2968
171 Ga0466971_0031539 3300044719 Bacteria 2373
172 Ga0466970_0094237 3300044765 Bacteria 1627
173 Ga0466970_0120055 3300044765 Bacteria 1439
174 Ga0466957_0050830 3300044842 Bacteria 2523
175 Ga0466957_0062861 3300044842 Bacteria 2281
176 Ga0466959_0004404 3300045049 Bacteria 9425
177 Ga0466959_0005892 3300045049 Bacteria 8442
178 Ga0466959_0011825 3300045049 Bacteria 6283
179 Ga0466959_0129760 3300045049 Bacteria 1787
180 Ga0466967_0010969 3300045976 Bacteria 6831
181 Ga0466967_0041397 3300045976 Bacteria 3972
182 Ga0466967_0515755 3300045976 Bacteria 1174
183 Ga0495627_025880 3300046453 Bacteria 1898
184 Ga0495592_0016050 3300046454 Bacteria 5683
185 Ga0495592_0104784 3300046454 Bacteria 2010
186 Ga0495592_0142458 3300046454 Bacteria 1666
187 Ga0495629_0176187 3300046459 Bacteria 1483
188 Ga0495638_0064320 3300046460 Bacteria 2260
189 Ga0495651_0000447 3300046462 Bacteria 31798
190 Ga0495651_0048800 3300046462 Bacteria 3268
191 Ga0495653_0000343 3300046463 Bacteria 37889
192 Ga0495653_0010871 3300046463 Bacteria 7452
193 Ga0495653_0109954 3300046463 Bacteria 1982
194 Ga0495653_0298558 3300046463 Bacteria 1051
195 Ga0495580_0048127 3300046472 Bacteria 3021
196 Ga0495662_0000597 3300046476 Bacteria 16672
197 Ga0495664_0004011 3300046477 Bacteria 8037
198 Ga0495608_0000968 3300046511 Bacteria 20278
199 Ga0495608_0051137 3300046511 Bacteria 2739
200 Ga0495618_0065135 3300046514 Bacteria 2316
201 Ga0495618_0088786 3300046514 Bacteria 1977
202 Ga0495628_0006306 3300046516 Bacteria 10359
203 Ga0495630_0063288 3300046517 Bacteria 2778
204 Ga0495666_0018259 3300046526 Bacteria 3492
205 Ga0495652_0000606 3300046529 Bacteria 42033
206 Ga0495652_0002727 3300046529 Bacteria 17906
207 Ga0495652_0094123 3300046529 Bacteria 2444
208 Ga0495665_0021872 3300046531 Bacteria 3439
209 Ga0495640_0046253 3300046533 Bacteria 3016
210 Ga0495587_0002974 3300046536 Bacteria 11332
211 Ga0495645_0014086 3300046543 Bacteria 5667
212 Ga0495645_0021528 3300046543 Bacteria 4658
213 Ga0495645_0067609 3300046543 Bacteria 2580
214 Ga0495645_0126720 3300046543 Bacteria 1794
215 Ga0495667_0000183 3300046559 Bacteria 42442
216 Ga0495668_0237609 3300046616 Bacteria 998
217 Ga0495634_0235331 3300046642 Bacteria 1125
218 Ga0495635_0004084 3300046663 Bacteria 10129
219 Ga0495635_0010351 3300046663 Bacteria 6522
220 Ga0495635_0034226 3300046663 Bacteria 3523
221 Ga0495635_0113428 3300046663 Bacteria 1851
222 Ga0495635_0233946 3300046663 Bacteria 1241
223 Ga0495657_0000843 3300046675 Bacteria 27048
224 Ga0495657_0014100 3300046675 Bacteria 5873
225 Ga0495599_0010675 3300046678 Bacteria 5622
226 Ga0495623_0052492 3300046679 Bacteria 2576
227 Ga0495623_0140903 3300046679 Bacteria 1434
228 Ga0495646_0011225 3300046680 Bacteria 5688
229 Ga0495646_0025358 3300046680 Bacteria 3729
230 Ga0495646_0046886 3300046680 Bacteria 2632
231 Ga0495613_0010156 3300046689 Bacteria 6993
232 Ga0495600_0000476 3300046809 Bacteria 20783
233 Ga0495600_0187318 3300046809 Bacteria 1332
234 Ga0495581_0050084 3300047315 Bacteria 2412
235 Ga0495604_0001550 3300047317 Bacteria 18931
236 Ga0495604_0016683 3300047317 Bacteria 5873
237 Ga0495604_0098184 3300047317 Bacteria 2159
238 Ga0495604_0355815 3300047317 Bacteria 972
239 Ga0495674_0145182 3300047319 Bacteria 1992
240 Ga0495674_0175079 3300047319 Bacteria 1788
241 Ga0495680_0000669 3300047322 Bacteria 38383
242 Ga0495675_0044554 3300047444 Bacteria 2826
243 Ga0495684_0022766 3300047471 Bacteria 4818
244 Ga0495684_0097679 3300047471 Bacteria 2221
245 Ga0495593_0014251 3300047673 Bacteria 4521
246 Ga0495602_0001386 3300048088 Bacteria 23910
247 Ga0496100_0022185 3300048903 Bacteria 3838
248 Ga0496100_0046607 3300048903 Bacteria 2789
249 Ga0496101_0227943 3300048904 Bacteria 1447
250 Ga0496102_0047315 3300048905 Bacteria 3908
251 Ga0496102_0202929 3300048905 Bacteria 1869
252 Ga0496103_0086046 3300048906 Bacteria 1981
253 Ga0496104_0000620 3300048907 Bacteria 30445
254 Ga0496104_0183013 3300048907 Bacteria 2006
255 Ga0496104_0204460 3300048907 Bacteria 1886
256 Ga0496104_0510132 3300048907 Bacteria 1114
257 Ga0496105_0003382 3300048908 Bacteria 11794
258 Ga0496105_0285188 3300048908 Bacteria 1330
259 Ga0496105_0428215 3300048908 Bacteria 1047
260 Ga0496108_0001092 3300048911 Bacteria 21182
261 Ga0496108_0132040 3300048911 Bacteria 2146
262 Ga0496108_0520272 3300048911 Bacteria 1039
263 Ga0496109_0194997 3300048912 Bacteria 1904
264 Ga0496109_0265343 3300048912 Bacteria 1617
265 Ga0496111_0002253 3300048914 Bacteria 11590
266 Ga0496112_0177630 3300048915 Bacteria 2094
267 Ga0496112_0759283 3300048915 Bacteria 896
268 Ga0496114_0036338 3300048917 Bacteria 4072
269 Ga0496114_0087519 3300048917 Bacteria 2641
270 Ga0496114_0198963 3300048917 Bacteria 1755
271 Ga0496115_0146238 3300048918 Bacteria 1950
272 Ga0496115_0163204 3300048918 Bacteria 1842
273 Ga0496118_0061396 3300048921 Bacteria 2783
274 Ga0496118_0114217 3300048921 Bacteria 1781
275 Ga0496119_0015658 3300048922 Bacteria 5819
276 Ga0496119_0033166 3300048922 Bacteria 3429
277 Ga0496120_0139236 3300048923 Bacteria 1234
278 Ga0496121_0270153 3300048924 Bacteria 1169
279 Ga0496122_0001313 3300048925 Bacteria 40783
280 Ga0496125_0000224 3300048928 Bacteria 115811
281 Ga0496125_0000230 3300048928 Bacteria 114490
282 Ga0496126_0369577 3300048929 Bacteria 1170
283 Ga0501033_0010777 3300049570 Bacteria 7010
284 Ga0501047_0260649 3300049581 Bacteria 1581
285 Ga0501070_0000317 3300049586 Bacteria 43770
286 Ga0501044_0024120 3300049823 Bacteria 6462
287 nmdc:mga05p37_10912_c1 3300050507 Bacteria 10786
288 nmdc:mga06r32_85588_c1 3300050510 Bacteria 3074
289 nmdc:mga0n895_3601_c1 3300050512 Bacteria 12521
290 nmdc:mga08x19_11518_c1 3300050514 Bacteria 5323
291 nmdc:mga0a205_71088_c1 3300050515 Bacteria 3361
292 Ga0495601_0005173 3300053077 Bacteria 7581
293 Ga0495601_0014229 3300053077 Bacteria 4793
294 Ga0495601_0041805 3300053077 Bacteria 2874
295 Ga0495601_0158652 3300053077 Bacteria 1478
296 Ga0495601_0210859 3300053077 Bacteria 1269
297 Ga0495612_0003601 3300053078 Bacteria 6423
298 Ga0495612_0046482 3300053078 Bacteria 1778
299 Ga0500635_0000059 3300053080 Bacteria 72321
300 Ga0495619_0036746 3300053085 Bacteria 3191
301 Ga0500644_0006336 3300053088 Bacteria 3027
302 Ga0500641_0173280 3300053096 Bacteria 928
303 Ga0500652_019258 3300053131 Bacteria 2532
304 Ga0500559_0003136 3300053136 Bacteria 8214
305 Ga0500600_0136543 3300053149 Bacteria 1241
306 Ga0500616_0011743 3300053153 Bacteria 5155
307 Ga0466962_0035503 3300061719 Bacteria 2386
308 Ga0466962_0221172 3300061719 Bacteria 927
309 2515857288 2515154155 Bacteria 7985436
310 2753268058 2751185782 Bacteria 11227053
311 2768643108 2767802112 Bacteria 6465194
312 2812483125 2811994917 Bacteria 7761064
313 2837268799 2837268691 Bacteria 7850704
314 2856747880 2856741275 Bacteria 8096094
315 2867305990 2867302475 Bacteria 7087181
316 2884763666 2884763398 Bacteria 4091164
317 2891396603 2891395885 Bacteria 9251614
318 2891555762 2891554331 Bacteria 8812224
319 2891567913 2891562705 Bacteria 8039471
320 8055072503 8055066027 Bacteria 9479577
321 8055174269 8055172936 Bacteria 9305943
322 Ga0500569_014369
323 JGI25164J39214_1002206
324 JGI25406J46586_10011231
325 JGI25406J46586_10065024
326 JGI25406J46586_10081938
327 JGI25165J46597_1000092
328 rootL2_10126546
329 Ga0055539_1000006
330 Ga0055533_1000002
331 Ga0055525_1000205
332 Ga0055527_1000004
333 Ga0055542_1000055
334 Ga0055529_1000066
335 Ga0055541_1002873
336 Ga0070658_10118789
337 Ga0070658_10236714
338 Ga0068869_100094524
339 Ga0070660_100224901
340 Ga0070675_100210727
341 Ga0070714_100123691
342 Ga0070714_100134309
343 Ga0070711_100358437
344 Ga0070708_100055865
345 Ga0070678_100332633
346 Ga0070706_100032754
347 Ga0070707_100000213
348 Ga0070698_100001139
349 Ga0070698_100001372
350 Ga0070698_100074664
351 Ga0070679_100044486
352 Ga0070684_100094327
353 Ga0070684_100423497
354 Ga0068853_100212925
355 Ga0070665_100191749
356 Ga0070665_100215070
357 Ga0068855_100075318
358 Ga0068854_100026713
359 Ga0068856_100060984
360 Ga0068856_100897373
361 Ga0068852_100013884
362 Ga0068861_100302915
363 Ga0081540_1016362
364 Ga0081539_10003394
365 Ga0081539_10003768
366 Ga0081539_10014603
367 Ga0081539_10043677
368 Ga0070717_10503324
369 Ga0075428_100004406
370 Ga0075434_100011898
371 Ga0075429_100005125
372 Ga0075436_100019142
373 Ga0075435_100050305
374 Ga0105240_10163831
375 Ga0105245_10083550
376 Ga0114129_10003796
377 Ga0105243_10180883
378 Ga0105241_10010787
379 Ga0105248_10115642
380 Ga0105237_10113430
381 Ga0105249_10796106
382 Ga0105246_10224588
383 Ga0157370_10142528
384 Ga0157372_10019201
385 Ga0157375_10074440
386 Ga0157375_10092274
387 Ga0163163_10006580
388 Ga0182008_10109887
389 Ga0197907_11450923
390 Ga0206356_11749057
391 Ga0206349_1662847
392 Ga0206354_10678980
393 Ga0206353_11193312
394 Ga0213875_10019837
395 Ga0224572_1000928
396 Ga0209672_100011
397 Ga0209147_100787
398 Ga0207427_100182
399 Ga0209437_100523
400 Ga0209258_103052
401 Ga0209148_1000132
402 Ga0209233_1000014
403 Ga0209455_1000122
404 Ga0207647_10008456
405 Ga0207699_10196679
406 Ga0207705_10078792
407 Ga0207684_10078588
408 Ga0207646_10000105
409 Ga0207700_10079693
410 Ga0207664_10002190
411 Ga0207664_10015533
412 Ga0207709_10045749
413 Ga0207711_10281150
414 Ga0207689_10074645
415 Ga0207661_10157273
416 Ga0207678_10621406
417 Ga0207708_10335248
418 Ga0207702_10803485
419 Ga0207675_100430850
420 Ga0265336_10002526
421 Ga0307517_10069776
422 Ga0307515_10011322
423 Ga0307515_10294046
424 Ga0265338_10003697
425 Ga0307512_10012947
426 Ga0307512_10214964
427 Ga0307513_10003176
428 Ga0307509_10040283
429 Ga0307509_10082441
430 Ga0307408_100377715
431 Ga0307508_10005866
432 Ga0307508_10212431
433 Ga0307514_10055188
434 Ga0316576_10063823
435 Ga0307516_10000514
436 Ga0307405_10033292
437 Ga0307413_10031130
438 Ga0307413_10203642
439 Ga0307413_10271538
440 Ga0307518_10035794
441 Ga0307406_10011630
442 Ga0307406_10075348
443 Ga0307409_100008158
444 Ga0307409_100196363
445 Ga0307416_100302025
446 Ga0307414_10052806
447 Ga0307411_10004513
448 Ga0307411_10087387
449 Ga0307415_100028117
450 Ga0307415_100046673
451 Ga0307415_100076058
452 Ga0307415_100199138
453 Ga0307415_100229039
454 Ga0307507_10000025
455 Ga0307507_10110892
456 Ga0307510_10016269
457 Ga0373934_0083002
458 Ga0373955_0123313
459 Ga0373924_0197434
460 Ga0373935_0395373
461 Ga0373933_0026673
462 Ga0373933_0267833
463 Ga0373937_0004180
464 Ga0373937_0767466
465 Ga0373925_0008213
466 Ga0395899_0064854
467 Ga0395899_0143460
468 Ga0395900_0164562
469 Ga0436364_0184510
470 Ga0436364_0780939
471 Ga0436364_1265507
472 Ga0451791_0175243
473 Ga0451791_0425205
474 Ga0451791_1708147
475 Ga0451833_1031829
476 Ga0451841_0643718
477 Ga0451851_0248816
478 Ga0466969_0001615
479 Ga0466969_0004327
480 Ga0466969_0010580
481 Ga0466969_0024110
482 Ga0466966_0007982
483 Ga0466966_0026817
484 Ga0466961_0011743
485 Ga0466961_0013050
486 Ga0466961_0030629
487 Ga0466961_0093722
488 Ga0466961_0136371
489 Ga0466961_0195797
490 Ga0466971_0010413
491 Ga0466971_0020097
492 Ga0466971_0031539
493 Ga0466970_0094237
494 Ga0466970_0120055
495 Ga0466957_0050830
496 Ga0466957_0062861
497 Ga0466959_0004404
498 Ga0466959_0005892
499 Ga0466959_0011825
500 Ga0466959_0129760
501 Ga0466967_0010969
502 Ga0466967_0041397
503 Ga0466967_0515755
504 Ga0495627_025880
505 Ga0495592_0016050
506 Ga0495592_0104784
507 Ga0495592_0142458
508 Ga0495629_0176187
509 Ga0495638_0064320
510 Ga0495651_0000447
511 Ga0495651_0048800
512 Ga0495653_0000343
513 Ga0495653_0010871
514 Ga0495653_0109954
515 Ga0495653_0298558
516 Ga0495580_0048127
517 Ga0495662_0000597
518 Ga0495664_0004011
519 Ga0495608_0000968
520 Ga0495608_0051137
521 Ga0495618_0065135
522 Ga0495618_0088786
523 Ga0495628_0006306
524 Ga0495630_0063288
525 Ga0495666_0018259
526 Ga0495652_0000606
527 Ga0495652_0002727
528 Ga0495652_0094123
529 Ga0495665_0021872
530 Ga0495640_0046253
531 Ga0495587_0002974
532 Ga0495645_0014086
533 Ga0495645_0021528
534 Ga0495645_0067609
535 Ga0495645_0126720
536 Ga0495667_0000183
537 Ga0495668_0237609
538 Ga0495634_0235331
539 Ga0495635_0004084
540 Ga0495635_0010351
541 Ga0495635_0034226
542 Ga0495635_0113428
543 Ga0495635_0233946
544 Ga0495657_0000843
545 Ga0495657_0014100
546 Ga0495599_0010675
547 Ga0495623_0052492
548 Ga0495623_0140903
549 Ga0495646_0011225
550 Ga0495646_0025358
551 Ga0495646_0046886
552 Ga0495613_0010156
553 Ga0495600_0000476
554 Ga0495600_0187318
555 Ga0495581_0050084
556 Ga0495604_0001550
557 Ga0495604_0016683
558 Ga0495604_0098184
559 Ga0495604_0355815
560 Ga0495674_0145182
561 Ga0495674_0175079
562 Ga0495680_0000669
563 Ga0495675_0044554
564 Ga0495684_0022766
565 Ga0495684_0097679
566 Ga0495593_0014251
567 Ga0495602_0001386
568 Ga0496100_0022185
569 Ga0496100_0046607
570 Ga0496101_0227943
571 Ga0496102_0047315
572 Ga0496102_0202929
573 Ga0496103_0086046
574 Ga0496104_0000620
575 Ga0496104_0183013
576 Ga0496104_0204460
577 Ga0496104_0510132
578 Ga0496105_0003382
579 Ga0496105_0285188
580 Ga0496105_0428215
581 Ga0496108_0001092
582 Ga0496108_0132040
583 Ga0496108_0520272
584 Ga0496109_0194997
585 Ga0496109_0265343
586 Ga0496111_0002253
587 Ga0496112_0177630
588 Ga0496112_0759283
589 Ga0496114_0036338
590 Ga0496114_0087519
591 Ga0496114_0198963
592 Ga0496115_0146238
593 Ga0496115_0163204
594 Ga0496118_0061396
595 Ga0496118_0114217
596 Ga0496119_0015658
597 Ga0496119_0033166
598 Ga0496120_0139236
599 Ga0496121_0270153
600 Ga0496122_0001313
601 Ga0496125_0000224
602 Ga0496125_0000230
603 Ga0496126_0369577
604 Ga0501033_0010777
605 Ga0501047_0260649
606 Ga0501070_0000317
607 Ga0501044_0024120
608 nmdc:mga05p37_10912_c1
609 nmdc:mga06r32_85588_c1
610 nmdc:mga0n895_3601_c1
611 nmdc:mga08x19_11518_c1
612 nmdc:mga0a205_71088_c1
613 Ga0495601_0005173
614 Ga0495601_0014229
615 Ga0495601_0041805
616 Ga0495601_0158652
617 Ga0495601_0210859
618 Ga0495612_0003601
619 Ga0495612_0046482
620 Ga0500635_0000059
621 Ga0495619_0036746
622 Ga0500644_0006336
623 Ga0500641_0173280
624 Ga0500652_019258
625 Ga0500559_0003136
626 Ga0500600_0136543
627 Ga0500616_0011743
628 Ga0466962_0035503
629 Ga0466962_0221172
630 2515857288
631 2753268058
632 2768643108
633 2812483125
634 2837268799
635 2856747880
636 2867305990
637 2884763666
638 2891396603
639 2891555762
640 2891567913
641 8055072503
642 8055174269

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

57

327

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hnq-assembly1.cif.gz_A the structure of a alcohol dehydrogenase akr13b2 with nadp 0.9203 3 283
3v0t-assembly1.cif.gz_A crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding 0.9097 1 285
4fzi-assembly2.cif.gz_B crystal structure of prostaglandin f synthase from trypanosoma cruzi 0.9018 3 285
3f7j-assembly2.cif.gz_B b.subtilis yvgn 0.901 3 285
4mhb-assembly4.cif.gz_D structure of a putative reductase from yersinia pestis 0.9006 1 285
ID Description Score Start End Superfamily
af_O94315_19_306_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9168 5 285 3.20.20.100
af_A0A0R0ETH2_7_234_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9139 1 211 3.20.20.100
af_Q4DJ07_1_282_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.909 7 285 3.20.20.100
3v0uA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8974 2 286 3.20.20.100
af_Q2G2T8_4_275_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8974 2 285 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A7V9SHP7-F1-model_v4 Aldo/keto reductase 0.9888 96 286 GO:0004033
GO:0005737
AF-A0A075V0A1-F1-model_v4 Aldo/keto reductase 0.9845 1 282 GO:0004033
GO:0005737
AF-A0A1T2X6X9-F1-model_v4 Aldo/keto reductase 0.9769 1 284 GO:0004033
GO:0005737
AF-A0A075V0A1-F1-model_v4 Aldo/keto reductase 0.9739 1 282 GO:0004033
GO:0005737
AF-A0A1H2DK65-F1-model_v4 deleted 0.9729 1 285

Map