F406084

General Info

Members Datasets Scaffolds Average Seq Length
321 246 309 275

Family's Representative Sequence

Representative Sequence 3300042002|Ga0439442_003294|Ga0439442_003294_1074_2018
Length 314
Sequence MSDKARKQSNWTLPFWRCGQPNTSLISVLPHLNNTHTSMAPTRSLNEDDPLDDFTPRQITLEGIEKKVHTAGRGPAVIVMTEMPGISPQVARFARWVRGAGFTVYMPSLFGRDGAVPEADEGAAVFKRACVSAEFRAFASNASSPVTQWLRALARLAHKECGGPGVGAIGMCFTGNFALSMMMEPAMLAPVVCQPSLPLDDPAGMNVAADELAAVRLRLEREDLSVMAYRFEGDRFCRAERFAAFSQALGERFVARVLPDSAANPDTPPFFARWVASPHSVVTAHLIDEAGQPTVAARDEILAFLALRLLGEPG

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2643221658 Variovorax sp. Root411 Isolate Unclassified
3 2643221672 Variovorax sp. Root434 Isolate Unclassified
4 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
5 2818991446 Variovorax sp. 1180 Isolate Unclassified
6 2899924645 Variovorax sp. 369 Isolate Unclassified
7 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
8 2928037797 Variovorax sp. 1126 Isolate Unclassified
9 2928044640 Variovorax sp. 1128 Isolate Unclassified
10 2928051484 Variovorax sp. 1133 Isolate Unclassified
11 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
12 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
13 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
14 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
15 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
16 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
17 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
18 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
19 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
20 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
21 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
22 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
23 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
24 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
25 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
26 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
27 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
28 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
29 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
30 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
31 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
32 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
33 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
34 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
35 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
36 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
37 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
38 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
39 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
40 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
41 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
42 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
43 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
44 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
45 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
46 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
47 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
48 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
49 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
50 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
51 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
52 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
53 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
54 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
55 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
56 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
69 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
92 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
93 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
94 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
95 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
102 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
105 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
108 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
109 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
111 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
113 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
115 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
116 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
138 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
139 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
140 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
141 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
142 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
143 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
144 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
145 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
146 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
147 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
150 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
151 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
152 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
153 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
154 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
155 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
156 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
157 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
158 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
159 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
160 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
161 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
162 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
163 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
164 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
165 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
166 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
167 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
168 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
169 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
170 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
171 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
172 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
173 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
174 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
175 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
176 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
177 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
178 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
179 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
180 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
181 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
182 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
183 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
184 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
185 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
186 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
187 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
188 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
189 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
190 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
191 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
192 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
193 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
194 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
195 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
196 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
197 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
198 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
199 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
200 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
201 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
202 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
203 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
204 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
205 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
206 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
207 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
208 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
209 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
210 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
211 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
212 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
213 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
214 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
215 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
223 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
225 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
226 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
227 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
228 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
229 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
230 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
231 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
232 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
233 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
234 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
235 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
236 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
237 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
238 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
239 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
240 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
241 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
242 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
243 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
244 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
245 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
246 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.95
Metatranscriptomes 0
Isolates 4.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 33.64
Nodule 0
Rhizoplane 0.93
Rhizosphere 56.07
Stem 0
Stem Tuber 0
Unclassified 9.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10001109 3300001979 Bacteria 12163
2 JGI25152J39213_1004952 3300002773 Bacteria 4033
3 JGI25150J39212_1000738 3300002774 Bacteria 11596
4 JGI25159J45721_1015873 3300002987 Bacteria 1630
5 JGI25151J46595_10000304 3300003187 Bacteria 53759
6 JGI25151J46595_10000631 3300003187 Bacteria 30567
7 JGI25151J46595_10013646 3300003187 Bacteria 3649
8 JGI25406J46586_10011662 3300003203 Bacteria 3846
9 JGI25153J46596_10012534 3300003215 Bacteria 3649
10 rootL2_10087160 3300003322 Bacteria 1407
11 rootH1_10019449 3300003316 Bacteria 4512
12 rootH1_10019449 3300003323 Bacteria 7798
13 JGI25160J50197_1008792 3300003354 Bacteria 3814
14 JGI25160J50197_1016391 3300003354 Bacteria 2389
15 JGI25161J50226_1002896 3300003374 Bacteria 4172
16 JGI25161J50226_1006665 3300003374 Bacteria 2057
17 Ga0055538_1002855 3300003751 Bacteria 2364
18 Ga0055539_1000293 3300003752 Bacteria 27556
19 Ga0055533_1003421 3300003756 Bacteria 3196
20 Ga0055532_1004310 3300003758 Bacteria 2179
21 Ga0055525_1000353 3300003759 Bacteria 32699
22 Ga0055527_1009930 3300003760 Bacteria 1106
23 Ga0055535_1000790 3300003761 Bacteria 23053
24 Ga0055542_1000091 3300003762 Bacteria 121973
25 Ga0055526_1020163 3300003771 Bacteria 2389
26 Ga0055537_1008385 3300003773 Bacteria 2389
27 Ga0055524_1010639 3300003775 Bacteria 3649
28 Ga0055524_1012615 3300003775 Bacteria 3232
29 Ga0055536_1003400 3300003781 Bacteria 8564
30 Ga0055536_1008150 3300003781 Bacteria 4560
31 Ga0055534_1006831 3300003784 Bacteria 2814
32 Ga0055528_1018221 3300003790 Bacteria 2389
33 Ga0055530_10003271 3300003791 Bacteria 9425
34 Ga0055540_1002696 3300003792 Bacteria 9150
35 Ga0055540_1007989 3300003792 Bacteria 3883
36 Ga0055540_1012350 3300003792 Bacteria 2687
37 Ga0055531_10003230 3300003794 Bacteria 10457
38 Ga0055531_10004103 3300003794 Bacteria 9004
39 Ga0055541_1004981 3300003841 Bacteria 2364
40 Ga0055543_1002629 3300004625 Bacteria 5789
41 Ga0065165_1001504 3300005262 Bacteria 24661
42 Ga0065165_1006978 3300005262 Bacteria 5721
43 Ga0065165_1015461 3300005262 Bacteria 2907
44 Ga0065165_1039141 3300005262 Bacteria 1422
45 Ga0070658_10184382 3300005327 Bacteria 1757
46 Ga0068869_100353021 3300005334 Bacteria 1199
47 Ga0070682_100220278 3300005337 Bacteria 1350
48 Ga0068868_100054598 3300005338 Bacteria 3149
49 Ga0068868_100225347 3300005338 Bacteria 1571
50 Ga0070660_100676165 3300005339 Bacteria 865
51 Ga0070661_100000708 3300005344 Bacteria 24429
52 Ga0070714_100443137 3300005435 Bacteria 1233
53 Ga0070663_100000336 3300005455 Bacteria 24425
54 Ga0070663_100349351 3300005455 Bacteria 1197
55 Ga0070663_100406310 3300005455 Bacteria 1114
56 Ga0070706_100354056 3300005467 Bacteria 1368
57 Ga0070707_100114199 3300005468 Bacteria 2620
58 Ga0070707_100136749 3300005468 Bacteria 2384
59 Ga0070698_100250603 3300005471 Bacteria 1703
60 Ga0070699_100227332 3300005518 Bacteria 1663
61 Ga0070679_100001782 3300005530 Bacteria 19408
62 Ga0070679_100031023 3300005530 Bacteria 5281
63 Ga0070697_100028908 3300005536 Bacteria 4442
64 Ga0068853_100018440 3300005539 Bacteria 5776
65 Ga0068853_100046001 3300005539 Bacteria 3741
66 Ga0070665_100341382 3300005548 Bacteria 1502
67 Ga0068855_100009496 3300005563 Bacteria 11746
68 Ga0070664_100000787 3300005564 Bacteria 24429
69 Ga0068857_100145237 3300005577 Bacteria 2146
70 Ga0068856_100032611 3300005614 Bacteria 5100
71 Ga0068856_100045005 3300005614 Bacteria 4344
72 Ga0068851_10012181 3300005834 Bacteria 4050
73 Ga0081539_10009538 3300005985 Bacteria 8082
74 Ga0070717_10274948 3300006028 Bacteria 1492
75 Ga0075363_100241225 3300006048 Bacteria 1039
76 Ga0075367_10002266 3300006178 Bacteria 8713
77 Ga0075428_100197372 3300006844 Bacteria 2176
78 Ga0075430_100008303 3300006846 Bacteria 8770
79 Ga0075431_100291743 3300006847 Bacteria 1650
80 Ga0075434_100349937 3300006871 Bacteria 1498
81 Ga0075429_100109245 3300006880 Bacteria 2417
82 Ga0105240_10384504 3300009093 Bacteria 1584
83 Ga0111539_11050183 3300009094 Bacteria 947
84 Ga0114129_10328158 3300009147 Bacteria 2032
85 Ga0114129_10426696 3300009147 Bacteria 1743
86 Ga0114129_10704609 3300009147 Bacteria 1297
87 Ga0105243_10164967 3300009148 Bacteria 1913
88 Ga0105241_10069330 3300009174 Bacteria 2734
89 Ga0105248_10274935 3300009177 Bacteria 1896
90 Ga0105237_10512747 3300009545 Bacteria 1206
91 Ga0105238_10049656 3300009551 Bacteria 4224
92 Ga0105238_10389697 3300009551 Bacteria 1385
93 Ga0105246_10019649 3300011119 Bacteria 4321
94 Ga0157371_10001472 3300013102 Bacteria 24434
95 Ga0157370_10005146 3300013104 Bacteria 14747
96 Ga0157370_10255948 3300013104 Bacteria 1619
97 Ga0157378_10025552 3300013297 Bacteria 5200
98 Ga0157372_10001617 3300013307 Bacteria 24435
99 Ga0157372_10206580 3300013307 Bacteria 2276
100 Ga0182008_10000576 3300014497 Bacteria 27046
101 Ga0182008_10002387 3300014497 Bacteria 11802
102 Ga0157377_10000100 3300014745 Bacteria 60781
103 Ga0157376_10038135 3300014969 Bacteria 3907
104 Ga0182007_10053945 3300015262 Bacteria 1323
105 Ga0213872_10050815 3300021361 Bacteria 1881
106 Ga0209436_101447 3300025208 Bacteria 8292
107 Ga0209436_110595 3300025208 Bacteria 1675
108 Ga0209784_101225 3300025224 Bacteria 3866
109 Ga0209566_100018 3300025225 Bacteria 448638
110 Ga0209674_100046 3300025226 Bacteria 357920
111 Ga0209672_101506 3300025228 Bacteria 8098
112 Ga0209147_100347 3300025229 Bacteria 33903
113 Ga0209563_100039 3300025230 Bacteria 409717
114 Ga0209258_100143 3300025242 Bacteria 165551
115 Ga0207425_1000414 3300025245 Bacteria 28762
116 Ga0209677_100024 3300025253 Bacteria 406035
117 Ga0209148_1000007 3300025254 Bacteria 1592273
118 Ga0209129_1000084 3300025258 Bacteria 182554
119 Ga0209129_1000414 3300025258 Bacteria 33160
120 Ga0209129_1004784 3300025258 Bacteria 5115
121 Ga0209129_1008510 3300025258 Bacteria 2845
122 Ga0209565_1000285 3300025263 Bacteria 49572
123 Ga0209565_1000745 3300025263 Bacteria 19237
124 Ga0209673_1001172 3300025273 Bacteria 28386
125 Ga0209673_1002099 3300025273 Bacteria 14969
126 Ga0209130_1000323 3300025284 Bacteria 56069
127 Ga0209130_1001159 3300025284 Bacteria 19065
128 Ga0209675_1000998 3300025291 Bacteria 17817
129 Ga0209675_1009362 3300025291 Bacteria 3470
130 Ga0209676_1002753 3300025292 Bacteria 11771
131 Ga0209676_1003792 3300025292 Bacteria 8942
132 Ga0209025_1000446 3300025294 Bacteria 80985
133 Ga0209025_1000521 3300025294 Bacteria 73251
134 Ga0209025_1002529 3300025294 Bacteria 19121
135 Ga0209025_1018905 3300025294 Bacteria 3870
136 Ga0209564_1000108 3300025295 Bacteria 213699
137 Ga0209564_1000357 3300025295 Bacteria 85402
138 Ga0209758_1000184 3300025297 Bacteria 140021
139 Ga0209758_1013317 3300025297 Bacteria 4497
140 Ga0209050_1001113 3300025298 Bacteria 32509
141 Ga0209256_1000101 3300025299 Bacteria 200246
142 Ga0209256_1000156 3300025299 Bacteria 144277
143 Ga0207426_1000049 3300025302 Bacteria 401954
144 Ga0207426_1000086 3300025302 Bacteria 292089
145 Ga0207426_1001811 3300025302 Bacteria 15849
146 Ga0209051_1002994 3300025303 Bacteria 11485
147 Ga0209051_1008020 3300025303 Bacteria 5659
148 Ga0209051_1013470 3300025303 Bacteria 3890
149 Ga0209257_1000411 3300025304 Bacteria 83024
150 Ga0209257_1004904 3300025304 Bacteria 9863
151 Ga0207656_10023667 3300025321 Bacteria 2476
152 Ga0207684_10348841 3300025910 Bacteria 1274
153 Ga0207654_10180648 3300025911 Bacteria 1376
154 Ga0207707_10003390 3300025912 Bacteria 14143
155 Ga0207695_10087903 3300025913 Bacteria 3130
156 Ga0207695_10397178 3300025913 Bacteria 1263
157 Ga0207660_10069687 3300025917 Bacteria 2554
158 Ga0207649_10000075 3300025920 Bacteria 83915
159 Ga0207652_10201427 3300025921 Bacteria 1791
160 Ga0207646_10116368 3300025922 Bacteria 2401
161 Ga0207646_10366288 3300025922 Bacteria 1302
162 Ga0207687_10129798 3300025927 Bacteria 1897
163 Ga0207664_10061112 3300025929 Bacteria 3005
164 Ga0207709_10044926 3300025935 Bacteria 2672
165 Ga0207711_10405027 3300025941 Bacteria 1268
166 Ga0207689_10360886 3300025942 Bacteria 1208
167 Ga0207679_10000267 3300025945 Bacteria 39861
168 Ga0207667_10498162 3300025949 Bacteria 1236
169 Ga0207677_10031899 3300026023 Bacteria 3379
170 Ga0207678_10001137 3300026067 Bacteria 24387
171 Ga0207678_10325704 3300026067 Bacteria 1322
172 Ga0207702_10001353 3300026078 Bacteria 24432
173 Ga0207702_10063319 3300026078 Bacteria 3162
174 Ga0209813_10017188 3300027866 Bacteria 1983
175 Ga0265326_10000003 3300028558 Bacteria 479811
176 Ga0265334_10000917 3300028573 Bacteria 14711
177 Ga0307515_10011478 3300028794 Bacteria 16813
178 Ga0307515_10099308 3300028794 Bacteria 3535
179 Ga0265338_10001882 3300028800 Bacteria 32873
180 Ga0307512_10125069 3300030522 Bacteria 1636
181 Ga0265339_10099189 3300031249 Bacteria 1518
182 Ga0265331_10010146 3300031250 Bacteria 5230
183 Ga0265327_10051024 3300031251 Bacteria 2162
184 Ga0307513_10000094 3300031456 Bacteria 127685
185 Ga0307513_10244090 3300031456 Bacteria 1598
186 Ga0307509_10070979 3300031507 Bacteria 3635
187 Ga0307509_10166801 3300031507 Bacteria 2089
188 Ga0307408_100019236 3300031548 Bacteria 4595
189 Ga0307408_100056348 3300031548 Bacteria 2850
190 Ga0307508_10000212 3300031616 Bacteria 70345
191 Ga0307514_10069928 3300031649 Bacteria 2638
192 Ga0265314_10000645 3300031711 Bacteria 42759
193 Ga0265314_10182582 3300031711 Bacteria 1256
194 Ga0265342_10111802 3300031712 Bacteria 1545
195 Ga0307516_10011996 3300031730 Bacteria 9368
196 Ga0307516_10096941 3300031730 Bacteria 2769
197 Ga0307516_10320158 3300031730 Bacteria 1222
198 Ga0307405_10031223 3300031731 Bacteria 3133
199 Ga0307413_10393673 3300031824 Bacteria 1083
200 Ga0307410_10005115 3300031852 Bacteria 6897
201 Ga0307406_10018581 3300031901 Bacteria 4064
202 Ga0307407_10007543 3300031903 Bacteria 4933
203 Ga0307409_100073609 3300031995 Bacteria 2726
204 Ga0307416_100193044 3300032002 Bacteria 1923
205 Ga0307414_10262425 3300032004 Bacteria 1442
206 Ga0307507_10049448 3300033179 Bacteria 4073
207 Ga0307507_10069226 3300033179 Unclassified 3213
208 Ga0395899_0028353 3300037312 Bacteria 4217
209 Ga0436360_0683138 3300039438 Bacteria 1063
210 Ga0436361_0607447 3300039447 Bacteria 8083
211 Ga0439436_0003725 3300041404 Bacteria 4652
212 Ga0439466_0031756 3300041411 Bacteria 1804
213 Ga0451837_1280379 3300041494 Bacteria 3137
214 Ga0439431_0055975 3300041997 Bacteria 1031
215 Ga0439442_003294 3300042002 Bacteria 3191
216 Ga0450894_007607 3300042131 Bacteria 1399
217 Ga0450906_005886 3300042145 Bacteria 2500
218 Ga0450908_007744 3300042184 Bacteria 2020
219 Ga0439434_0016131 3300042435 Bacteria 2231
220 Ga0439460_0003494 3300042461 Bacteria 3799
221 Ga0451577_0121030 3300042876 Unclassified 2344
222 Ga0466969_0002649 3300044656 Bacteria 9563
223 Ga0466969_0066745 3300044656 Bacteria 1736
224 Ga0466965_0053615 3300044683 Bacteria 2004
225 Ga0466966_0013966 3300044684 Bacteria 5317
226 Ga0466961_0085035 3300044693 Bacteria 2000
227 Ga0466961_0115846 3300044693 Bacteria 1684
228 Ga0466963_0095218 3300044694 Bacteria 2032
229 Ga0466963_0301419 3300044694 Bacteria 1127
230 Ga0466964_0015654 3300044706 Bacteria 2887
231 Ga0466971_0029433 3300044719 Bacteria 2456
232 Ga0466970_0050739 3300044765 Bacteria 2213
233 Ga0466957_0009483 3300044842 Bacteria 5558
234 Ga0466959_0015553 3300045049 Bacteria 5546
235 Ga0466959_0172310 3300045049 Bacteria 1517
236 Ga0451576_0000390 3300045051 Bacteria 102401
237 Ga0451576_0216027 3300045051 Bacteria 2002
238 Ga0466958_0086974 3300045836 Bacteria 1929
239 Ga0466958_0183364 3300045836 Bacteria 1328
240 Ga0495603_0317252 3300046455 Bacteria 895
241 Ga0495653_0000408 3300046463 Bacteria 34435
242 Ga0495605_0070966 3300046474 Bacteria 1646
243 Ga0495639_0083158 3300046475 Bacteria 1493
244 Ga0495639_0159048 3300046475 Bacteria 1093
245 Ga0495584_0004003 3300046491 Bacteria 7952
246 Ga0495616_0011595 3300046513 Bacteria 5043
247 Ga0495630_0000072 3300046517 Bacteria 79669
248 Ga0495643_0019164 3300046522 Bacteria 3963
249 Ga0495640_0173315 3300046533 Bacteria 1378
250 Ga0495597_0085788 3300046542 Bacteria 1341
251 Ga0495645_0000811 3300046543 Bacteria 21359
252 Ga0495622_0153421 3300046557 Bacteria 1041
253 Ga0495668_0060049 3300046616 Bacteria 2098
254 Ga0495659_0004894 3300046664 Bacteria 4218
255 Ga0495661_0014850 3300046665 Bacteria 5209
256 Ga0495588_0004190 3300046674 Bacteria 6358
257 Ga0495657_0000683 3300046675 Bacteria 30438
258 Ga0495636_0037731 3300047318 Bacteria 1996
259 Ga0495672_0013349 3300047320 Bacteria 5672
260 Ga0495684_0002281 3300047471 Bacteria 15358
261 Ga0496102_0390099 3300048905 Bacteria 1310
262 Ga0496108_0007324 3300048911 Bacteria 8944
263 Ga0496110_0002105 3300048913 Bacteria 14853
264 Ga0496119_0052678 3300048922 Bacteria 2491
265 Ga0496121_0077093 3300048924 Bacteria 2655
266 Ga0496126_0007657 3300048929 Bacteria 11787
267 Ga0501033_0000923 3300049570 Bacteria 26860
268 Ga0501034_0036329 3300049571 Bacteria 4991
269 Ga0501036_0017630 3300049572 Bacteria 5974
270 Ga0501038_0012588 3300049574 Bacteria 7731
271 Ga0501039_0042526 3300049575 Bacteria 3510
272 Ga0501043_0096915 3300049579 Bacteria 2319
273 Ga0501047_0022590 3300049581 Bacteria 6040
274 Ga0501068_0163845 3300049584 Bacteria 1402
275 Ga0501035_0001082 3300049822 Bacteria 28545
276 Ga0501035_0431873 3300049822 Bacteria 1092
277 Ga0501044_0001703 3300049823 Bacteria 25803
278 Ga0501044_0190843 3300049823 Bacteria 2012
279 nmdc:mga03n38_15071_c1 3300050490 Bacteria 2978
280 nmdc:mga0k408_178812_c1 3300050493 Bacteria 1265
281 nmdc:mga06z11_155291_c1 3300050494 Bacteria 1304
282 nmdc:mga06z11_374_c1 3300050494 Bacteria 16845
283 nmdc:mga07m45_21019_c1 3300050496 Bacteria 3550
284 nmdc:mga07m45_56968_c1 3300050496 Bacteria 2209
285 nmdc:mga05p37_210645_c1 3300050507 Bacteria 2350
286 nmdc:mga05p37_729604_c1 3300050507 Bacteria 1096
287 nmdc:mga0qj67_6258_c1 3300050509 Bacteria 8733
288 nmdc:mga06r32_251726_c1 3300050510 Bacteria 1754
289 nmdc:mga0n895_309704_c1 3300050512 Bacteria 1600
290 nmdc:mga0a205_560914_c1 3300050515 Bacteria 997
291 Ga0495595_0053809 3300053084 Bacteria 1871
292 Ga0500644_0001426 3300053088 Bacteria 6340
293 Ga0500651_0022738 3300053093 Bacteria 3919
294 Ga0500566_0029852 3300053094 Bacteria 3183
295 Ga0500566_0081877 3300053094 Bacteria 1795
296 Ga0500566_0182527 3300053094 Bacteria 1075
297 Ga0500595_000198 3300053119 Bacteria 41024
298 Ga0500595_000658 3300053119 Bacteria 20744
299 Ga0500595_001530 3300053119 Bacteria 12274
300 Ga0500559_0047641 3300053136 Bacteria 1883
301 Ga0500564_142702 3300053138 Bacteria 1027
302 Ga0500586_046671 3300053145 Bacteria 1486
303 Ga0500616_0018764 3300053153 Bacteria 3907
304 Ga0500637_0000722 3300053178 Bacteria 13182
305 Ga0500645_005704 3300053730 Bacteria 4536
306 Ga0500552_000706 3300053733 Bacteria 3104
307 Ga0466962_0010444 3300061719 Bacteria 4463
308 Ga0466962_0092008 3300061719 Bacteria 1454
309 Ga0466962_0186952 3300061719 Bacteria 1010

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046533 Ga0495640_0173315 Ga0495640_0173315_572_1270 230
2 3300053138 Ga0500564_142702 Ga0500564_142702_286_1002 233
3 3300047320 Ga0495672_0013349 Ga0495672_0013349_2241_3128 256
4 3300005334 Ga0068869_100353021 Ga0068869_1003530212 264
5 3300014745 Ga0157377_10000100 Ga0157377_100001009 264
6 3300025942 Ga0207689_10360886 Ga0207689_103608862 264
7 3300053119 Ga0500595_000198 Ga0500595_000198_3808_4611 264
8 3300005577 Ga0068857_100145237 Ga0068857_1001452374 265
9 3300009094 Ga0111539_11050183 Ga0111539_110501831 265
10 3300009148 Ga0105243_10164967 Ga0105243_101649672 265
11 3300011119 Ga0105246_10019649 Ga0105246_100196492 265
12 3300014497 Ga0182008_10002387 Ga0182008_1000238710 265
13 3300025263 Ga0209565_1000745 Ga0209565_10007453 265
14 3300031250 Ga0265331_10010146 Ga0265331_100101463 265
15 3300031711 Ga0265314_10000645 Ga0265314_1000064522 265
16 3300031712 Ga0265342_10111802 Ga0265342_101118021 265
17 3300031824 Ga0307413_10393673 Ga0307413_103936732 265
18 3300031852 Ga0307410_10005115 Ga0307410_100051157 265
19 3300031903 Ga0307407_10007543 Ga0307407_100075431 265
20 3300031995 Ga0307409_100073609 Ga0307409_1000736092 265
21 3300032002 Ga0307416_100193044 Ga0307416_1001930442 265
22 3300032004 Ga0307414_10262425 Ga0307414_102624251 265
23 3300041494 Ga0451837_1280379 Ga0451837_1280379_504_1319 265
24 3300044694 Ga0466963_0095218 Ga0466963_0095218_1170_1982 265
25 3300046474 Ga0495605_0070966 Ga0495605_0070966_703_1506 265
26 3300046522 Ga0495643_0019164 Ga0495643_0019164_487_1290 265
27 3300046542 Ga0495597_0085788 Ga0495597_0085788_454_1257 265
28 3300046616 Ga0495668_0060049 Ga0495668_0060049_827_1630 265
29 3300046664 Ga0495659_0004894 Ga0495659_0004894_2469_3275 265
30 3300046665 Ga0495661_0014850 Ga0495661_0014850_2701_3504 265
31 3300047318 Ga0495636_0037731 Ga0495636_0037731_678_1484 265
32 3300049570 Ga0501033_0000923 Ga0501033_0000923_23772_24593 265
33 3300049571 Ga0501034_0036329 Ga0501034_0036329_656_1477 265
34 3300049572 Ga0501036_0017630 Ga0501036_0017630_2333_3154 265
35 3300049574 Ga0501038_0012588 Ga0501038_0012588_2136_2957 265
36 3300049575 Ga0501039_0042526 Ga0501039_0042526_1336_2157 265
37 3300049579 Ga0501043_0096915 Ga0501043_0096915_330_1151 265
38 3300049581 Ga0501047_0022590 Ga0501047_0022590_2244_3065 265
39 3300049822 Ga0501035_0001082 Ga0501035_0001082_2393_3214 265
40 3300049823 Ga0501044_0001703 Ga0501044_0001703_3854_4675 265
41 3300050493 nmdc:mga0k408_178812_c1 nmdc:mga0k408_178812_c1_245_1057 265
42 3300050494 nmdc:mga06z11_155291_c1 nmdc:mga06z11_155291_c1_215_1027 265
43 3300050496 nmdc:mga07m45_21019_c1 nmdc:mga07m45_21019_c1_2540_3349 265
44 3300053094 Ga0500566_0029852 Ga0500566_0029852_2060_2863 265
45 3300053119 Ga0500595_000658 Ga0500595_000658_19606_20409 265
46 3300053136 Ga0500559_0047641 Ga0500559_0047641_587_1390 265
47 3300053178 Ga0500637_0000722 Ga0500637_0000722_8995_9798 265
48 3300053733 Ga0500552_000706 Ga0500552_000706_271_1083 265
49 3300005338 Ga0068868_100225347 Ga0068868_1002253471 266
50 3300009147 Ga0114129_10426696 Ga0114129_104266962 266
51 3300031507 Ga0307509_10166801 Ga0307509_101668012 266
52 3300047471 Ga0495684_0002281 Ga0495684_0002281_13239_14063 266
53 iso_pu_bacteria 2643221672 2644400852 266
54 3300009545 Ga0105237_10512747 Ga0105237_105127472 267
55 3300046455 Ga0495603_0317252 Ga0495603_0317252_35_850 267
56 iso_pu_bacteria 2511231002 2511245703 267
57 iso_pu_bacteria 2643221658 2644325762 267
58 iso_pu_bacteria 2738543005 2739202460 267
59 iso_pu_bacteria 2818991446 2819602645 267
60 iso_pu_bacteria 2899924645 2899927125 267
61 iso_pu_bacteria 2904541872 2904545997 267
62 iso_pu_bacteria 2928037797 2928043973 267
63 iso_pu_bacteria 2928044640 2928048621 267
64 iso_pu_bacteria 2928051484 2928054944 267
65 iso_pu_bacteria 2928064002 2928068383 267
66 iso_pu_bacteria 2928142448 2928143324 267
67 iso_pu_bacteria 2929160207 2929161191 267
68 3300005455 Ga0070663_100349351 Ga0070663_1003493511 268
69 3300005539 Ga0068853_100018440 Ga0068853_1000184403 268
70 3300005548 Ga0070665_100341382 Ga0070665_1003413821 268
71 3300026067 Ga0207678_10325704 Ga0207678_103257041 268
72 3300031730 Ga0307516_10320158 Ga0307516_103201582 268
73 3300037312 Ga0395899_0028353 Ga0395899_0028353_1082_1927 268
74 3300053094 Ga0500566_0081877 Ga0500566_0081877_544_1368 268
75 3300061719 Ga0466962_0092008 Ga0466962_0092008_87_908 268
76 3300003791 Ga0055530_10003271 Ga0055530_100032716 269
77 3300005262 Ga0065165_1001504 Ga0065165_100150423 269
78 3300046475 Ga0495639_0083158 Ga0495639_0083158_400_1218 269
79 3300046674 Ga0495588_0004190 Ga0495588_0004190_4261_5100 269
80 3300002773 JGI25152J39213_1004952 JGI25152J39213_10049525 270
81 3300002774 JGI25150J39212_1000738 JGI25150J39212_100073810 270
82 3300002987 JGI25159J45721_1015873 JGI25159J45721_10158732 270
83 3300003187 JGI25151J46595_10000304 JGI25151J46595_1000030426 270
84 3300003187 JGI25151J46595_10000631 JGI25151J46595_100006316 270
85 3300003187 JGI25151J46595_10013646 JGI25151J46595_100136462 270
86 3300003203 JGI25406J46586_10011662 JGI25406J46586_100116624 270
87 3300003215 JGI25153J46596_10012534 JGI25153J46596_100125342 270
88 3300003322 rootL2_10087160 rootL2_100871601 270
89 3300003323 rootH1_10019449 rootH1_1001944911 270
90 3300003354 JGI25160J50197_1008792 JGI25160J50197_10087921 270
91 3300003354 JGI25160J50197_1016391 JGI25160J50197_10163912 270
92 3300003374 JGI25161J50226_1002896 JGI25161J50226_10028962 270
93 3300003374 JGI25161J50226_1006665 JGI25161J50226_10066652 270
94 3300003758 Ga0055532_1004310 Ga0055532_10043102 270
95 3300003760 Ga0055527_1009930 Ga0055527_10099302 270
96 3300003761 Ga0055535_1000790 Ga0055535_10007909 270
97 3300003762 Ga0055542_1000091 Ga0055542_100009194 270
98 3300003771 Ga0055526_1020163 Ga0055526_10201632 270
99 3300003773 Ga0055537_1008385 Ga0055537_10083852 270
100 3300003775 Ga0055524_1010639 Ga0055524_10106392 270
101 3300003775 Ga0055524_1012615 Ga0055524_10126152 270
102 3300003781 Ga0055536_1003400 Ga0055536_10034004 270
103 3300003781 Ga0055536_1008150 Ga0055536_10081504 270
104 3300003784 Ga0055534_1006831 Ga0055534_10068314 270
105 3300003790 Ga0055528_1018221 Ga0055528_10182212 270
106 3300003792 Ga0055540_1002696 Ga0055540_10026964 270
107 3300003792 Ga0055540_1007989 Ga0055540_10079895 270
108 3300003792 Ga0055540_1012350 Ga0055540_10123503 270
109 3300003794 Ga0055531_10003230 Ga0055531_100032306 270
110 3300003794 Ga0055531_10004103 Ga0055531_100041037 270
111 3300004625 Ga0055543_1002629 Ga0055543_10026292 270
112 3300005262 Ga0065165_1006978 Ga0065165_10069786 270
113 3300005262 Ga0065165_1015461 Ga0065165_10154613 270
114 3300005262 Ga0065165_1039141 Ga0065165_10391412 270
115 3300005327 Ga0070658_10184382 Ga0070658_101843823 270
116 3300005338 Ga0068868_100054598 Ga0068868_1000545982 270
117 3300005339 Ga0070660_100676165 Ga0070660_1006761651 270
118 3300005455 Ga0070663_100406310 Ga0070663_1004063101 270
119 3300005468 Ga0070707_100136749 Ga0070707_1001367493 270
120 3300005530 Ga0070679_100001782 Ga0070679_10000178211 270
121 3300005530 Ga0070679_100031023 Ga0070679_1000310234 270
122 3300005539 Ga0068853_100046001 Ga0068853_1000460015 270
123 3300005563 Ga0068855_100009496 Ga0068855_1000094962 270
124 3300005614 Ga0068856_100045005 Ga0068856_1000450054 270
125 3300005834 Ga0068851_10012181 Ga0068851_100121815 270
126 3300005985 Ga0081539_10009538 Ga0081539_100095384 270
127 3300006048 Ga0075363_100241225 Ga0075363_1002412251 270
128 3300006178 Ga0075367_10002266 Ga0075367_100022663 270
129 3300006844 Ga0075428_100197372 Ga0075428_1001973723 270
130 3300006880 Ga0075429_100109245 Ga0075429_1001092452 270
131 3300009147 Ga0114129_10328158 Ga0114129_103281582 270
132 3300009177 Ga0105248_10274935 Ga0105248_102749353 270
133 3300009551 Ga0105238_10049656 Ga0105238_100496562 270
134 3300009551 Ga0105238_10389697 Ga0105238_103896971 270
135 3300013104 Ga0157370_10005146 Ga0157370_1000514616 270
136 3300013104 Ga0157370_10255948 Ga0157370_102559482 270
137 3300013297 Ga0157378_10025552 Ga0157378_100255525 270
138 3300013307 Ga0157372_10206580 Ga0157372_102065802 270
139 3300015262 Ga0182007_10053945 Ga0182007_100539452 270
140 3300021361 Ga0213872_10050815 Ga0213872_100508151 270
141 3300025208 Ga0209436_101447 Ga0209436_1014475 270
142 3300025208 Ga0209436_110595 Ga0209436_1105952 270
143 3300025228 Ga0209672_101506 Ga0209672_1015066 270
144 3300025229 Ga0209147_100347 Ga0209147_10034716 270
145 3300025242 Ga0209258_100143 Ga0209258_10014316 270
146 3300025245 Ga0207425_1000414 Ga0207425_100041424 270
147 3300025254 Ga0209148_1000007 Ga0209148_10000071361 270
148 3300025258 Ga0209129_1000084 Ga0209129_1000084140 270
149 3300025258 Ga0209129_1000414 Ga0209129_100041426 270
150 3300025258 Ga0209129_1004784 Ga0209129_10047845 270
151 3300025258 Ga0209129_1008510 Ga0209129_10085103 270
152 3300025263 Ga0209565_1000285 Ga0209565_10002857 270
153 3300025273 Ga0209673_1001172 Ga0209673_10011727 270
154 3300025273 Ga0209673_1002099 Ga0209673_10020994 270
155 3300025284 Ga0209130_1000323 Ga0209130_100032321 270
156 3300025284 Ga0209130_1001159 Ga0209130_10011597 270
157 3300025291 Ga0209675_1000998 Ga0209675_10009987 270
158 3300025291 Ga0209675_1009362 Ga0209675_10093622 270
159 3300025292 Ga0209676_1002753 Ga0209676_10027538 270
160 3300025292 Ga0209676_1003792 Ga0209676_10037924 270
161 3300025294 Ga0209025_1000446 Ga0209025_100044653 270
162 3300025294 Ga0209025_1000521 Ga0209025_100052112 270
163 3300025294 Ga0209025_1002529 Ga0209025_10025296 270
164 3300025294 Ga0209025_1018905 Ga0209025_10189053 270
165 3300025295 Ga0209564_1000108 Ga0209564_1000108135 270
166 3300025295 Ga0209564_1000357 Ga0209564_100035739 270
167 3300025297 Ga0209758_1000184 Ga0209758_1000184102 270
168 3300025297 Ga0209758_1013317 Ga0209758_10133173 270
169 3300025298 Ga0209050_1001113 Ga0209050_100111325 270
170 3300025299 Ga0209256_1000101 Ga0209256_100010123 270
171 3300025299 Ga0209256_1000156 Ga0209256_100015694 270
172 3300025302 Ga0207426_1000049 Ga0207426_100004944 270
173 3300025302 Ga0207426_1000086 Ga0207426_1000086153 270
174 3300025302 Ga0207426_1001811 Ga0207426_10018115 270
175 3300025303 Ga0209051_1002994 Ga0209051_10029948 270
176 3300025303 Ga0209051_1008020 Ga0209051_10080206 270
177 3300025303 Ga0209051_1013470 Ga0209051_10134702 270
178 3300025304 Ga0209257_1000411 Ga0209257_100041158 270
179 3300025304 Ga0209257_1004904 Ga0209257_10049046 270
180 3300025321 Ga0207656_10023667 Ga0207656_100236671 270
181 3300025912 Ga0207707_10003390 Ga0207707_1000339013 270
182 3300025913 Ga0207695_10087903 Ga0207695_100879033 270
183 3300025917 Ga0207660_10069687 Ga0207660_100696872 270
184 3300025921 Ga0207652_10201427 Ga0207652_102014272 270
185 3300025922 Ga0207646_10116368 Ga0207646_101163681 270
186 3300025935 Ga0207709_10044926 Ga0207709_100449263 270
187 3300025941 Ga0207711_10405027 Ga0207711_104050271 270
188 3300025949 Ga0207667_10498162 Ga0207667_104981621 270
189 3300026023 Ga0207677_10031899 Ga0207677_100318994 270
190 3300026078 Ga0207702_10063319 Ga0207702_100633194 270
191 3300027866 Ga0209813_10017188 Ga0209813_100171882 270
192 3300028558 Ga0265326_10000003 Ga0265326_1000000395 270
193 3300028573 Ga0265334_10000917 Ga0265334_100009177 270
194 3300028794 Ga0307515_10011478 Ga0307515_1001147815 270
195 3300028794 Ga0307515_10099308 Ga0307515_100993083 270
196 3300028800 Ga0265338_10001882 Ga0265338_100018826 270
197 3300030522 Ga0307512_10125069 Ga0307512_101250692 270
198 3300031249 Ga0265339_10099189 Ga0265339_100991892 270
199 3300031251 Ga0265327_10051024 Ga0265327_100510242 270
200 3300031456 Ga0307513_10000094 Ga0307513_10000094109 270
201 3300031456 Ga0307513_10244090 Ga0307513_102440902 270
202 3300031507 Ga0307509_10070979 Ga0307509_100709793 270
203 3300031548 Ga0307408_100019236 Ga0307408_1000192363 270
204 3300031548 Ga0307408_100056348 Ga0307408_1000563483 270
205 3300031616 Ga0307508_10000212 Ga0307508_1000021237 270
206 3300031649 Ga0307514_10069928 Ga0307514_100699282 270
207 3300031711 Ga0265314_10182582 Ga0265314_101825822 270
208 3300031730 Ga0307516_10011996 Ga0307516_100119965 270
209 3300031730 Ga0307516_10096941 Ga0307516_100969413 270
210 3300031731 Ga0307405_10031223 Ga0307405_100312233 270
211 3300031901 Ga0307406_10018581 Ga0307406_100185812 270
212 3300033179 Ga0307507_10049448 Ga0307507_100494482 270
213 3300033179 Ga0307507_10069226 Ga0307507_100692262 270
214 3300039438 Ga0436360_0683138 Ga0436360_0683138_89_913 270
215 3300039447 Ga0436361_0607447 Ga0436361_0607447_3939_4781 270
216 3300041404 Ga0439436_0003725 Ga0439436_0003725_1726_2580 270
217 3300041411 Ga0439466_0031756 Ga0439466_0031756_949_1779 270
218 3300041997 Ga0439431_0055975 Ga0439431_0055975_128_958 270
219 3300042002 Ga0439442_003294 Ga0439442_003294_1074_2018 270
220 3300042131 Ga0450894_007607 Ga0450894_007607_101_931 270
221 3300042145 Ga0450906_005886 Ga0450906_005886_1199_2029 270
222 3300042184 Ga0450908_007744 Ga0450908_007744_137_967 270
223 3300042435 Ga0439434_0016131 Ga0439434_0016131_153_1097 270
224 3300042461 Ga0439460_0003494 Ga0439460_0003494_187_1032 270
225 3300045049 Ga0466959_0015553 Ga0466959_0015553_1684_2517 270
226 3300045051 Ga0451576_0000390 Ga0451576_0000390_36749_37582 270
227 3300045836 Ga0466958_0086974 Ga0466958_0086974_1067_1900 270
228 3300046463 Ga0495653_0000408 Ga0495653_0000408_11127_11948 270
229 3300046475 Ga0495639_0159048 Ga0495639_0159048_204_1034 270
230 3300046491 Ga0495584_0004003 Ga0495584_0004003_5650_6471 270
231 3300046513 Ga0495616_0011595 Ga0495616_0011595_616_1446 270
232 3300046517 Ga0495630_0000072 Ga0495630_0000072_10744_11601 270
233 3300046543 Ga0495645_0000811 Ga0495645_0000811_8441_9259 270
234 3300046557 Ga0495622_0153421 Ga0495622_0153421_38_877 270
235 3300046675 Ga0495657_0000683 Ga0495657_0000683_15147_16004 270
236 3300048905 Ga0496102_0390099 Ga0496102_0390099_165_983 270
237 3300048911 Ga0496108_0007324 Ga0496108_0007324_3611_4435 270
238 3300048913 Ga0496110_0002105 Ga0496110_0002105_1438_2262 270
239 3300048922 Ga0496119_0052678 Ga0496119_0052678_404_1252 270
240 3300048924 Ga0496121_0077093 Ga0496121_0077093_200_1030 270
241 3300049822 Ga0501035_0431873 Ga0501035_0431873_135_959 270
242 3300049823 Ga0501044_0190843 Ga0501044_0190843_963_1787 270
243 3300050490 nmdc:mga03n38_15071_c1 nmdc:mga03n38_15071_c1_1727_2548 270
244 3300050494 nmdc:mga06z11_374_c1 nmdc:mga06z11_374_c1_8936_9757 270
245 3300050496 nmdc:mga07m45_56968_c1 nmdc:mga07m45_56968_c1_860_1681 270
246 3300050507 nmdc:mga05p37_210645_c1 nmdc:mga05p37_210645_c1_950_1774 270
247 3300053084 Ga0495595_0053809 Ga0495595_0053809_980_1798 270
248 3300053088 Ga0500644_0001426 Ga0500644_0001426_3894_4739 270
249 3300053093 Ga0500651_0022738 Ga0500651_0022738_1032_1850 270
250 3300053094 Ga0500566_0182527 Ga0500566_0182527_171_1028 270
251 3300053119 Ga0500595_001530 Ga0500595_001530_5139_5978 270
252 3300053145 Ga0500586_046671 Ga0500586_046671_524_1387 270
253 3300053153 Ga0500616_0018764 Ga0500616_0018764_794_1684 270
254 3300053730 Ga0500645_005704 Ga0500645_005704_1633_2460 270
255 3300061719 Ga0466962_0186952 Ga0466962_0186952_136_969 270
256 3300001979 JGI24740J21852_10001109 JGI24740J21852_100011097 271
257 3300003751 Ga0055538_1002855 Ga0055538_10028552 271
258 3300003752 Ga0055539_1000293 Ga0055539_100029311 271
259 3300003756 Ga0055533_1003421 Ga0055533_10034213 271
260 3300003759 Ga0055525_1000353 Ga0055525_100035311 271
261 3300003841 Ga0055541_1004981 Ga0055541_10049812 271
262 3300005337 Ga0070682_100220278 Ga0070682_1002202782 271
263 3300005344 Ga0070661_100000708 Ga0070661_1000007086 271
264 3300005435 Ga0070714_100443137 Ga0070714_1004431372 271
265 3300005455 Ga0070663_100000336 Ga0070663_1000003366 271
266 3300005467 Ga0070706_100354056 Ga0070706_1003540562 271
267 3300005468 Ga0070707_100114199 Ga0070707_1001141992 271
268 3300005471 Ga0070698_100250603 Ga0070698_1002506032 271
269 3300005518 Ga0070699_100227332 Ga0070699_1002273322 271
270 3300005536 Ga0070697_100028908 Ga0070697_1000289083 271
271 3300005564 Ga0070664_100000787 Ga0070664_10000078718 271
272 3300005614 Ga0068856_100032611 Ga0068856_1000326114 271
273 3300006028 Ga0070717_10274948 Ga0070717_102749482 271
274 3300006846 Ga0075430_100008303 Ga0075430_1000083037 271
275 3300006847 Ga0075431_100291743 Ga0075431_1002917432 271
276 3300006871 Ga0075434_100349937 Ga0075434_1003499374 271
277 3300009093 Ga0105240_10384504 Ga0105240_103845042 271
278 3300009147 Ga0114129_10704609 Ga0114129_107046092 271
279 3300009174 Ga0105241_10069330 Ga0105241_100693301 271
280 3300013102 Ga0157371_10001472 Ga0157371_1000147216 271
281 3300013307 Ga0157372_10001617 Ga0157372_1000161717 271
282 3300014497 Ga0182008_10000576 Ga0182008_1000057613 271
283 3300014969 Ga0157376_10038135 Ga0157376_100381352 271
284 3300025224 Ga0209784_101225 Ga0209784_1012254 271
285 3300025225 Ga0209566_100018 Ga0209566_100018350 271
286 3300025226 Ga0209674_100046 Ga0209674_10004613 271
287 3300025230 Ga0209563_100039 Ga0209563_10003913 271
288 3300025253 Ga0209677_100024 Ga0209677_10002411 271
289 3300025910 Ga0207684_10348841 Ga0207684_103488411 271
290 3300025911 Ga0207654_10180648 Ga0207654_101806481 271
291 3300025913 Ga0207695_10397178 Ga0207695_103971781 271
292 3300025920 Ga0207649_10000075 Ga0207649_1000007558 271
293 3300025922 Ga0207646_10366288 Ga0207646_103662881 271
294 3300025927 Ga0207687_10129798 Ga0207687_101297982 271
295 3300025929 Ga0207664_10061112 Ga0207664_100611122 271
296 3300025945 Ga0207679_10000267 Ga0207679_1000026724 271
297 3300026067 Ga0207678_10001137 Ga0207678_100011376 271
298 3300026078 Ga0207702_10001353 Ga0207702_1000135317 271
299 3300042876 Ga0451577_0121030 Ga0451577_0121030_1252_2100 271
300 3300044656 Ga0466969_0002649 Ga0466969_0002649_1407_2237 271
301 3300044656 Ga0466969_0066745 Ga0466969_0066745_481_1308 271
302 3300044683 Ga0466965_0053615 Ga0466965_0053615_607_1434 271
303 3300044684 Ga0466966_0013966 Ga0466966_0013966_2361_3188 271
304 3300044693 Ga0466961_0085035 Ga0466961_0085035_48_875 271
305 3300044693 Ga0466961_0115846 Ga0466961_0115846_219_1049 271
306 3300044694 Ga0466963_0301419 Ga0466963_0301419_115_942 271
307 3300044706 Ga0466964_0015654 Ga0466964_0015654_1839_2666 271
308 3300044719 Ga0466971_0029433 Ga0466971_0029433_130_957 271
309 3300044765 Ga0466970_0050739 Ga0466970_0050739_364_1191 271
310 3300044842 Ga0466957_0009483 Ga0466957_0009483_719_1546 271
311 3300045049 Ga0466959_0172310 Ga0466959_0172310_50_880 271
312 3300045051 Ga0451576_0216027 Ga0451576_0216027_249_1097 271
313 3300045836 Ga0466958_0183364 Ga0466958_0183364_276_1103 271
314 3300048929 Ga0496126_0007657 Ga0496126_0007657_2880_3719 271
315 3300049584 Ga0501068_0163845 Ga0501068_0163845_149_979 271
316 3300050507 nmdc:mga05p37_729604_c1 nmdc:mga05p37_729604_c1_237_1085 271
317 3300050509 nmdc:mga0qj67_6258_c1 nmdc:mga0qj67_6258_c1_2950_3798 271
318 3300050510 nmdc:mga06r32_251726_c1 nmdc:mga06r32_251726_c1_332_1180 271
319 3300050512 nmdc:mga0n895_309704_c1 nmdc:mga0n895_309704_c1_484_1332 271
320 3300050515 nmdc:mga0a205_560914_c1 nmdc:mga0a205_560914_c1_137_985 271
321 3300061719 Ga0466962_0010444 Ga0466962_0010444_3542_4369 271

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01738

DLH

Dienelactone hydrolase family

62

203

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4u2b-assembly1.cif.gz_A crystal structure of dienelactone hydrolase (c123s) at 1.70 a resolution 0.7508 19 271
1zic-assembly1.cif.gz_A crystal structure analysis of the dienelactone hydrolase (c123s, r206a) mutant- 1.7 a 0.7339 19 271
1zi6-assembly1.cif.gz_A crystal structure analysis of the dienelactone hydrolase (c123s) mutant- 1.7 a 0.729 19 271
4u2b-assembly1.cif.gz_A crystal structure of dienelactone hydrolase (c123s) at 1.70 a resolution 0.7282 19 271
1zj5-assembly1.cif.gz_A crystal structure analysis of the dienelactone hydrolase mutant (e36d, c123s, a134s, s208g, a229v, k234r) bound with the pms moiety of the protease inhibitor, phenylmethylsulfonyl fluoride (pmsf)- 1.7 a 0.7266 19 271
ID Description Score Start End Superfamily
af_A0A1P8AZN3_78_316_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7499 13 270 3.40.50.1820
af_Q8R1G2_23_244_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7423 18 268 3.40.50.1820
af_A0A0R0KP61_46_233_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7389 38 221 3.40.50.1820
af_Q8R1G2_23_244_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7364 18 268 3.40.50.1820
af_A0A1P8AZN3_78_316_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7359 13 270 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A1G5ZAJ8-F1-model_v4 Uncharacterized protein 0.9942 132 269
AF-A0A7X0PIT2-F1-model_v4 Dienelactone hydrolase 0.9933 7 270 GO:0016787
AF-A0A533ITF0-F1-model_v4 deleted 0.9925 1 241
AF-A0A257JPL5-F1-model_v4 Dienelactone hydrolase 0.9921 124 271 GO:0016787
AF-A0A1S8FJY5-F1-model_v4 Dienelactone hydrolase 0.9905 1 270 GO:0016787

Feature Viewer

pLDDT pTM Quality
89.49 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map