F406026

General Info

Members Datasets Scaffolds Average Seq Length
321 163 642 311

Family's Representative Sequence

Representative Sequence 3300027543|Ga0209999_1013899|Ga0209999_10138992
Length 346
Sequence MEYWKDGAFGRTKFFFSNITPPLHFSTTPVIPMPHPYQAILLIAFGGPASPEEIRPFLARVTQGLTIPDARLEEVAHHYEAVGGKSPLNEITFRQAAALEKYLSAQQRRPPVYVGMRNSSPFFTETLKQMAHDGVKKALGLILSSHRTEASWQRYQRNIEEACAELGGKAPAVDYCAPWHDHPLFIQCWVELIDKAYAKIAPERRNSTPLLFTAHSLPTPMAARSPYVDDLHASARLIANKLGRSDWSLAYQSRSGKPSDPWLEPDIGDAIRKLAAEGRPDVVAAPIGFVCDHVEVLYDLDIEAKKLADDLQLNLVRAGCPNDHATFIHMIADVIEQSLKAAENRG

Samples

Sample ID Description Type Environment
1 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
29 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
30 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
39 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
40 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
41 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
42 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
43 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
44 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
45 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
46 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
47 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
48 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
56 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
59 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
82 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
84 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
85 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
86 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
90 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
91 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
92 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
93 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
94 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
95 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
96 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
97 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
98 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
99 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
100 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
101 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
102 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
103 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
104 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
105 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
106 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
107 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
108 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
109 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
110 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
111 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
112 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
115 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
116 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
117 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
118 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
119 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
120 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
121 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
122 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
123 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
124 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
125 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
126 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
127 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
128 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
130 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
131 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
132 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
133 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
134 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
135 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
136 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
137 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
138 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
139 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
140 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
141 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
142 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
143 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
144 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
145 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
146 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
147 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
150 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
151 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
152 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
153 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
154 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
155 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
156 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
157 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
158 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
159 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
160 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
161 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
162 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
163 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.87
Rhizosphere 98.13
Stem 0
Stem Tuber 0
Unclassified 12.77

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0209999_1013899 3300027543 Unclassified 1459
2 Ga0065704_10109299 3300005289 Bacteria 2007
3 Ga0065712_10000212 3300005290 Bacteria 30259
4 Ga0065712_10001923 3300005290 Bacteria 5407
5 Ga0065715_10009635 3300005293 Bacteria 2276
6 Ga0065715_10092218 3300005293 Bacteria 5247
7 Ga0070676_10015131 3300005328 Bacteria 4253
8 Ga0070670_100005432 3300005331 Bacteria 10747
9 Ga0070680_100128615 3300005336 Unclassified 2118
10 Ga0068868_100179903 3300005338 Bacteria 1754
11 Ga0070668_100098485 3300005347 Bacteria 2314
12 Ga0070675_100505443 3300005354 Unclassified 1089
13 Ga0070671_100223753 3300005355 Bacteria 1596
14 Ga0070673_100141539 3300005364 Unclassified 2029
15 Ga0070659_100073909 3300005366 Unclassified 2714
16 Ga0070709_10093551 3300005434 Unclassified 1987
17 Ga0070701_10113784 3300005438 Unclassified 1515
18 Ga0070711_100030373 3300005439 Bacteria 3576
19 Ga0070705_100029388 3300005440 Bacteria 3022
20 Ga0070694_100019274 3300005444 Bacteria 4338
21 Ga0070708_100001170 3300005445 Bacteria 20215
22 Ga0070708_100088269 3300005445 Bacteria 2819
23 Ga0070662_100117128 3300005457 Unclassified 2037
24 Ga0070706_100016109 3300005467 Bacteria 6902
25 Ga0070707_100002283 3300005468 Bacteria 18326
26 Ga0070698_100025666 3300005471 Bacteria 6139
27 Ga0070699_100002074 3300005518 Bacteria 18134
28 Ga0070699_100030994 3300005518 Bacteria 4617
29 Ga0070679_100011149 3300005530 Bacteria 8561
30 Ga0070697_100011216 3300005536 Bacteria 7004
31 Ga0070697_100068356 3300005536 Bacteria 2908
32 Ga0070686_100206198 3300005544 Unclassified 1412
33 Ga0070695_100003760 3300005545 Bacteria 8854
34 Ga0070696_100098830 3300005546 Bacteria 2088
35 Ga0070704_100285939 3300005549 Bacteria 1368
36 Ga0068855_100018798 3300005563 Bacteria 8305
37 Ga0070664_100011835 3300005564 Bacteria 7082
38 Ga0068864_100160638 3300005618 Unclassified 2042
39 Ga0068858_100265751 3300005842 Unclassified 1632
40 Ga0068862_100060166 3300005844 Bacteria 3262
41 Ga0068862_100091764 3300005844 Bacteria 2646
42 Ga0068862_100443046 3300005844 Bacteria 1223
43 Ga0081538_10026035 3300005981 Bacteria 4104
44 Ga0070712_100230394 3300006175 Unclassified 1471
45 Ga0075427_10013256 3300006194 Bacteria 1259
46 Ga0075428_100023712 3300006844 Bacteria 6791
47 Ga0075428_100050399 3300006844 Bacteria 4567
48 Ga0075428_100229681 3300006844 Bacteria 2002
49 Ga0075430_100000221 3300006846 Bacteria 39261
50 Ga0075430_100006879 3300006846 Bacteria 9590
51 Ga0075430_100034797 3300006846 Bacteria 4276
52 Ga0075430_100038015 3300006846 Bacteria 4079
53 Ga0075430_100046792 3300006846 Bacteria 3653
54 Ga0075431_100000511 3300006847 Bacteria 32481
55 Ga0075431_100001741 3300006847 Bacteria 20481
56 Ga0075431_100006870 3300006847 Bacteria 11306
57 Ga0075431_100008809 3300006847 Bacteria 10110
58 Ga0075431_100011349 3300006847 Bacteria 8975
59 Ga0075431_100065280 3300006847 Bacteria 3759
60 Ga0075431_100075893 3300006847 Bacteria 3469
61 Ga0075433_10000275 3300006852 Bacteria 30321
62 Ga0075433_10010612 3300006852 Bacteria 7406
63 Ga0075433_10017059 3300006852 Bacteria 6003
64 Ga0075433_10030398 3300006852 Bacteria 4608
65 Ga0075433_10063949 3300006852 Unclassified 3225
66 Ga0075433_10103069 3300006852 Bacteria 2527
67 Ga0075433_10140960 3300006852 Unclassified 2143
68 Ga0075434_100000489 3300006871 Bacteria 29813
69 Ga0075434_100001884 3300006871 Bacteria 18155
70 Ga0075434_100009445 3300006871 Bacteria 9093
71 Ga0075434_100022776 3300006871 Bacteria 6100
72 Ga0075434_100036488 3300006871 Bacteria 4862
73 Ga0075434_100095421 3300006871 Bacteria 2980
74 Ga0075434_100436636 3300006871 Bacteria 1330
75 Ga0075429_100000820 3300006880 Bacteria 24377
76 Ga0075429_100042781 3300006880 Bacteria 3942
77 Ga0075429_100077941 3300006880 Bacteria 2888
78 Ga0075429_100301231 3300006880 Bacteria 1403
79 Ga0075436_100022745 3300006914 Bacteria 4306
80 Ga0075436_100030710 3300006914 Bacteria 3697
81 Ga0075436_100103039 3300006914 Bacteria 1989
82 Ga0075436_100156963 3300006914 Bacteria 1603
83 Ga0075435_100001180 3300007076 Bacteria 16687
84 Ga0075435_100054201 3300007076 Bacteria 3236
85 Ga0075435_100088523 3300007076 Bacteria 2552
86 Ga0075435_100142725 3300007076 Bacteria 2010
87 Ga0075435_100171409 3300007076 Bacteria 1831
88 Ga0099794_10045573 3300007265 Bacteria 2099
89 Ga0111539_10003846 3300009094 Bacteria 19767
90 Ga0111539_10005312 3300009094 Bacteria 16672
91 Ga0111539_10021330 3300009094 Bacteria 7975
92 Ga0111539_10376861 3300009094 Bacteria 1652
93 Ga0111539_10435071 3300009094 Unclassified 1527
94 Ga0114129_10000002 3300009147 Bacteria 204413
95 Ga0114129_10001662 3300009147 Bacteria 30288
96 Ga0114129_10006458 3300009147 Bacteria 16625
97 Ga0114129_10010368 3300009147 Bacteria 13290
98 Ga0114129_10025121 3300009147 Bacteria 8444
99 Ga0114129_10041224 3300009147 Bacteria 6507
100 Ga0114129_10054070 3300009147 Bacteria 5630
101 Ga0114129_10057821 3300009147 Bacteria 5426
102 Ga0114129_10193012 3300009147 Bacteria 2764
103 Ga0114129_10194635 3300009147 Bacteria 2750
104 Ga0114129_10425305 3300009147 Unclassified 1746
105 Ga0105243_10195845 3300009148 Unclassified 1769
106 Ga0105241_10027562 3300009174 Unclassified 4231
107 Ga0105248_10003149 3300009177 Bacteria 18261
108 Ga0105246_10011468 3300011119 Bacteria 5501
109 Ga0157378_10029118 3300013297 Bacteria 4875
110 Ga0163162_10125036 3300013306 Unclassified 2677
111 Ga0157372_10059884 3300013307 Bacteria 4260
112 Ga0163163_10126931 3300014325 Unclassified 2589
113 Ga0157376_10024155 3300014969 Bacteria 4768
114 Ga0207697_10021710 3300025315 Bacteria 2629
115 Ga0207645_10012706 3300025907 Bacteria 5709
116 Ga0207684_10000931 3300025910 Bacteria 33094
117 Ga0207684_10094423 3300025910 Bacteria 2551
118 Ga0207654_10107680 3300025911 Unclassified 1728
119 Ga0207707_10005570 3300025912 Bacteria 11018
120 Ga0207693_10192422 3300025915 Bacteria 1605
121 Ga0207663_10022822 3300025916 Bacteria 3583
122 Ga0207657_10012591 3300025919 Bacteria 8338
123 Ga0207649_10014009 3300025920 Bacteria 4488
124 Ga0207652_10054514 3300025921 Bacteria 3437
125 Ga0207652_10164873 3300025921 Unclassified 1987
126 Ga0207646_10007305 3300025922 Bacteria 11259
127 Ga0207646_10015702 3300025922 Bacteria 7137
128 Ga0207650_10001233 3300025925 Bacteria 18644
129 Ga0207650_10451386 3300025925 Unclassified 1070
130 Ga0207644_10174068 3300025931 Unclassified 1682
131 Ga0207706_10002680 3300025933 Bacteria 17353
132 Ga0207670_10170435 3300025936 Unclassified 1632
133 Ga0207689_10028707 3300025942 Unclassified 4653
134 Ga0207679_10009000 3300025945 Bacteria 6381
135 Ga0207658_10224163 3300025986 Unclassified 1583
136 Ga0207703_10343497 3300026035 Unclassified 1372
137 Ga0207641_10177414 3300026088 Bacteria 1949
138 Ga0207648_10097017 3300026089 Unclassified 2580
139 Ga0207676_10233400 3300026095 Unclassified 1646
140 Ga0209982_1000676 3300027552 Bacteria 4337
141 Ga0210002_1001304 3300027617 Bacteria 3486
142 Ga0209971_1002204 3300027682 Bacteria 4729
143 Ga0209974_10006146 3300027876 Bacteria 4207
144 Ga0209974_10010422 3300027876 Bacteria 3137
145 Ga0207428_10074167 3300027907 Bacteria 2668
146 Ga0207428_10192500 3300027907 Unclassified 1537
147 Ga0268266_10079347 3300028379 Unclassified 2858
148 Ga0268265_10099083 3300028380 Bacteria 2349
149 Ga0268264_10153414 3300028381 Bacteria 2068
150 Ga0268264_10465387 3300028381 Unclassified 1227
151 Ga0265330_10042764 3300031235 Bacteria 2006
152 Ga0265332_10000602 3300031238 Bacteria 23590
153 Ga0265332_10001991 3300031238 Bacteria 10743
154 Ga0265328_10003783 3300031239 Bacteria 6655
155 Ga0265320_10040100 3300031240 Bacteria 2337
156 Ga0265329_10010332 3300031242 Bacteria 3432
157 Ga0265339_10000279 3300031249 Bacteria 41139
158 Ga0265331_10000183 3300031250 Bacteria 76963
159 Ga0265327_10026642 3300031251 Bacteria 3344
160 Ga0265316_10000148 3300031344 Bacteria 76964
161 Ga0265316_10060112 3300031344 Bacteria 2954
162 Ga0307408_100023085 3300031548 Bacteria 4234
163 Ga0307408_100028231 3300031548 Bacteria 3876
164 Ga0265314_10000984 3300031711 Bacteria 33551
165 Ga0265314_10002991 3300031711 Bacteria 16727
166 Ga0265342_10010451 3300031712 Bacteria 6436
167 Ga0265342_10023812 3300031712 Bacteria 3870
168 Ga0265342_10141460 3300031712 Bacteria 1342
169 Ga0307406_10019251 3300031901 Bacteria 4004
170 Ga0307412_10201608 3300031911 Bacteria 1511
171 Ga0307409_100014445 3300031995 Bacteria 5138
172 Ga0307409_100016057 3300031995 Bacteria 4940
173 Ga0307416_100003431 3300032002 Bacteria 9307
174 Ga0307416_100538157 3300032002 Bacteria 1239
175 Ga0307416_100538918 3300032002 Bacteria 1238
176 Ga0307414_10003232 3300032004 Bacteria 8674
177 Ga0307411_10047531 3300032005 Bacteria 2775
178 Ga0307415_100015488 3300032126 Unclassified 4517
179 Ga0307415_100181411 3300032126 Bacteria 1652
180 Ga0373940_0010770 3300035088 Bacteria 2159
181 Ga0373960_0008346 3300035121 Bacteria 2481
182 Ga0373931_0013154 3300035691 Bacteria 4025
183 Ga0395900_0136106 3300037418 Bacteria 2517
184 Ga0395905_0035220 3300037471 Bacteria 4701
185 Ga0395901_0220454 3300038443 Bacteria 1983
186 Ga0453684_0258644 3300044712 Bacteria 1995
187 Ga0451576_0096491 3300045051 Bacteria 3075
188 Ga0451576_0115644 3300045051 Unclassified 2792
189 Ga0495580_0001006 3300046472 Bacteria 24801
190 Ga0495642_0022712 3300046528 Bacteria 2473
191 Ga0495669_0008088 3300046684 Bacteria 4414
192 Ga0496104_0076042 3300048907 Bacteria 3198
193 Ga0496109_0160585 3300048912 Bacteria 2106
194 Ga0496110_0303485 3300048913 Unclassified 1454
195 Ga0496111_0202391 3300048914 Unclassified 1476
196 Ga0496112_0007269 3300048915 Bacteria 9814
197 Ga0496112_0017754 3300048915 Bacteria 6696
198 Ga0501032_0175170 3300049569 Bacteria 1405
199 Ga0501033_0002641 3300049570 Bacteria 15081
200 Ga0501036_0108750 3300049572 Bacteria 2343
201 Ga0501037_0001295 3300049573 Bacteria 18398
202 Ga0501038_0003810 3300049574 Bacteria 14024
203 Ga0501040_0009074 3300049576 Bacteria 6470
204 Ga0501040_0085062 3300049576 Bacteria 2195
205 Ga0501041_0040859 3300049577 Bacteria 2816
206 Ga0501041_0167503 3300049577 Bacteria 1374
207 Ga0501042_0033831 3300049578 Bacteria 3624
208 Ga0501042_0047169 3300049578 Bacteria 3072
209 Ga0501042_0082825 3300049578 Bacteria 2300
210 Ga0501043_0001665 3300049579 Bacteria 19295
211 Ga0501048_0026778 3300049582 Bacteria 4196
212 Ga0501048_0120629 3300049582 Bacteria 1853
213 Ga0501048_0176976 3300049582 Bacteria 1512
214 Ga0501068_0018183 3300049584 Bacteria 4070
215 Ga0501068_0054023 3300049584 Bacteria 2433
216 Ga0501068_0177062 3300049584 Bacteria 1348
217 Ga0501069_0015861 3300049585 Bacteria 4039
218 Ga0501070_0005136 3300049586 Bacteria 11155
219 Ga0501071_0027658 3300049587 Bacteria 3992
220 Ga0501072_0062964 3300049588 Bacteria 2926
221 Ga0501072_0128212 3300049588 Bacteria 2021
222 Ga0501073_0045934 3300049589 Bacteria 3074
223 Ga0501074_0001858 3300049590 Bacteria 14490
224 Ga0501075_0009751 3300049591 Bacteria 6729
225 Ga0501075_0031245 3300049591 Bacteria 3951
226 Ga0501075_0114410 3300049591 Bacteria 2051
227 Ga0501076_0010291 3300049592 Bacteria 6933
228 Ga0501076_0033869 3300049592 Bacteria 3989
229 Ga0501076_0053098 3300049592 Bacteria 3211
230 Ga0501077_0020322 3300049593 Bacteria 4203
231 Ga0501077_0023148 3300049593 Bacteria 3938
232 Ga0501077_0035926 3300049593 Bacteria 3155
233 Ga0501077_0081776 3300049593 Bacteria 2047
234 Ga0501079_0003048 3300049741 Bacteria 12261
235 Ga0501079_0015899 3300049741 Bacteria 5752
236 Ga0501079_0124331 3300049741 Bacteria 2006
237 Ga0501079_0155138 3300049741 Bacteria 1785
238 Ga0501081_0001922 3300049743 Bacteria 12895
239 Ga0501081_0002492 3300049743 Bacteria 11602
240 Ga0501081_0011689 3300049743 Bacteria 5746
241 Ga0501083_0000620 3300049744 Bacteria 22897
242 Ga0501035_0142478 3300049822 Bacteria 2083
243 Ga0501044_0131246 3300049823 Bacteria 2499
244 Ga0501045_0054454 3300049824 Bacteria 2924
245 Ga0501045_0112941 3300049824 Bacteria 2015
246 Ga0501045_0134237 3300049824 Bacteria 1840
247 nmdc:mga05p37_14305_c1 3300050507 Bacteria 9527
248 nmdc:mga05p37_160075_c1 3300050507 Bacteria 2750
249 nmdc:mga05p37_164545_c1 3300050507 Bacteria 2708
250 nmdc:mga05p37_180842_c1 3300050507 Bacteria 2565
251 nmdc:mga05p37_250107_c1 3300050507 Bacteria 2127
252 nmdc:mga05p37_2_c1 3300050507 Bacteria 173421
253 nmdc:mga05p37_307797_c1 3300050507 Bacteria 1879
254 nmdc:mga05p37_39523_c1 3300050507 Bacteria 5793
255 nmdc:mga05p37_468187_c1 3300050507 Unclassified 1455
256 nmdc:mga05p37_61393_c1 3300050507 Bacteria 4277
257 nmdc:mga05p37_6771_c1 3300050507 Bacteria 13506
258 nmdc:mga05p37_700999_c1 3300050507 Bacteria 1125
259 nmdc:mga05p37_70282_c1 3300050507 Bacteria 4306
260 nmdc:mga09592_106706_c1 3300050508 Bacteria 2402
261 nmdc:mga09592_1125_c1 3300050508 Bacteria 21272
262 nmdc:mga09592_28845_c1 3300050508 Unclassified 4614
263 nmdc:mga09592_3599_c1 3300050508 Bacteria 12504
264 nmdc:mga09592_42688_c1 3300050508 Bacteria 3814
265 nmdc:mga09592_86539_c1 3300050508 Bacteria 2674
266 nmdc:mga0qj67_22427_c1 3300050509 Bacteria 4850
267 nmdc:mga0qj67_34294_c1 3300050509 Bacteria 3964
268 nmdc:mga0qj67_4622_c1 3300050509 Bacteria 9988
269 nmdc:mga0qj67_48957_c1 3300050509 Bacteria 3340
270 nmdc:mga0qj67_533_c1 3300050509 Bacteria 25864
271 nmdc:mga06r32_21358_c1 3300050510 Bacteria 5976
272 nmdc:mga06r32_37305_c1 3300050510 Bacteria 4598
273 nmdc:mga06r32_387219_c1 3300050510 Bacteria 1381
274 nmdc:mga06r32_48206_c1 3300050510 Bacteria 4072
275 nmdc:mga06r32_51178_c1 3300050510 Bacteria 3952
276 nmdc:mga06r32_695_c1 3300050510 Bacteria 29349
277 nmdc:mga06r32_825_c1 3300050510 Bacteria 27452
278 nmdc:mga08y16_191540_c1 3300050511 Bacteria 2121
279 nmdc:mga08y16_44644_c1 3300050511 Bacteria 4644
280 nmdc:mga08y16_82527_c1 3300050511 Bacteria 3351
281 nmdc:mga0n895_41063_c1 3300050512 Bacteria 4497
282 nmdc:mga0n895_415705_c1 3300050512 Bacteria 1360
283 nmdc:mga0n895_62023_c1 3300050512 Bacteria 3693
284 nmdc:mga0n895_7652_c1 3300050512 Bacteria 9290
285 nmdc:mga0n895_87178_c1 3300050512 Bacteria 3119
286 nmdc:mga0n895_92132_c1 3300050512 Bacteria 3034
287 nmdc:mga0rr50_10211_c1 3300050513 Bacteria 5946
288 nmdc:mga0rr50_188337_c1 3300050513 Bacteria 1690
289 nmdc:mga0rr50_20473_c1 3300050513 Bacteria 4495
290 nmdc:mga0rr50_2682_c1 3300050513 Bacteria 10081
291 nmdc:mga0rr50_7958_c1 3300050513 Bacteria 6579
292 nmdc:mga08x19_11492_c1 3300050514 Bacteria 5328
293 nmdc:mga08x19_13967_c1 3300050514 Bacteria 4865
294 nmdc:mga08x19_170042_c1 3300050514 Unclassified 1484
295 nmdc:mga08x19_88774_c1 3300050514 Bacteria 2038
296 nmdc:mga0a205_14897_c1 3300050515 Bacteria 7255
297 nmdc:mga0a205_209_c1 3300050515 Bacteria 41023
298 nmdc:mga0a205_351191_c1 3300050515 Bacteria 1342
299 nmdc:mga0a205_36714_c1 3300050515 Unclassified 4710
300 nmdc:mga0a205_37748_c1 3300050515 Bacteria 4645
301 nmdc:mga0a205_4810_c1 3300050515 Bacteria 12139
302 nmdc:mga0a205_496580_c1 3300050515 Viruses 1077
303 nmdc:mga0a205_9537_c1 3300050515 Bacteria 8880
304 Ga0501084_0014043 3300054114 Bacteria 6631
305 Ga0501084_0025878 3300054114 Bacteria 4893
306 Ga0501084_0035882 3300054114 Bacteria 4145
307 Ga0501084_0073382 3300054114 Bacteria 2866
308 Ga0501084_0120527 3300054114 Bacteria 2206
309 Ga0590071_002333 3300059421 Bacteria 4795
310 Ga0590075_009229 3300059424 Bacteria 2361
311 Ga0501082_0006889 3300060353 Bacteria 9831
312 Ga0501082_0020972 3300060353 Bacteria 5635
313 Ga0501082_0035475 3300060353 Bacteria 4299
314 Ga0501082_0054685 3300060353 Bacteria 3441
315 Ga0501082_0150431 3300060353 Bacteria 2021
316 Ga0501082_0170396 3300060353 Bacteria 1893
317 Ga0530510_0002148 3300061734 Bacteria 13537
318 Ga0530510_0023679 3300061734 Bacteria 4378
319 Ga0530510_0060057 3300061734 Bacteria 2751
320 Ga0530510_0061917 3300061734 Bacteria 2709
321 Ga0530510_0098671 3300061734 Bacteria 2135
322 Ga0209999_1013899
323 Ga0065704_10109299
324 Ga0065712_10000212
325 Ga0065712_10001923
326 Ga0065715_10009635
327 Ga0065715_10092218
328 Ga0070676_10015131
329 Ga0070670_100005432
330 Ga0070680_100128615
331 Ga0068868_100179903
332 Ga0070668_100098485
333 Ga0070675_100505443
334 Ga0070671_100223753
335 Ga0070673_100141539
336 Ga0070659_100073909
337 Ga0070709_10093551
338 Ga0070701_10113784
339 Ga0070711_100030373
340 Ga0070705_100029388
341 Ga0070694_100019274
342 Ga0070708_100001170
343 Ga0070708_100088269
344 Ga0070662_100117128
345 Ga0070706_100016109
346 Ga0070707_100002283
347 Ga0070698_100025666
348 Ga0070699_100002074
349 Ga0070699_100030994
350 Ga0070679_100011149
351 Ga0070697_100011216
352 Ga0070697_100068356
353 Ga0070686_100206198
354 Ga0070695_100003760
355 Ga0070696_100098830
356 Ga0070704_100285939
357 Ga0068855_100018798
358 Ga0070664_100011835
359 Ga0068864_100160638
360 Ga0068858_100265751
361 Ga0068862_100060166
362 Ga0068862_100091764
363 Ga0068862_100443046
364 Ga0081538_10026035
365 Ga0070712_100230394
366 Ga0075427_10013256
367 Ga0075428_100023712
368 Ga0075428_100050399
369 Ga0075428_100229681
370 Ga0075430_100000221
371 Ga0075430_100006879
372 Ga0075430_100034797
373 Ga0075430_100038015
374 Ga0075430_100046792
375 Ga0075431_100000511
376 Ga0075431_100001741
377 Ga0075431_100006870
378 Ga0075431_100008809
379 Ga0075431_100011349
380 Ga0075431_100065280
381 Ga0075431_100075893
382 Ga0075433_10000275
383 Ga0075433_10010612
384 Ga0075433_10017059
385 Ga0075433_10030398
386 Ga0075433_10063949
387 Ga0075433_10103069
388 Ga0075433_10140960
389 Ga0075434_100000489
390 Ga0075434_100001884
391 Ga0075434_100009445
392 Ga0075434_100022776
393 Ga0075434_100036488
394 Ga0075434_100095421
395 Ga0075434_100436636
396 Ga0075429_100000820
397 Ga0075429_100042781
398 Ga0075429_100077941
399 Ga0075429_100301231
400 Ga0075436_100022745
401 Ga0075436_100030710
402 Ga0075436_100103039
403 Ga0075436_100156963
404 Ga0075435_100001180
405 Ga0075435_100054201
406 Ga0075435_100088523
407 Ga0075435_100142725
408 Ga0075435_100171409
409 Ga0099794_10045573
410 Ga0111539_10003846
411 Ga0111539_10005312
412 Ga0111539_10021330
413 Ga0111539_10376861
414 Ga0111539_10435071
415 Ga0114129_10000002
416 Ga0114129_10001662
417 Ga0114129_10006458
418 Ga0114129_10010368
419 Ga0114129_10025121
420 Ga0114129_10041224
421 Ga0114129_10054070
422 Ga0114129_10057821
423 Ga0114129_10193012
424 Ga0114129_10194635
425 Ga0114129_10425305
426 Ga0105243_10195845
427 Ga0105241_10027562
428 Ga0105248_10003149
429 Ga0105246_10011468
430 Ga0157378_10029118
431 Ga0163162_10125036
432 Ga0157372_10059884
433 Ga0163163_10126931
434 Ga0157376_10024155
435 Ga0207697_10021710
436 Ga0207645_10012706
437 Ga0207684_10000931
438 Ga0207684_10094423
439 Ga0207654_10107680
440 Ga0207707_10005570
441 Ga0207693_10192422
442 Ga0207663_10022822
443 Ga0207657_10012591
444 Ga0207649_10014009
445 Ga0207652_10054514
446 Ga0207652_10164873
447 Ga0207646_10007305
448 Ga0207646_10015702
449 Ga0207650_10001233
450 Ga0207650_10451386
451 Ga0207644_10174068
452 Ga0207706_10002680
453 Ga0207670_10170435
454 Ga0207689_10028707
455 Ga0207679_10009000
456 Ga0207658_10224163
457 Ga0207703_10343497
458 Ga0207641_10177414
459 Ga0207648_10097017
460 Ga0207676_10233400
461 Ga0209982_1000676
462 Ga0210002_1001304
463 Ga0209971_1002204
464 Ga0209974_10006146
465 Ga0209974_10010422
466 Ga0207428_10074167
467 Ga0207428_10192500
468 Ga0268266_10079347
469 Ga0268265_10099083
470 Ga0268264_10153414
471 Ga0268264_10465387
472 Ga0265330_10042764
473 Ga0265332_10000602
474 Ga0265332_10001991
475 Ga0265328_10003783
476 Ga0265320_10040100
477 Ga0265329_10010332
478 Ga0265339_10000279
479 Ga0265331_10000183
480 Ga0265327_10026642
481 Ga0265316_10000148
482 Ga0265316_10060112
483 Ga0307408_100023085
484 Ga0307408_100028231
485 Ga0265314_10000984
486 Ga0265314_10002991
487 Ga0265342_10010451
488 Ga0265342_10023812
489 Ga0265342_10141460
490 Ga0307406_10019251
491 Ga0307412_10201608
492 Ga0307409_100014445
493 Ga0307409_100016057
494 Ga0307416_100003431
495 Ga0307416_100538157
496 Ga0307416_100538918
497 Ga0307414_10003232
498 Ga0307411_10047531
499 Ga0307415_100015488
500 Ga0307415_100181411
501 Ga0373940_0010770
502 Ga0373960_0008346
503 Ga0373931_0013154
504 Ga0395900_0136106
505 Ga0395905_0035220
506 Ga0395901_0220454
507 Ga0453684_0258644
508 Ga0451576_0096491
509 Ga0451576_0115644
510 Ga0495580_0001006
511 Ga0495642_0022712
512 Ga0495669_0008088
513 Ga0496104_0076042
514 Ga0496109_0160585
515 Ga0496110_0303485
516 Ga0496111_0202391
517 Ga0496112_0007269
518 Ga0496112_0017754
519 Ga0501032_0175170
520 Ga0501033_0002641
521 Ga0501036_0108750
522 Ga0501037_0001295
523 Ga0501038_0003810
524 Ga0501040_0009074
525 Ga0501040_0085062
526 Ga0501041_0040859
527 Ga0501041_0167503
528 Ga0501042_0033831
529 Ga0501042_0047169
530 Ga0501042_0082825
531 Ga0501043_0001665
532 Ga0501048_0026778
533 Ga0501048_0120629
534 Ga0501048_0176976
535 Ga0501068_0018183
536 Ga0501068_0054023
537 Ga0501068_0177062
538 Ga0501069_0015861
539 Ga0501070_0005136
540 Ga0501071_0027658
541 Ga0501072_0062964
542 Ga0501072_0128212
543 Ga0501073_0045934
544 Ga0501074_0001858
545 Ga0501075_0009751
546 Ga0501075_0031245
547 Ga0501075_0114410
548 Ga0501076_0010291
549 Ga0501076_0033869
550 Ga0501076_0053098
551 Ga0501077_0020322
552 Ga0501077_0023148
553 Ga0501077_0035926
554 Ga0501077_0081776
555 Ga0501079_0003048
556 Ga0501079_0015899
557 Ga0501079_0124331
558 Ga0501079_0155138
559 Ga0501081_0001922
560 Ga0501081_0002492
561 Ga0501081_0011689
562 Ga0501083_0000620
563 Ga0501035_0142478
564 Ga0501044_0131246
565 Ga0501045_0054454
566 Ga0501045_0112941
567 Ga0501045_0134237
568 nmdc:mga05p37_14305_c1
569 nmdc:mga05p37_160075_c1
570 nmdc:mga05p37_164545_c1
571 nmdc:mga05p37_180842_c1
572 nmdc:mga05p37_250107_c1
573 nmdc:mga05p37_2_c1
574 nmdc:mga05p37_307797_c1
575 nmdc:mga05p37_39523_c1
576 nmdc:mga05p37_468187_c1
577 nmdc:mga05p37_61393_c1
578 nmdc:mga05p37_6771_c1
579 nmdc:mga05p37_700999_c1
580 nmdc:mga05p37_70282_c1
581 nmdc:mga09592_106706_c1
582 nmdc:mga09592_1125_c1
583 nmdc:mga09592_28845_c1
584 nmdc:mga09592_3599_c1
585 nmdc:mga09592_42688_c1
586 nmdc:mga09592_86539_c1
587 nmdc:mga0qj67_22427_c1
588 nmdc:mga0qj67_34294_c1
589 nmdc:mga0qj67_4622_c1
590 nmdc:mga0qj67_48957_c1
591 nmdc:mga0qj67_533_c1
592 nmdc:mga06r32_21358_c1
593 nmdc:mga06r32_37305_c1
594 nmdc:mga06r32_387219_c1
595 nmdc:mga06r32_48206_c1
596 nmdc:mga06r32_51178_c1
597 nmdc:mga06r32_695_c1
598 nmdc:mga06r32_825_c1
599 nmdc:mga08y16_191540_c1
600 nmdc:mga08y16_44644_c1
601 nmdc:mga08y16_82527_c1
602 nmdc:mga0n895_41063_c1
603 nmdc:mga0n895_415705_c1
604 nmdc:mga0n895_62023_c1
605 nmdc:mga0n895_7652_c1
606 nmdc:mga0n895_87178_c1
607 nmdc:mga0n895_92132_c1
608 nmdc:mga0rr50_10211_c1
609 nmdc:mga0rr50_188337_c1
610 nmdc:mga0rr50_20473_c1
611 nmdc:mga0rr50_2682_c1
612 nmdc:mga0rr50_7958_c1
613 nmdc:mga08x19_11492_c1
614 nmdc:mga08x19_13967_c1
615 nmdc:mga08x19_170042_c1
616 nmdc:mga08x19_88774_c1
617 nmdc:mga0a205_14897_c1
618 nmdc:mga0a205_209_c1
619 nmdc:mga0a205_351191_c1
620 nmdc:mga0a205_36714_c1
621 nmdc:mga0a205_37748_c1
622 nmdc:mga0a205_4810_c1
623 nmdc:mga0a205_496580_c1
624 nmdc:mga0a205_9537_c1
625 Ga0501084_0014043
626 Ga0501084_0025878
627 Ga0501084_0035882
628 Ga0501084_0073382
629 Ga0501084_0120527
630 Ga0590071_002333
631 Ga0590075_009229
632 Ga0501082_0006889
633 Ga0501082_0020972
634 Ga0501082_0035475
635 Ga0501082_0054685
636 Ga0501082_0150431
637 Ga0501082_0170396
638 Ga0530510_0002148
639 Ga0530510_0023679
640 Ga0530510_0060057
641 Ga0530510_0061917
642 Ga0530510_0098671

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00762

Ferrochelatase

Ferrochelatase

37

339

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ofl-assembly1.cif.gz_A coproporphyrin iii - lmcpfc complex soaked 4min with fe2+ 0.9262 7 308
8aw7-assembly1.cif.gz_A structure of coproporphyrin iii-lmcpfc r45l 0.9216 5 308
4mk4-assembly1.cif.gz_B s197c variant of human ferrochelatase. 0.921 4 309
4kla-assembly1.cif.gz_B e343d variant of human ferrochelatase 0.9175 4 309
4f4d-assembly1.cif.gz_B f337r variant of human ferrochelatase 0.9167 4 309
ID Description Score Start End Superfamily
af_O59786_242_370_3.40.50.1400 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9287 159 286 3.40.50.1400
af_P9WNE3_146_279_3.40.50.1400 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.928 154 287 3.40.50.1400
1ak1A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.927 149 287 3.40.50.1400
af_Q9V9S8_189_328_3.40.50.1400 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9253 150 286 3.40.50.1400
af_P9WNE3_5_124_3.40.50.1400 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9172 7 131 3.40.50.1400
ID Description Score Start End GO Terms
AF-A0A2H5ZH54-F1-model_v4 Ferrochelatase (EC 4.98.1.1) (Heme synthase) (Protoheme ferro-lyase) 0.9828 5 306 GO:0004325
GO:0005737
GO:0006783
GO:0046872
AF-A0A2V6TV95-F1-model_v4 coproporphyrin ferrochelatase (EC 4.99.1.9) 0.9811 3 263 GO:0004325
GO:0006783
AF-A0A7Y3L1F4-F1-model_v4 Ferrochelatase (EC 4.98.1.1) (Heme synthase) (Protoheme ferro-lyase) 0.9771 3 305 GO:0004325
GO:0005737
GO:0006783
GO:0046872
AF-A0A3L7RV70-F1-model_v4 Ferrochelatase (EC 4.98.1.1) (Heme synthase) (Protoheme ferro-lyase) 0.9766 3 307 GO:0004325
GO:0005737
GO:0006783
GO:0046872
AF-A0A382CW72-F1-model_v4 Ferrochelatase 0.9764 5 155 GO:0004325
GO:0006783

Map