F405904

General Info

Members Datasets Scaffolds Average Seq Length
321 206 642 146

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10339196|Ga0081455_103391963
Length 159
Sequence MLMRTDPFRELDRVAQQVFGTAARPAAMPIDAYRKGDEFVVLFDLPGCDADSINLTVERNVLAVHAERRPSIDEQDDGVELVVGERPRGTFSRQLFLAETLDSERIVADYTDGVLRLRIPVREQAKPRRVDISVGRIESKPIEANSTDDVRDPAGATVS

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
26 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
27 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
28 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
29 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
30 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
34 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
35 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
36 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
39 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
40 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
41 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
42 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
43 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
44 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
45 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
46 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
47 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
48 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
49 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
50 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
52 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
55 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
56 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
57 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
58 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
59 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
82 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
83 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
84 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
85 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
86 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
87 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
88 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
89 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
90 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
91 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
92 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
93 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
94 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
95 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
96 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
97 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
98 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
99 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
100 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
101 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
102 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
103 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
104 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
105 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
106 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
107 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
108 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
109 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
112 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
113 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
114 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
115 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
120 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
121 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
122 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
123 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
124 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
125 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
126 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
127 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
128 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
129 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
130 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
131 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
132 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
133 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
134 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
135 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
136 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
137 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
138 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
139 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
140 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
141 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
142 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
143 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
144 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
145 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
146 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
147 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
148 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
149 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
150 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
151 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
152 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
153 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
154 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
155 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
156 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
157 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
158 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
159 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
160 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
161 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
162 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
163 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
164 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
165 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
166 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
173 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
174 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
175 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
176 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
177 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
178 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
180 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
181 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
182 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
183 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
184 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
185 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
186 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
189 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
190 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
191 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
192 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
193 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
194 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
195 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
196 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
197 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
198 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
199 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
200 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
201 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
202 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
203 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
204 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
205 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
206 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.31
Metatranscriptomes 13.71
Isolates 4.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.18
Nodule 0
Rhizoplane 3.43
Rhizosphere 87.85
Stem 0
Stem Tuber 0
Unclassified 0.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10339196 3300005937 Bacteria 1064
2 Ga0065714_10145096 3300005288 Bacteria 1144
3 Ga0070683_100149335 3300005329 Bacteria 2215
4 Ga0070670_100196544 3300005331 Bacteria 1752
5 Ga0070677_10089890 3300005333 Bacteria 1333
6 Ga0070680_100047579 3300005336 Bacteria 3492
7 Ga0070682_100055408 3300005337 Bacteria 2490
8 Ga0070660_100038405 3300005339 Bacteria 3635
9 Ga0070691_10037207 3300005341 Bacteria 2296
10 Ga0070692_10308169 3300005345 Bacteria 969
11 Ga0070667_100755847 3300005367 Bacteria 901
12 Ga0070714_100000876 3300005435 Bacteria 21365
13 Ga0070714_100013862 3300005435 Bacteria 6464
14 Ga0070714_100048915 3300005435 Bacteria 3598
15 Ga0070714_100070364 3300005435 Bacteria 3024
16 Ga0070714_100091521 3300005435 Bacteria 2665
17 Ga0070713_100060529 3300005436 Bacteria 3165
18 Ga0070710_10519608 3300005437 Bacteria 818
19 Ga0070711_100079448 3300005439 Bacteria 2333
20 Ga0070663_100164385 3300005455 Bacteria 1711
21 Ga0070681_10022824 3300005458 Bacteria 6288
22 Ga0070707_101451290 3300005468 Bacteria 653
23 Ga0070679_100170663 3300005530 Bacteria 2148
24 Ga0070684_102170561 3300005535 Bacteria 524
25 Ga0070684_102199138 3300005535 Bacteria 520
26 Ga0070686_100627249 3300005544 Bacteria 850
27 Ga0070665_101634035 3300005548 Bacteria 652
28 Ga0068856_100267646 3300005614 Bacteria 1725
29 Ga0068863_100269943 3300005841 Bacteria 1647
30 Ga0068862_100404802 3300005844 Unclassified 1277
31 Ga0081455_10356367 3300005937 Bacteria 1030
32 Ga0070717_10106561 3300006028 Bacteria 2387
33 Ga0075365_10071858 3300006038 Bacteria 2330
34 Ga0075365_10450528 3300006038 Bacteria 909
35 Ga0075365_10797071 3300006038 Bacteria 667
36 Ga0075363_100204391 3300006048 Bacteria 1129
37 Ga0070715_10939809 3300006163 Bacteria 535
38 Ga0070716_100251622 3300006173 Bacteria 1204
39 Ga0070716_100638712 3300006173 Bacteria 806
40 Ga0070712_100078280 3300006175 Bacteria 2386
41 Ga0075428_101818596 3300006844 Bacteria 634
42 Ga0075429_100899886 3300006880 Bacteria 774
43 Ga0075435_100725932 3300007076 Bacteria 864
44 Ga0105240_11361730 3300009093 Bacteria 747
45 Ga0111539_10566820 3300009094 Bacteria 1323
46 Ga0111539_11421618 3300009094 Bacteria 805
47 Ga0111539_12338511 3300009094 Bacteria 620
48 Ga0114129_10967015 3300009147 Bacteria 1074
49 Ga0105243_11878354 3300009148 Bacteria 631
50 Ga0105243_11881043 3300009148 Bacteria 631
51 Ga0105241_10218981 3300009174 Bacteria 1599
52 Ga0105248_12697139 3300009177 Bacteria 567
53 Ga0105246_10235335 3300011119 Bacteria 1444
54 Ga0157371_10409384 3300013102 Bacteria 993
55 Ga0157370_10468898 3300013104 Bacteria 1157
56 Ga0157369_10023366 3300013105 Bacteria 6885
57 Ga0157369_10038113 3300013105 Bacteria 5258
58 Ga0157369_10132716 3300013105 Bacteria 2638
59 Ga0157378_11594250 3300013297 Bacteria 699
60 Ga0163163_10240885 3300014325 Bacteria 1858
61 Ga0157380_10612576 3300014326 Bacteria 1079
62 Ga0157380_12226231 3300014326 Bacteria 612
63 Ga0157376_10354552 3300014969 Bacteria 1405
64 Ga0197907_10281526 3300020069 Bacteria 572
65 Ga0206349_1021664 3300020075 Bacteria 800
66 Ga0206349_1113299 3300020075 Bacteria 1869
67 Ga0206349_1598043 3300020075 Bacteria 1772
68 Ga0206349_1846828 3300020075 Bacteria 1441
69 Ga0206355_1441286 3300020076 Bacteria 890
70 Ga0206351_10028925 3300020077 Bacteria 2000
71 Ga0206351_10070256 3300020077 Bacteria 688
72 Ga0206351_10093226 3300020077 Bacteria 845
73 Ga0206351_10308969 3300020077 Bacteria 1006
74 Ga0206351_10329869 3300020077 Bacteria 586
75 Ga0206351_10541660 3300020077 Bacteria 534
76 Ga0206351_10665811 3300020077 Bacteria 733
77 Ga0206351_10691984 3300020077 Bacteria 815
78 Ga0206351_10871468 3300020077 Bacteria 1414
79 Ga0206351_10891331 3300020077 Bacteria 527
80 Ga0206350_10423167 3300020080 Bacteria 1174
81 Ga0206350_10532368 3300020080 Bacteria 1399
82 Ga0206350_10786459 3300020080 Bacteria 688
83 Ga0206350_10978579 3300020080 Bacteria 898
84 Ga0206350_11146153 3300020080 Bacteria 559
85 Ga0206350_11177926 3300020080 Bacteria 1358
86 Ga0206350_11226173 3300020080 Bacteria 956
87 Ga0206350_11409816 3300020080 Bacteria 655
88 Ga0206350_11466823 3300020080 Bacteria 1008
89 Ga0154015_1157625 3300020610 Bacteria 774
90 Ga0154015_1247588 3300020610 Bacteria 671
91 Ga0154015_1465140 3300020610 Bacteria 541
92 Ga0154015_1585568 3300020610 Bacteria 752
93 Ga0154015_1632857 3300020610 Bacteria 672
94 Ga0154015_1653620 3300020610 Bacteria 565
95 Ga0213873_10000083 3300021358 Bacteria 19405
96 Ga0213872_10313854 3300021361 Bacteria 649
97 Ga0213876_10062347 3300021384 Bacteria 1968
98 Ga0213875_10000652 3300021388 Bacteria 27599
99 Ga0213875_10088000 3300021388 Bacteria 1449
100 Ga0224712_10001134 3300022467 Bacteria 5928
101 Ga0224712_10014904 3300022467 Bacteria 2517
102 Ga0224712_10019787 3300022467 Bacteria 2276
103 Ga0224712_10061050 3300022467 Bacteria 1502
104 Ga0224712_10132694 3300022467 Bacteria 1089
105 Ga0224712_10158066 3300022467 Bacteria 1009
106 Ga0224712_10166207 3300022467 Bacteria 987
107 Ga0224712_10254536 3300022467 Bacteria 812
108 Ga0224712_10265617 3300022467 Bacteria 796
109 Ga0224712_10383207 3300022467 Bacteria 668
110 Ga0224712_10460628 3300022467 Bacteria 611
111 Ga0207692_10028859 3300025898 Bacteria 2630
112 Ga0207692_10124914 3300025898 Bacteria 1446
113 Ga0207642_10424947 3300025899 Bacteria 800
114 Ga0207710_10360173 3300025900 Bacteria 742
115 Ga0207685_10340270 3300025905 Bacteria 753
116 Ga0207699_10021089 3300025906 Bacteria 3505
117 Ga0207707_10045046 3300025912 Bacteria 3845
118 Ga0207693_10023631 3300025915 Bacteria 4878
119 Ga0207693_10217044 3300025915 Bacteria 1503
120 Ga0207663_10294856 3300025916 Bacteria 1209
121 Ga0207663_10491442 3300025916 Bacteria 952
122 Ga0207663_10810659 3300025916 Bacteria 746
123 Ga0207660_10010819 3300025917 Bacteria 5929
124 Ga0207657_10117716 3300025919 Bacteria 2188
125 Ga0207650_11137275 3300025925 Bacteria 665
126 Ga0207700_10020927 3300025928 Bacteria 4454
127 Ga0207700_10130414 3300025928 Bacteria 2052
128 Ga0207700_10304181 3300025928 Bacteria 1378
129 Ga0207700_10910951 3300025928 Bacteria 787
130 Ga0207664_10005255 3300025929 Bacteria 8838
131 Ga0207664_10009673 3300025929 Bacteria 6777
132 Ga0207664_10019333 3300025929 Bacteria 5033
133 Ga0207664_10277845 3300025929 Bacteria 1469
134 Ga0207644_10861261 3300025931 Bacteria 759
135 Ga0207665_10486174 3300025939 Bacteria 952
136 Ga0207665_10936551 3300025939 Bacteria 688
137 Ga0207661_10009748 3300025944 Bacteria 6898
138 Ga0207677_10330024 3300026023 Bacteria 1271
139 Ga0207678_10118034 3300026067 Bacteria 2264
140 Ga0207702_12037378 3300026078 Bacteria 564
141 Ga0207683_12137598 3300026121 Bacteria 508
142 Ga0207698_10363177 3300026142 Bacteria 1372
143 Ga0207428_10004286 3300027907 Bacteria 13644
144 Ga0207428_10142439 3300027907 Bacteria 1829
145 Ga0265337_1003919 3300028556 Bacteria 6300
146 Ga0265326_10006942 3300028558 Bacteria 3491
147 Ga0265319_1001688 3300028563 Bacteria 12755
148 Ga0265334_10008404 3300028573 Bacteria 4389
149 Ga0265318_10217290 3300028577 Bacteria 698
150 Ga0265323_10004042 3300028653 Bacteria 6358
151 Ga0265322_10067201 3300028654 Bacteria 1016
152 Ga0265336_10024022 3300028666 Bacteria 1929
153 Ga0265338_10000757 3300028800 Bacteria 55097
154 Ga0265324_10004364 3300029957 Bacteria 6425
155 Ga0265332_10003463 3300031238 Bacteria 7598
156 Ga0265328_10167543 3300031239 Bacteria 829
157 Ga0265320_10017416 3300031240 Bacteria 3991
158 Ga0265325_10062430 3300031241 Bacteria 1887
159 Ga0265329_10271528 3300031242 Bacteria 569
160 Ga0265340_10048306 3300031247 Bacteria 2069
161 Ga0265339_10148371 3300031249 Bacteria 1188
162 Ga0265316_10019994 3300031344 Bacteria 5711
163 Ga0307408_100005745 3300031548 Bacteria 8263
164 Ga0307408_100042009 3300031548 Bacteria 3244
165 Ga0307408_100132311 3300031548 Bacteria 1947
166 Ga0307408_100703851 3300031548 Bacteria 908
167 Ga0307408_102059958 3300031548 Bacteria 549
168 Ga0265314_10312853 3300031711 Bacteria 876
169 Ga0265342_10183562 3300031712 Bacteria 1144
170 Ga0307405_10305863 3300031731 Bacteria 1208
171 Ga0307413_10593224 3300031824 Bacteria 905
172 Ga0307410_10023368 3300031852 Bacteria 3841
173 Ga0307410_10210803 3300031852 Bacteria 1488
174 Ga0307410_10213850 3300031852 Bacteria 1479
175 Ga0307410_10227754 3300031852 Bacteria 1437
176 Ga0307410_11802505 3300031852 Bacteria 544
177 Ga0307406_10049408 3300031901 Bacteria 2662
178 Ga0307407_10003012 3300031903 Bacteria 6773
179 Ga0307407_10051924 3300031903 Bacteria 2352
180 Ga0307407_10227260 3300031903 Bacteria 1265
181 Ga0307412_10080710 3300031911 Bacteria 2247
182 Ga0307412_10206295 3300031911 Bacteria 1496
183 Ga0307412_10390184 3300031911 Bacteria 1130
184 Ga0307409_100037821 3300031995 Bacteria 3561
185 Ga0307409_100038457 3300031995 Bacteria 3540
186 Ga0307409_101120065 3300031995 Bacteria 809
187 Ga0307416_100049260 3300032002 Bacteria 3348
188 Ga0307416_100152607 3300032002 Bacteria 2121
189 Ga0307416_100590863 3300032002 Bacteria 1189
190 Ga0307416_100629403 3300032002 Bacteria 1156
191 Ga0307416_101557051 3300032002 Bacteria 766
192 Ga0307416_102161216 3300032002 Bacteria 658
193 Ga0307416_102195395 3300032002 Bacteria 653
194 Ga0307414_10180142 3300032004 Bacteria 1699
195 Ga0307414_10439058 3300032004 Bacteria 1142
196 Ga0307415_100031125 3300032126 Bacteria 3433
197 Ga0307415_100416088 3300032126 Bacteria 1152
198 Ga0373955_0867304 3300035172 Bacteria 555
199 Ga0373924_0183340 3300035410 Bacteria 921
200 Ga0395899_0014751 3300037312 Bacteria 5965
201 Ga0395899_0020221 3300037312 Bacteria 5051
202 Ga0395900_0083279 3300037418 Bacteria 3286
203 Ga0395900_0877472 3300037418 Bacteria 821
204 Ga0395898_0012596 3300037466 Bacteria 8743
205 Ga0395898_0024221 3300037466 Bacteria 6123
206 Ga0395898_0108717 3300037466 Bacteria 2659
207 Ga0395905_0173996 3300037471 Bacteria 2022
208 Ga0395905_0288511 3300037471 Bacteria 1528
209 Ga0395905_0394201 3300037471 Unclassified 1279
210 Ga0436364_0080425 3300037853 Bacteria 655
211 Ga0436364_0090304 3300037853 Bacteria 41526
212 Ga0436364_0592530 3300037853 Bacteria 20813
213 Ga0436364_0643029 3300037853 Bacteria 2908
214 Ga0436364_1492002 3300037853 Bacteria 1106
215 Ga0395901_0142794 3300038443 Bacteria 2516
216 Ga0395901_0147838 3300038443 Bacteria 2469
217 Ga0395901_0615438 3300038443 Bacteria 1093
218 Ga0436365_0906999 3300039437 Bacteria 2199
219 Ga0436363_0799493 3300039450 Bacteria 853
220 Ga0436362_0017650 3300039453 Bacteria 19903
221 Ga0436362_0722501 3300039453 Bacteria 1613
222 Ga0439436_0011623 3300041404 Bacteria 2674
223 Ga0439439_0025892 3300041406 Bacteria 1477
224 Ga0439439_0030795 3300041406 Bacteria 1365
225 Ga0439447_058157 3300041407 Bacteria 913
226 Ga0439447_071553 3300041407 Bacteria 806
227 Ga0439466_0063794 3300041411 Bacteria 1182
228 Ga0439466_0171367 3300041411 Bacteria 663
229 Ga0451839_0016129 3300041496 Bacteria 1280
230 Ga0451853_0136513 3300041512 Bacteria 6255
231 Ga0451853_4106689 3300041512 Bacteria 576
232 Ga0439433_0011998 3300041999 Bacteria 1898
233 Ga0439433_0012961 3300041999 Bacteria 1830
234 Ga0439433_0014162 3300041999 Bacteria 1755
235 Ga0439433_0093885 3300041999 Bacteria 740
236 Ga0439442_000191 3300042002 Bacteria 15596
237 Ga0439449_0026334 3300042007 Bacteria 2171
238 Ga0439449_0043204 3300042007 Bacteria 1673
239 Ga0439452_072436 3300042010 Bacteria 758
240 Ga0439457_007253 3300042014 Bacteria 2669
241 Ga0439462_0016499 3300042015 Bacteria 1908
242 Ga0450920_026227 3300042122 Bacteria 1136
243 Ga0450907_002229 3300042146 Bacteria 3778
244 Ga0439434_0000187 3300042435 Bacteria 16927
245 Ga0439434_0046548 3300042435 Bacteria 1339
246 Ga0450918_000581 3300042531 Bacteria 7796
247 Ga0466965_0863125 3300044683 Bacteria 526
248 Ga0466966_0001420 3300044684 Bacteria 15432
249 Ga0466963_0007319 3300044694 Bacteria 6579
250 Ga0466963_0886236 3300044694 Bacteria 629
251 Ga0466971_0003478 3300044719 Bacteria 6727
252 Ga0466968_0000089 3300044735 Bacteria 26922
253 Ga0466968_0279654 3300044735 Bacteria 798
254 Ga0466968_0531930 3300044735 Bacteria 588
255 Ga0466970_0002921 3300044765 Bacteria 8284
256 Ga0466957_0008919 3300044842 Bacteria 5715
257 Ga0466960_0003387 3300044901 Bacteria 6124
258 Ga0466958_0019679 3300045836 Bacteria 3929
259 Ga0466967_0539344 3300045976 Bacteria 1147
260 Ga0495608_0106767 3300046511 Bacteria 1802
261 Ga0495667_0151796 3300046559 Bacteria 1491
262 Ga0495657_0446986 3300046675 Bacteria 757
263 Ga0495613_1121966 3300046689 Bacteria 501
264 Ga0495672_0189934 3300047320 Bacteria 1034
265 Ga0495675_0828035 3300047444 Bacteria 511
266 Ga0496101_0609760 3300048904 Bacteria 863
267 Ga0496103_0047630 3300048906 Bacteria 2649
268 Ga0496105_1247553 3300048908 Bacteria 545
269 Ga0496108_0965981 3300048911 Bacteria 729
270 Ga0496109_1330162 3300048912 Bacteria 654
271 Ga0496110_0058671 3300048913 Bacteria 3390
272 Ga0496113_0770596 3300048916 Bacteria 765
273 Ga0496114_0668322 3300048917 Bacteria 913
274 Ga0496114_1052644 3300048917 Bacteria 698
275 Ga0496114_1567947 3300048917 Bacteria 547
276 Ga0496115_0094327 3300048918 Bacteria 2448
277 Ga0496126_0014002 3300048929 Bacteria 8128
278 Ga0501033_0734305 3300049570 Bacteria 670
279 Ga0501034_0749945 3300049571 Bacteria 872
280 Ga0501036_1094924 3300049572 Bacteria 651
281 Ga0501038_0070087 3300049574 Bacteria 2977
282 Ga0501038_0854727 3300049574 Bacteria 674
283 Ga0501039_0551728 3300049575 Bacteria 904
284 Ga0501040_0361137 3300049576 Bacteria 1041
285 Ga0501043_0097349 3300049579 Bacteria 2313
286 Ga0501071_0657277 3300049587 Bacteria 807
287 Ga0501072_0297113 3300049588 Bacteria 1284
288 Ga0501072_1058528 3300049588 Bacteria 632
289 Ga0501075_1270586 3300049591 Bacteria 558
290 Ga0501076_1107503 3300049592 Bacteria 652
291 Ga0501079_0298196 3300049741 Bacteria 1261
292 Ga0501044_0737729 3300049823 Bacteria 868
293 Ga0501045_0183312 3300049824 Bacteria 1560
294 nmdc:mga03n38_319925_c1 3300050490 Bacteria 837
295 nmdc:mga0yw44_377004_c1 3300050492 Bacteria 957
296 nmdc:mga0yw44_401976_c1 3300050492 Bacteria 926
297 nmdc:mga05p37_667063_c1 3300050507 Bacteria 1161
298 nmdc:mga09592_888053_c1 3300050508 Bacteria 750
299 nmdc:mga08x19_190876_c1 3300050514 Bacteria 1401
300 Ga0501084_0086407 3300054114 Bacteria 2634
301 Ga0587072_014375 3300059643 Bacteria 1333
302 Ga0587114_111009 3300059655 Bacteria 545
303 Ga0501082_0641601 3300060353 Bacteria 929
304 Ga0466962_0162270 3300061719 Bacteria 1086
305 Ga0530510_0933053 3300061734 Bacteria 664
306 2808828542 2808606357 Bacteria 4466944
307 2808877622 2808606366 Bacteria 4415912
308 2808899078 2808606371 Bacteria 4251511
309 2808916308 2808606375 Bacteria 9466072
310 2809591283 2808606522 Bacteria 9488490
311 2862707239 2862705112 Bacteria 6563286
312 2945960672 2945956166 Bacteria 5110334
313 2954711966 2954711539 Bacteria 10867210
314 2954721905 2954721474 Bacteria 10456478
315 2954739948 2954731030 Bacteria 10243860
316 2954740799 2954740390 Bacteria 10229294
317 2954758767 2954749733 Bacteria 10366972
318 2954759807 2954759201 Bacteria 9358192
319 8008489729 8008485437 Bacteria 7198341
320 8025528695 8025524527 Bacteria 7197316
321 8056673027 8056667051 Bacteria 6953971
322 Ga0081455_10339196
323 Ga0065714_10145096
324 Ga0070683_100149335
325 Ga0070670_100196544
326 Ga0070677_10089890
327 Ga0070680_100047579
328 Ga0070682_100055408
329 Ga0070660_100038405
330 Ga0070691_10037207
331 Ga0070692_10308169
332 Ga0070667_100755847
333 Ga0070714_100000876
334 Ga0070714_100013862
335 Ga0070714_100048915
336 Ga0070714_100070364
337 Ga0070714_100091521
338 Ga0070713_100060529
339 Ga0070710_10519608
340 Ga0070711_100079448
341 Ga0070663_100164385
342 Ga0070681_10022824
343 Ga0070707_101451290
344 Ga0070679_100170663
345 Ga0070684_102170561
346 Ga0070684_102199138
347 Ga0070686_100627249
348 Ga0070665_101634035
349 Ga0068856_100267646
350 Ga0068863_100269943
351 Ga0068862_100404802
352 Ga0081455_10356367
353 Ga0070717_10106561
354 Ga0075365_10071858
355 Ga0075365_10450528
356 Ga0075365_10797071
357 Ga0075363_100204391
358 Ga0070715_10939809
359 Ga0070716_100251622
360 Ga0070716_100638712
361 Ga0070712_100078280
362 Ga0075428_101818596
363 Ga0075429_100899886
364 Ga0075435_100725932
365 Ga0105240_11361730
366 Ga0111539_10566820
367 Ga0111539_11421618
368 Ga0111539_12338511
369 Ga0114129_10967015
370 Ga0105243_11878354
371 Ga0105243_11881043
372 Ga0105241_10218981
373 Ga0105248_12697139
374 Ga0105246_10235335
375 Ga0157371_10409384
376 Ga0157370_10468898
377 Ga0157369_10023366
378 Ga0157369_10038113
379 Ga0157369_10132716
380 Ga0157378_11594250
381 Ga0163163_10240885
382 Ga0157380_10612576
383 Ga0157380_12226231
384 Ga0157376_10354552
385 Ga0197907_10281526
386 Ga0206349_1021664
387 Ga0206349_1113299
388 Ga0206349_1598043
389 Ga0206349_1846828
390 Ga0206355_1441286
391 Ga0206351_10028925
392 Ga0206351_10070256
393 Ga0206351_10093226
394 Ga0206351_10308969
395 Ga0206351_10329869
396 Ga0206351_10541660
397 Ga0206351_10665811
398 Ga0206351_10691984
399 Ga0206351_10871468
400 Ga0206351_10891331
401 Ga0206350_10423167
402 Ga0206350_10532368
403 Ga0206350_10786459
404 Ga0206350_10978579
405 Ga0206350_11146153
406 Ga0206350_11177926
407 Ga0206350_11226173
408 Ga0206350_11409816
409 Ga0206350_11466823
410 Ga0154015_1157625
411 Ga0154015_1247588
412 Ga0154015_1465140
413 Ga0154015_1585568
414 Ga0154015_1632857
415 Ga0154015_1653620
416 Ga0213873_10000083
417 Ga0213872_10313854
418 Ga0213876_10062347
419 Ga0213875_10000652
420 Ga0213875_10088000
421 Ga0224712_10001134
422 Ga0224712_10014904
423 Ga0224712_10019787
424 Ga0224712_10061050
425 Ga0224712_10132694
426 Ga0224712_10158066
427 Ga0224712_10166207
428 Ga0224712_10254536
429 Ga0224712_10265617
430 Ga0224712_10383207
431 Ga0224712_10460628
432 Ga0207692_10028859
433 Ga0207692_10124914
434 Ga0207642_10424947
435 Ga0207710_10360173
436 Ga0207685_10340270
437 Ga0207699_10021089
438 Ga0207707_10045046
439 Ga0207693_10023631
440 Ga0207693_10217044
441 Ga0207663_10294856
442 Ga0207663_10491442
443 Ga0207663_10810659
444 Ga0207660_10010819
445 Ga0207657_10117716
446 Ga0207650_11137275
447 Ga0207700_10020927
448 Ga0207700_10130414
449 Ga0207700_10304181
450 Ga0207700_10910951
451 Ga0207664_10005255
452 Ga0207664_10009673
453 Ga0207664_10019333
454 Ga0207664_10277845
455 Ga0207644_10861261
456 Ga0207665_10486174
457 Ga0207665_10936551
458 Ga0207661_10009748
459 Ga0207677_10330024
460 Ga0207678_10118034
461 Ga0207702_12037378
462 Ga0207683_12137598
463 Ga0207698_10363177
464 Ga0207428_10004286
465 Ga0207428_10142439
466 Ga0265337_1003919
467 Ga0265326_10006942
468 Ga0265319_1001688
469 Ga0265334_10008404
470 Ga0265318_10217290
471 Ga0265323_10004042
472 Ga0265322_10067201
473 Ga0265336_10024022
474 Ga0265338_10000757
475 Ga0265324_10004364
476 Ga0265332_10003463
477 Ga0265328_10167543
478 Ga0265320_10017416
479 Ga0265325_10062430
480 Ga0265329_10271528
481 Ga0265340_10048306
482 Ga0265339_10148371
483 Ga0265316_10019994
484 Ga0307408_100005745
485 Ga0307408_100042009
486 Ga0307408_100132311
487 Ga0307408_100703851
488 Ga0307408_102059958
489 Ga0265314_10312853
490 Ga0265342_10183562
491 Ga0307405_10305863
492 Ga0307413_10593224
493 Ga0307410_10023368
494 Ga0307410_10210803
495 Ga0307410_10213850
496 Ga0307410_10227754
497 Ga0307410_11802505
498 Ga0307406_10049408
499 Ga0307407_10003012
500 Ga0307407_10051924
501 Ga0307407_10227260
502 Ga0307412_10080710
503 Ga0307412_10206295
504 Ga0307412_10390184
505 Ga0307409_100037821
506 Ga0307409_100038457
507 Ga0307409_101120065
508 Ga0307416_100049260
509 Ga0307416_100152607
510 Ga0307416_100590863
511 Ga0307416_100629403
512 Ga0307416_101557051
513 Ga0307416_102161216
514 Ga0307416_102195395
515 Ga0307414_10180142
516 Ga0307414_10439058
517 Ga0307415_100031125
518 Ga0307415_100416088
519 Ga0373955_0867304
520 Ga0373924_0183340
521 Ga0395899_0014751
522 Ga0395899_0020221
523 Ga0395900_0083279
524 Ga0395900_0877472
525 Ga0395898_0012596
526 Ga0395898_0024221
527 Ga0395898_0108717
528 Ga0395905_0173996
529 Ga0395905_0288511
530 Ga0395905_0394201
531 Ga0436364_0080425
532 Ga0436364_0090304
533 Ga0436364_0592530
534 Ga0436364_0643029
535 Ga0436364_1492002
536 Ga0395901_0142794
537 Ga0395901_0147838
538 Ga0395901_0615438
539 Ga0436365_0906999
540 Ga0436363_0799493
541 Ga0436362_0017650
542 Ga0436362_0722501
543 Ga0439436_0011623
544 Ga0439439_0025892
545 Ga0439439_0030795
546 Ga0439447_058157
547 Ga0439447_071553
548 Ga0439466_0063794
549 Ga0439466_0171367
550 Ga0451839_0016129
551 Ga0451853_0136513
552 Ga0451853_4106689
553 Ga0439433_0011998
554 Ga0439433_0012961
555 Ga0439433_0014162
556 Ga0439433_0093885
557 Ga0439442_000191
558 Ga0439449_0026334
559 Ga0439449_0043204
560 Ga0439452_072436
561 Ga0439457_007253
562 Ga0439462_0016499
563 Ga0450920_026227
564 Ga0450907_002229
565 Ga0439434_0000187
566 Ga0439434_0046548
567 Ga0450918_000581
568 Ga0466965_0863125
569 Ga0466966_0001420
570 Ga0466963_0007319
571 Ga0466963_0886236
572 Ga0466971_0003478
573 Ga0466968_0000089
574 Ga0466968_0279654
575 Ga0466968_0531930
576 Ga0466970_0002921
577 Ga0466957_0008919
578 Ga0466960_0003387
579 Ga0466958_0019679
580 Ga0466967_0539344
581 Ga0495608_0106767
582 Ga0495667_0151796
583 Ga0495657_0446986
584 Ga0495613_1121966
585 Ga0495672_0189934
586 Ga0495675_0828035
587 Ga0496101_0609760
588 Ga0496103_0047630
589 Ga0496105_1247553
590 Ga0496108_0965981
591 Ga0496109_1330162
592 Ga0496110_0058671
593 Ga0496113_0770596
594 Ga0496114_0668322
595 Ga0496114_1052644
596 Ga0496114_1567947
597 Ga0496115_0094327
598 Ga0496126_0014002
599 Ga0501033_0734305
600 Ga0501034_0749945
601 Ga0501036_1094924
602 Ga0501038_0070087
603 Ga0501038_0854727
604 Ga0501039_0551728
605 Ga0501040_0361137
606 Ga0501043_0097349
607 Ga0501071_0657277
608 Ga0501072_0297113
609 Ga0501072_1058528
610 Ga0501075_1270586
611 Ga0501076_1107503
612 Ga0501079_0298196
613 Ga0501044_0737729
614 Ga0501045_0183312
615 nmdc:mga03n38_319925_c1
616 nmdc:mga0yw44_377004_c1
617 nmdc:mga0yw44_401976_c1
618 nmdc:mga05p37_667063_c1
619 nmdc:mga09592_888053_c1
620 nmdc:mga08x19_190876_c1
621 Ga0501084_0086407
622 Ga0587072_014375
623 Ga0587114_111009
624 Ga0501082_0641601
625 Ga0466962_0162270
626 Ga0530510_0933053
627 2808828542
628 2808877622
629 2808899078
630 2808916308
631 2809591283
632 2862707239
633 2945960672
634 2954711966
635 2954721905
636 2954739948
637 2954740799
638 2954758767
639 2954759807
640 8008489729
641 8025528695
642 8056673027

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00011

HSP20

Hsp20/alpha crystallin family

31

133

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5zul-assembly1.cif.gz_E-2 small heat shock protein from mycobacterium marinum m : form-3 0.9029 37 133
5zul-assembly1.cif.gz_E-2 small heat shock protein from mycobacterium marinum m : form-3 0.8937 37 133
2h50-assembly1.cif.gz_P multiple distinct assemblies reveal conformational flexibility in the small heat shock protein hsp26 0.891 44 132
5zul-assembly1.cif.gz_A-2 small heat shock protein from mycobacterium marinum m : form-3 0.8909 37 133
5zul-assembly1.cif.gz_A-2 small heat shock protein from mycobacterium marinum m : form-3 0.8822 37 133
ID Description Score Start End Superfamily
5ds2D00 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8777 42 132 2.60.40.790
af_F4K6X6_3_101_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.865 42 135 2.60.40.790
af_Q0E4A8_70_176_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8603 44 144 2.60.40.790
af_Q208N7_181_285_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8595 43 134 2.60.40.790
af_I1M7E1_1_101_2.60.40.790 Mainly Beta;Sandwich;Immunoglobulin-like; 0.8581 42 133 2.60.40.790
ID Description Score Start End GO Terms
AF-A0A3M1V4Z6-F1-model_v4 Hsp20/alpha crystallin family protein 0.9232 42 146
AF-C4ANX2-F1-model_v4 deleted 0.9204 46 144
AF-A0A4Q0MV17-F1-model_v4 deleted 0.9148 42 144
AF-A0A2V8UYI6-F1-model_v4 Heat-shock protein Hsp20 0.8977 46 148
AF-A0A257W7T4-F1-model_v4 SHSP domain-containing protein 0.89 43 117

Map