F405882

General Info

Members Datasets Scaffolds Average Seq Length
321 211 642 258

Family's Representative Sequence

Representative Sequence 3300005544|Ga0070686_100054103|Ga0070686_1000541032
Length 289
Sequence MAVRKARPRRPLQPKKKTSLQCGRFTLPLEKPLLMGVVNVTPDSFSDGGRFEDAEAAIAHAHSLIDDGAHILDVGGESSRPGAAPVSVDEELRRVLPVVRQLRDVPVSVDTRRPEVMRAALDFGASMINDIEALSAPGALAAIARSDCAVCLMHKQGEPATMQRDPHYDDVVGEVKAFLEQRVKAARDAGIAADRIVVDPGFGFGKTVAHNLQLLRDLEKFSSLELPLLAGLSRKSSLAKITGRAVGERLAGSLAMALLALQGGARILRVHDVKETRDVIAVWEAFNNA

Samples

Sample ID Description Type Environment
1 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
24 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
25 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
42 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
100 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
102 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
103 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
104 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
107 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
108 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
109 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
110 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
111 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
112 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
113 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
114 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
115 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
116 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
117 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
118 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
119 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
120 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
121 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
122 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
123 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
124 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
125 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
126 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
127 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
128 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
129 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
130 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
131 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
132 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
133 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
134 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
135 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
136 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
137 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
138 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
139 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
140 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
141 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
142 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
143 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
144 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
145 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
146 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
147 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
148 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
149 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
150 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
151 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
152 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
153 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
154 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
155 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
156 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
157 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
158 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
159 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
160 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
161 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
162 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
163 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
164 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
165 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
166 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
167 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
168 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
169 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
170 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
172 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
184 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
185 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
186 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
187 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
188 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
189 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
190 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
191 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
192 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
193 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
194 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
195 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
196 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
199 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
200 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
201 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
202 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
205 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
206 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
207 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
208 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
209 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
210 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
211 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.31
Rhizosphere 99.38
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070686_100054103 3300005544 Bacteria 2566
2 JGI25406J46586_10069992 3300003203 Bacteria 1104
3 Ga0065707_10095922 3300005295 Bacteria 3322
4 Ga0070683_100175229 3300005329 Bacteria 2036
5 Ga0070690_100007605 3300005330 Bacteria 6206
6 Ga0070690_100122453 3300005330 Bacteria 1747
7 Ga0070690_100151442 3300005330 Bacteria 1583
8 Ga0068869_100001828 3300005334 Bacteria 12783
9 Ga0070680_100050716 3300005336 Bacteria 3385
10 Ga0070680_100229200 3300005336 Bacteria 1569
11 Ga0070689_100016494 3300005340 Bacteria 5406
12 Ga0070689_100033249 3300005340 Bacteria 3928
13 Ga0070691_10037924 3300005341 Bacteria 2274
14 Ga0070687_100002716 3300005343 Bacteria 6701
15 Ga0070692_10020987 3300005345 Bacteria 3174
16 Ga0070692_10074903 3300005345 Bacteria 1811
17 Ga0070673_100126817 3300005364 Bacteria 2137
18 Ga0070688_100035178 3300005365 Bacteria 3041
19 Ga0070710_10141781 3300005437 Bacteria 1474
20 Ga0070701_10003142 3300005438 Bacteria 6480
21 Ga0070705_100004359 3300005440 Bacteria 6888
22 Ga0070700_100008264 3300005441 Bacteria 5667
23 Ga0070694_100000696 3300005444 Bacteria 18697
24 Ga0070694_100278731 3300005444 Bacteria 1274
25 Ga0070681_10017658 3300005458 Bacteria 7130
26 Ga0068867_100003703 3300005459 Bacteria 10751
27 Ga0070699_100162196 3300005518 Bacteria 1979
28 Ga0070699_100165623 3300005518 Bacteria 1958
29 Ga0070679_100064102 3300005530 Bacteria 3662
30 Ga0070697_100022023 3300005536 Bacteria 5056
31 Ga0070697_100731206 3300005536 Bacteria 874
32 Ga0070686_100014635 3300005544 Bacteria 4526
33 Ga0070686_100196935 3300005544 Bacteria 1442
34 Ga0070695_100000426 3300005545 Bacteria 21798
35 Ga0070695_100038429 3300005545 Bacteria 3020
36 Ga0070695_100101237 3300005545 Bacteria 1941
37 Ga0070695_100323266 3300005545 Bacteria 1147
38 Ga0070696_100000247 3300005546 Bacteria 32511
39 Ga0070696_100001285 3300005546 Bacteria 16351
40 Ga0070696_100133041 3300005546 Bacteria 1811
41 Ga0070696_100247561 3300005546 Bacteria 1347
42 Ga0070693_100000356 3300005547 Bacteria 20752
43 Ga0070704_100000099 3300005549 Bacteria 30058
44 Ga0070704_100054762 3300005549 Bacteria 2824
45 Ga0068855_100002434 3300005563 Bacteria 22992
46 Ga0068855_100262138 3300005563 Bacteria 1925
47 Ga0068857_100291396 3300005577 Bacteria 1503
48 Ga0068854_100011910 3300005578 Bacteria 5682
49 Ga0068856_100075742 3300005614 Bacteria 3333
50 Ga0068856_100179882 3300005614 Bacteria 2127
51 Ga0070702_100000982 3300005615 Bacteria 11248
52 Ga0068852_100113423 3300005616 Bacteria 2468
53 Ga0068859_100002131 3300005617 Bacteria 20153
54 Ga0068864_100156645 3300005618 Bacteria 2068
55 Ga0068866_10000453 3300005718 Bacteria 18807
56 Ga0068861_100023883 3300005719 Bacteria 4415
57 Ga0068858_100016860 3300005842 Bacteria 6859
58 Ga0068858_100150290 3300005842 Bacteria 2190
59 Ga0068860_100023885 3300005843 Bacteria 5909
60 Ga0068862_100051709 3300005844 Bacteria 3514
61 Ga0081539_10000178 3300005985 Bacteria 149201
62 Ga0070715_10032252 3300006163 Bacteria 2133
63 Ga0070716_100079481 3300006173 Bacteria 1953
64 Ga0097621_100001473 3300006237 Bacteria 16111
65 Ga0068871_100037452 3300006358 Bacteria 3868
66 Ga0075428_100005900 3300006844 Bacteria 13610
67 Ga0075428_100039132 3300006844 Bacteria 5219
68 Ga0075430_100007298 3300006846 Bacteria 9334
69 Ga0075430_100021056 3300006846 Bacteria 5543
70 Ga0075430_100046999 3300006846 Bacteria 3644
71 Ga0075431_100163460 3300006847 Bacteria 2289
72 Ga0075431_100186438 3300006847 Bacteria 2127
73 Ga0075433_10019508 3300006852 Bacteria 5652
74 Ga0075433_10058892 3300006852 Bacteria 3360
75 Ga0075433_10276621 3300006852 Bacteria 1488
76 Ga0075434_100004064 3300006871 Bacteria 13112
77 Ga0075434_100281769 3300006871 Bacteria 1682
78 Ga0075429_100002565 3300006880 Bacteria 15314
79 Ga0068865_100020285 3300006881 Bacteria 4310
80 Ga0075436_100003426 3300006914 Bacteria 10873
81 Ga0075436_100015077 3300006914 Bacteria 5296
82 Ga0097620_100002131 3300006931 Bacteria 20153
83 Ga0075435_100000454 3300007076 Bacteria 25078
84 Ga0099794_10016378 3300007265 Bacteria 3285
85 Ga0111539_10024887 3300009094 Bacteria 7340
86 Ga0111539_10050325 3300009094 Bacteria 4963
87 Ga0111539_10154563 3300009094 Bacteria 2685
88 Ga0105245_10004138 3300009098 Bacteria 12886
89 Ga0114129_10048224 3300009147 Bacteria 5986
90 Ga0114129_10167203 3300009147 Bacteria 3000
91 Ga0105243_10008328 3300009148 Bacteria 7963
92 Ga0105242_10002122 3300009176 Bacteria 15648
93 Ga0105249_10004985 3300009553 Bacteria 11454
94 Ga0157378_10005053 3300013297 Bacteria 11582
95 Ga0163162_10479382 3300013306 Bacteria 1375
96 Ga0157376_10026156 3300014969 Bacteria 4608
97 Ga0163161_10114127 3300017792 Bacteria 2023
98 Ga0207692_10094941 3300025898 Bacteria 1625
99 Ga0207642_10002410 3300025899 Bacteria 5827
100 Ga0207707_10015157 3300025912 Bacteria 6710
101 Ga0207660_10003907 3300025917 Bacteria 9709
102 Ga0207662_10001502 3300025918 Bacteria 11338
103 Ga0207652_10100171 3300025921 Bacteria 2558
104 Ga0207687_10001349 3300025927 Bacteria 16797
105 Ga0207686_10002042 3300025934 Bacteria 11126
106 Ga0207709_10002069 3300025935 Bacteria 12959
107 Ga0207670_10000958 3300025936 Bacteria 15220
108 Ga0207670_10092734 3300025936 Bacteria 2138
109 Ga0207704_10000960 3300025938 Bacteria 12763
110 Ga0207689_10010499 3300025942 Bacteria 7975
111 Ga0207661_10042348 3300025944 Bacteria 3590
112 Ga0207667_10011352 3300025949 Bacteria 10360
113 Ga0207667_10237619 3300025949 Bacteria 1865
114 Ga0207640_10008408 3300025981 Bacteria 5732
115 Ga0207677_10004489 3300026023 Bacteria 7502
116 Ga0207703_10180002 3300026035 Bacteria 1865
117 Ga0207708_10011187 3300026075 Bacteria 6677
118 Ga0207702_10065519 3300026078 Bacteria 3112
119 Ga0207648_10001765 3300026089 Bacteria 23684
120 Ga0207674_10389997 3300026116 Bacteria 1346
121 Ga0207675_100016352 3300026118 Bacteria 6925
122 Ga0207698_10022364 3300026142 Bacteria 4392
123 Ga0209969_1002420 3300027360 Bacteria 2580
124 Ga0209967_1002995 3300027364 Bacteria 2215
125 Ga0209981_1016845 3300027378 Bacteria 1029
126 Ga0210000_1000743 3300027462 Bacteria 4521
127 Ga0209999_1000884 3300027543 Bacteria 5017
128 Ga0209999_1022541 3300027543 Bacteria 1159
129 Ga0209588_1022985 3300027671 Bacteria 1964
130 Ga0209966_1006071 3300027695 Bacteria 2089
131 Ga0209998_10012738 3300027717 Bacteria 1748
132 Ga0209974_10055510 3300027876 Bacteria 1336
133 Ga0207428_10095522 3300027907 Bacteria 2303
134 Ga0268264_10004292 3300028381 Bacteria 12165
135 Ga0307408_100274936 3300031548 Bacteria 1400
136 Ga0307408_100471442 3300031548 Bacteria 1093
137 Ga0307413_10198471 3300031824 Bacteria 1447
138 Ga0307406_10169985 3300031901 Bacteria 1577
139 Ga0307409_100193768 3300031995 Bacteria 1812
140 Ga0307416_100008349 3300032002 Bacteria 6673
141 Ga0307416_100140833 3300032002 Bacteria 2192
142 Ga0307416_100151538 3300032002 Bacteria 2127
143 Ga0307411_10357229 3300032005 Bacteria 1193
144 Ga0307411_10370233 3300032005 Bacteria 1175
145 Ga0373930_0027569 3300034816 Bacteria 1152
146 Ga0373948_0023743 3300034817 Bacteria 1191
147 Ga0373926_0003159 3300035083 Bacteria 5286
148 Ga0373923_0149658 3300035111 Bacteria 1059
149 Ga0373932_0003000 3300035112 Bacteria 4138
150 Ga0373939_0006208 3300035114 Bacteria 2874
151 Ga0373941_0021922 3300035115 Bacteria 1808
152 Ga0373945_0024100 3300035116 Bacteria 2106
153 Ga0373954_0000255 3300035118 Bacteria 19287
154 Ga0373957_0015555 3300035120 Bacteria 2621
155 Ga0373960_0027086 3300035121 Bacteria 1571
156 Ga0373960_0062207 3300035121 Bacteria 1135
157 Ga0373943_0017957 3300035170 Bacteria 3244
158 Ga0373946_0002819 3300035171 Bacteria 6148
159 Ga0373955_0098024 3300035172 Bacteria 1679
160 Ga0373942_0008732 3300035207 Bacteria 2367
161 Ga0373931_0000432 3300035691 Bacteria 17012
162 Ga0373931_0003851 3300035691 Bacteria 6783
163 Ga0373931_0058185 3300035691 Bacteria 2075
164 Ga0373931_0319413 3300035691 Bacteria 964
165 Ga0373935_0030401 3300035692 Bacteria 3347
166 Ga0373937_0022363 3300036401 Bacteria 5685
167 Ga0373937_0048813 3300036401 Bacteria 3875
168 Ga0242420_031264 3300038996 Bacteria 988
169 Ga0436363_0007511 3300039450 Bacteria 1225
170 Ga0439453_0035473 3300041408 Bacteria 961
171 Ga0439441_000429 3300042001 Bacteria 4447
172 Ga0439443_000683 3300042003 Bacteria 3257
173 Ga0439443_001999 3300042003 Bacteria 2376
174 Ga0439435_0013354 3300042436 Bacteria 2006
175 Ga0439460_0001085 3300042461 Bacteria 6330
176 Ga0451577_0059644 3300042876 Bacteria 3402
177 Ga0451577_0161028 3300042876 Bacteria 2021
178 Ga0451576_0017692 3300045051 Bacteria 7833
179 Ga0451576_0028150 3300045051 Bacteria 6024
180 Ga0451576_0280119 3300045051 Bacteria 1743
181 Ga0451576_0533054 3300045051 Bacteria 1233
182 Ga0495592_0000957 3300046454 Bacteria 19997
183 Ga0495603_0039021 3300046455 Bacteria 2846
184 Ga0495580_0009898 3300046472 Bacteria 7465
185 Ga0495582_0089710 3300046473 Bacteria 1713
186 Ga0495582_0246631 3300046473 Bacteria 1024
187 Ga0495639_0096162 3300046475 Bacteria 1394
188 Ga0495662_0006738 3300046476 Bacteria 5720
189 Ga0495662_0022819 3300046476 Bacteria 3021
190 Ga0495594_0174977 3300046499 Bacteria 1221
191 Ga0495608_0003744 3300046511 Bacteria 10915
192 Ga0495618_0209729 3300046514 Bacteria 1231
193 Ga0495628_0019341 3300046516 Bacteria 5631
194 Ga0495630_0283900 3300046517 Bacteria 1265
195 Ga0495666_0025209 3300046526 Bacteria 2937
196 Ga0495642_0011079 3300046528 Bacteria 3459
197 Ga0495642_0088278 3300046528 Bacteria 1311
198 Ga0495652_0068938 3300046529 Bacteria 2962
199 Ga0495640_0064243 3300046533 Bacteria 2482
200 Ga0495586_0000534 3300046535 Bacteria 22170
201 Ga0495586_0017996 3300046535 Bacteria 3757
202 Ga0495586_0018974 3300046535 Bacteria 3661
203 Ga0495587_0037078 3300046536 Bacteria 2930
204 Ga0495645_0038931 3300046543 Bacteria 3468
205 Ga0495667_0038259 3300046559 Bacteria 3195
206 Ga0495634_0028238 3300046642 Bacteria 3896
207 Ga0495659_0014299 3300046664 Bacteria 2597
208 Ga0495659_0123976 3300046664 Bacteria 1020
209 Ga0495657_0139533 3300046675 Bacteria 1512
210 Ga0495599_0004632 3300046678 Bacteria 8151
211 Ga0495623_0203204 3300046679 Bacteria 1138
212 Ga0495658_0003079 3300046683 Bacteria 8344
213 Ga0495658_0011699 3300046683 Bacteria 4421
214 Ga0495669_0031520 3300046684 Bacteria 2328
215 Ga0495613_0002871 3300046689 Bacteria 12898
216 Ga0495624_0117240 3300046690 Bacteria 1636
217 Ga0495624_0193049 3300046690 Bacteria 1238
218 Ga0495600_0047838 3300046809 Bacteria 2790
219 Ga0495581_0072185 3300047315 Bacteria 1997
220 Ga0495604_0097264 3300047317 Bacteria 2171
221 Ga0495636_0001281 3300047318 Bacteria 9529
222 Ga0495636_0054651 3300047318 Bacteria 1678
223 Ga0495674_0528117 3300047319 Bacteria 941
224 Ga0495676_0154584 3300047321 Bacteria 1629
225 Ga0495680_0056039 3300047322 Bacteria 3053
226 Ga0496106_0124453 3300048909 Bacteria 2018
227 Ga0501032_0169514 3300049569 Bacteria 1432
228 Ga0501033_0001144 3300049570 Bacteria 23971
229 Ga0501033_0178648 3300049570 Bacteria 1522
230 Ga0501036_0001050 3300049572 Bacteria 20857
231 Ga0501036_0116665 3300049572 Bacteria 2255
232 Ga0501036_0235640 3300049572 Bacteria 1535
233 Ga0501036_0460932 3300049572 Bacteria 1059
234 Ga0501037_0210987 3300049573 Bacteria 1369
235 Ga0501038_0078661 3300049574 Bacteria 2782
236 Ga0501038_0261292 3300049574 Bacteria 1368
237 Ga0501039_0001846 3300049575 Bacteria 15638
238 Ga0501039_0008392 3300049575 Bacteria 7873
239 Ga0501039_0182509 3300049575 Bacteria 1650
240 Ga0501040_0000994 3300049576 Bacteria 17940
241 Ga0501040_0001917 3300049576 Bacteria 13370
242 Ga0501040_0044693 3300049576 Bacteria 3020
243 Ga0501041_0006800 3300049577 Bacteria 6701
244 Ga0501041_0016879 3300049577 Bacteria 4344
245 Ga0501041_0020249 3300049577 Bacteria 3976
246 Ga0501041_0089050 3300049577 Bacteria 1905
247 Ga0501042_0000247 3300049578 Bacteria 26226
248 Ga0501042_0079296 3300049578 Bacteria 2352
249 Ga0501043_0014782 3300049579 Bacteria 6112
250 Ga0501043_0394749 3300049579 Bacteria 1046
251 Ga0501046_0000518 3300049580 Bacteria 38078
252 Ga0501046_0080072 3300049580 Bacteria 2525
253 Ga0501047_0107223 3300049581 Bacteria 2675
254 Ga0501048_0000316 3300049582 Bacteria 33108
255 Ga0501048_0075413 3300049582 Bacteria 2379
256 Ga0501048_0167358 3300049582 Bacteria 1557
257 Ga0501068_0321691 3300049584 Bacteria 992
258 Ga0501069_0252737 3300049585 Bacteria 1028
259 Ga0501070_0073561 3300049586 Bacteria 2828
260 Ga0501071_0002564 3300049587 Bacteria 11083
261 Ga0501071_0042671 3300049587 Bacteria 3251
262 Ga0501071_0255083 3300049587 Bacteria 1324
263 Ga0501072_0000833 3300049588 Bacteria 22700
264 Ga0501072_0003005 3300049588 Bacteria 12717
265 Ga0501072_0056268 3300049588 Bacteria 3100
266 Ga0501073_0074653 3300049589 Bacteria 2361
267 Ga0501074_0037993 3300049590 Bacteria 3490
268 Ga0501075_0000258 3300049591 Bacteria 28848
269 Ga0501075_0000575 3300049591 Bacteria 22398
270 Ga0501075_0045147 3300049591 Bacteria 3307
271 Ga0501076_0000558 3300049592 Bacteria 23724
272 Ga0501076_0004293 3300049592 Bacteria 10105
273 Ga0501076_0178436 3300049592 Bacteria 1731
274 Ga0501077_0000798 3300049593 Bacteria 19043
275 Ga0501077_0089129 3300049593 Bacteria 1955
276 Ga0501077_0196871 3300049593 Bacteria 1280
277 Ga0501079_0000599 3300049741 Bacteria 23916
278 Ga0501079_0059132 3300049741 Bacteria 2957
279 Ga0501080_0013287 3300049742 Bacteria 7566
280 Ga0501080_0142690 3300049742 Bacteria 2214
281 Ga0501080_0483069 3300049742 Bacteria 1108
282 Ga0501080_0525106 3300049742 Bacteria 1056
283 Ga0501081_0000242 3300049743 Bacteria 27990
284 Ga0501081_0041756 3300049743 Bacteria 3142
285 Ga0501081_0199488 3300049743 Bacteria 1451
286 Ga0501081_0390625 3300049743 Bacteria 1029
287 Ga0501035_0113677 3300049822 Bacteria 2371
288 Ga0501044_0149236 3300049823 Bacteria 2321
289 Ga0501045_0002234 3300049824 Bacteria 13156
290 Ga0501045_0084029 3300049824 Bacteria 2348
291 Ga0501045_0098917 3300049824 Bacteria 2158
292 Ga0501045_0153692 3300049824 Bacteria 1712
293 Ga0501045_0550271 3300049824 Bacteria 856
294 nmdc:mga05p37_77603_c1 3300050507 Bacteria 4089
295 nmdc:mga09592_14983_c1 3300050508 Bacteria 6333
296 nmdc:mga09592_18475_c1 3300050508 Bacteria 5718
297 nmdc:mga0qj67_46771_c1 3300050509 Bacteria 3417
298 nmdc:mga0qj67_60915_c1 3300050509 Bacteria 2996
299 nmdc:mga06r32_123978_c1 3300050510 Bacteria 2550
300 nmdc:mga06r32_178148_c1 3300050510 Bacteria 2111
301 nmdc:mga08y16_106474_c1 3300050511 Bacteria 2919
302 nmdc:mga08y16_301109_c1 3300050511 Bacteria 1653
303 nmdc:mga08y16_6669_c1 3300050511 Bacteria 12110
304 nmdc:mga0n895_10431_c1 3300050512 Bacteria 8206
305 nmdc:mga0n895_13127_c1 3300050512 Bacteria 7457
306 nmdc:mga0n895_466768_c1 3300050512 Bacteria 1274
307 nmdc:mga0n895_7269_c1 3300050512 Bacteria 9487
308 nmdc:mga0rr50_1209_c1 3300050513 Bacteria 14036
309 nmdc:mga0rr50_13135_c1 3300050513 Bacteria 5379
310 nmdc:mga0rr50_396356_c1 3300050513 Bacteria 1165
311 nmdc:mga08x19_1118_c1 3300050514 Bacteria 16743
312 nmdc:mga08x19_118272_c1 3300050514 Bacteria 1774
313 nmdc:mga0a205_3933_c1 3300050515 Bacteria 13298
314 Ga0495612_0172440 3300053078 Bacteria 948
315 Ga0501084_0000698 3300054114 Bacteria 25733
316 Ga0501084_0056260 3300054114 Bacteria 3291
317 Ga0501084_0091013 3300054114 Bacteria 2561
318 Ga0501082_0001254 3300060353 Bacteria 22312
319 Ga0501082_0042665 3300060353 Bacteria 3910
320 Ga0530510_0000121 3300061734 Bacteria 44581
321 Ga0530510_0040959 3300061734 Bacteria 3344
322 Ga0070686_100054103
323 JGI25406J46586_10069992
324 Ga0065707_10095922
325 Ga0070683_100175229
326 Ga0070690_100007605
327 Ga0070690_100122453
328 Ga0070690_100151442
329 Ga0068869_100001828
330 Ga0070680_100050716
331 Ga0070680_100229200
332 Ga0070689_100016494
333 Ga0070689_100033249
334 Ga0070691_10037924
335 Ga0070687_100002716
336 Ga0070692_10020987
337 Ga0070692_10074903
338 Ga0070673_100126817
339 Ga0070688_100035178
340 Ga0070710_10141781
341 Ga0070701_10003142
342 Ga0070705_100004359
343 Ga0070700_100008264
344 Ga0070694_100000696
345 Ga0070694_100278731
346 Ga0070681_10017658
347 Ga0068867_100003703
348 Ga0070699_100162196
349 Ga0070699_100165623
350 Ga0070679_100064102
351 Ga0070697_100022023
352 Ga0070697_100731206
353 Ga0070686_100014635
354 Ga0070686_100196935
355 Ga0070695_100000426
356 Ga0070695_100038429
357 Ga0070695_100101237
358 Ga0070695_100323266
359 Ga0070696_100000247
360 Ga0070696_100001285
361 Ga0070696_100133041
362 Ga0070696_100247561
363 Ga0070693_100000356
364 Ga0070704_100000099
365 Ga0070704_100054762
366 Ga0068855_100002434
367 Ga0068855_100262138
368 Ga0068857_100291396
369 Ga0068854_100011910
370 Ga0068856_100075742
371 Ga0068856_100179882
372 Ga0070702_100000982
373 Ga0068852_100113423
374 Ga0068859_100002131
375 Ga0068864_100156645
376 Ga0068866_10000453
377 Ga0068861_100023883
378 Ga0068858_100016860
379 Ga0068858_100150290
380 Ga0068860_100023885
381 Ga0068862_100051709
382 Ga0081539_10000178
383 Ga0070715_10032252
384 Ga0070716_100079481
385 Ga0097621_100001473
386 Ga0068871_100037452
387 Ga0075428_100005900
388 Ga0075428_100039132
389 Ga0075430_100007298
390 Ga0075430_100021056
391 Ga0075430_100046999
392 Ga0075431_100163460
393 Ga0075431_100186438
394 Ga0075433_10019508
395 Ga0075433_10058892
396 Ga0075433_10276621
397 Ga0075434_100004064
398 Ga0075434_100281769
399 Ga0075429_100002565
400 Ga0068865_100020285
401 Ga0075436_100003426
402 Ga0075436_100015077
403 Ga0097620_100002131
404 Ga0075435_100000454
405 Ga0099794_10016378
406 Ga0111539_10024887
407 Ga0111539_10050325
408 Ga0111539_10154563
409 Ga0105245_10004138
410 Ga0114129_10048224
411 Ga0114129_10167203
412 Ga0105243_10008328
413 Ga0105242_10002122
414 Ga0105249_10004985
415 Ga0157378_10005053
416 Ga0163162_10479382
417 Ga0157376_10026156
418 Ga0163161_10114127
419 Ga0207692_10094941
420 Ga0207642_10002410
421 Ga0207707_10015157
422 Ga0207660_10003907
423 Ga0207662_10001502
424 Ga0207652_10100171
425 Ga0207687_10001349
426 Ga0207686_10002042
427 Ga0207709_10002069
428 Ga0207670_10000958
429 Ga0207670_10092734
430 Ga0207704_10000960
431 Ga0207689_10010499
432 Ga0207661_10042348
433 Ga0207667_10011352
434 Ga0207667_10237619
435 Ga0207640_10008408
436 Ga0207677_10004489
437 Ga0207703_10180002
438 Ga0207708_10011187
439 Ga0207702_10065519
440 Ga0207648_10001765
441 Ga0207674_10389997
442 Ga0207675_100016352
443 Ga0207698_10022364
444 Ga0209969_1002420
445 Ga0209967_1002995
446 Ga0209981_1016845
447 Ga0210000_1000743
448 Ga0209999_1000884
449 Ga0209999_1022541
450 Ga0209588_1022985
451 Ga0209966_1006071
452 Ga0209998_10012738
453 Ga0209974_10055510
454 Ga0207428_10095522
455 Ga0268264_10004292
456 Ga0307408_100274936
457 Ga0307408_100471442
458 Ga0307413_10198471
459 Ga0307406_10169985
460 Ga0307409_100193768
461 Ga0307416_100008349
462 Ga0307416_100140833
463 Ga0307416_100151538
464 Ga0307411_10357229
465 Ga0307411_10370233
466 Ga0373930_0027569
467 Ga0373948_0023743
468 Ga0373926_0003159
469 Ga0373923_0149658
470 Ga0373932_0003000
471 Ga0373939_0006208
472 Ga0373941_0021922
473 Ga0373945_0024100
474 Ga0373954_0000255
475 Ga0373957_0015555
476 Ga0373960_0027086
477 Ga0373960_0062207
478 Ga0373943_0017957
479 Ga0373946_0002819
480 Ga0373955_0098024
481 Ga0373942_0008732
482 Ga0373931_0000432
483 Ga0373931_0003851
484 Ga0373931_0058185
485 Ga0373931_0319413
486 Ga0373935_0030401
487 Ga0373937_0022363
488 Ga0373937_0048813
489 Ga0242420_031264
490 Ga0436363_0007511
491 Ga0439453_0035473
492 Ga0439441_000429
493 Ga0439443_000683
494 Ga0439443_001999
495 Ga0439435_0013354
496 Ga0439460_0001085
497 Ga0451577_0059644
498 Ga0451577_0161028
499 Ga0451576_0017692
500 Ga0451576_0028150
501 Ga0451576_0280119
502 Ga0451576_0533054
503 Ga0495592_0000957
504 Ga0495603_0039021
505 Ga0495580_0009898
506 Ga0495582_0089710
507 Ga0495582_0246631
508 Ga0495639_0096162
509 Ga0495662_0006738
510 Ga0495662_0022819
511 Ga0495594_0174977
512 Ga0495608_0003744
513 Ga0495618_0209729
514 Ga0495628_0019341
515 Ga0495630_0283900
516 Ga0495666_0025209
517 Ga0495642_0011079
518 Ga0495642_0088278
519 Ga0495652_0068938
520 Ga0495640_0064243
521 Ga0495586_0000534
522 Ga0495586_0017996
523 Ga0495586_0018974
524 Ga0495587_0037078
525 Ga0495645_0038931
526 Ga0495667_0038259
527 Ga0495634_0028238
528 Ga0495659_0014299
529 Ga0495659_0123976
530 Ga0495657_0139533
531 Ga0495599_0004632
532 Ga0495623_0203204
533 Ga0495658_0003079
534 Ga0495658_0011699
535 Ga0495669_0031520
536 Ga0495613_0002871
537 Ga0495624_0117240
538 Ga0495624_0193049
539 Ga0495600_0047838
540 Ga0495581_0072185
541 Ga0495604_0097264
542 Ga0495636_0001281
543 Ga0495636_0054651
544 Ga0495674_0528117
545 Ga0495676_0154584
546 Ga0495680_0056039
547 Ga0496106_0124453
548 Ga0501032_0169514
549 Ga0501033_0001144
550 Ga0501033_0178648
551 Ga0501036_0001050
552 Ga0501036_0116665
553 Ga0501036_0235640
554 Ga0501036_0460932
555 Ga0501037_0210987
556 Ga0501038_0078661
557 Ga0501038_0261292
558 Ga0501039_0001846
559 Ga0501039_0008392
560 Ga0501039_0182509
561 Ga0501040_0000994
562 Ga0501040_0001917
563 Ga0501040_0044693
564 Ga0501041_0006800
565 Ga0501041_0016879
566 Ga0501041_0020249
567 Ga0501041_0089050
568 Ga0501042_0000247
569 Ga0501042_0079296
570 Ga0501043_0014782
571 Ga0501043_0394749
572 Ga0501046_0000518
573 Ga0501046_0080072
574 Ga0501047_0107223
575 Ga0501048_0000316
576 Ga0501048_0075413
577 Ga0501048_0167358
578 Ga0501068_0321691
579 Ga0501069_0252737
580 Ga0501070_0073561
581 Ga0501071_0002564
582 Ga0501071_0042671
583 Ga0501071_0255083
584 Ga0501072_0000833
585 Ga0501072_0003005
586 Ga0501072_0056268
587 Ga0501073_0074653
588 Ga0501074_0037993
589 Ga0501075_0000258
590 Ga0501075_0000575
591 Ga0501075_0045147
592 Ga0501076_0000558
593 Ga0501076_0004293
594 Ga0501076_0178436
595 Ga0501077_0000798
596 Ga0501077_0089129
597 Ga0501077_0196871
598 Ga0501079_0000599
599 Ga0501079_0059132
600 Ga0501080_0013287
601 Ga0501080_0142690
602 Ga0501080_0483069
603 Ga0501080_0525106
604 Ga0501081_0000242
605 Ga0501081_0041756
606 Ga0501081_0199488
607 Ga0501081_0390625
608 Ga0501035_0113677
609 Ga0501044_0149236
610 Ga0501045_0002234
611 Ga0501045_0084029
612 Ga0501045_0098917
613 Ga0501045_0153692
614 Ga0501045_0550271
615 nmdc:mga05p37_77603_c1
616 nmdc:mga09592_14983_c1
617 nmdc:mga09592_18475_c1
618 nmdc:mga0qj67_46771_c1
619 nmdc:mga0qj67_60915_c1
620 nmdc:mga06r32_123978_c1
621 nmdc:mga06r32_178148_c1
622 nmdc:mga08y16_106474_c1
623 nmdc:mga08y16_301109_c1
624 nmdc:mga08y16_6669_c1
625 nmdc:mga0n895_10431_c1
626 nmdc:mga0n895_13127_c1
627 nmdc:mga0n895_466768_c1
628 nmdc:mga0n895_7269_c1
629 nmdc:mga0rr50_1209_c1
630 nmdc:mga0rr50_13135_c1
631 nmdc:mga0rr50_396356_c1
632 nmdc:mga08x19_1118_c1
633 nmdc:mga08x19_118272_c1
634 nmdc:mga0a205_3933_c1
635 Ga0495612_0172440
636 Ga0501084_0000698
637 Ga0501084_0056260
638 Ga0501084_0091013
639 Ga0501082_0001254
640 Ga0501082_0042665
641 Ga0530510_0000121
642 Ga0530510_0040959

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00809

Pterin_bind

Pterin binding enzyme

35

271

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tzn-assembly1.cif.gz_B crystal structure of the yersinia pestis dihydropteroate synthase. 0.9351 1 255
5jq9-assembly1.cif.gz_B yersinia pestis dhps with pterine-sulfa conjugate compound 16 0.927 1 254
3tzn-assembly1.cif.gz_A crystal structure of the yersinia pestis dihydropteroate synthase. 0.925 1 255
5u0v-assembly1.cif.gz_B e. coli dihydropteroate synthase complexed with 6-methylamino-5-nitrosoisocytosine 0.924 1 254
5jq9-assembly1.cif.gz_A yersinia pestis dhps with pterine-sulfa conjugate compound 16 0.9235 1 255
ID Description Score Start End Superfamily
3tznB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Dihydropteroate synthase-like 0.9351 1 255 3.20.20.20
5jq9A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Dihydropteroate synthase-like 0.9235 1 255 3.20.20.20
af_P9WNC9_29_318_3.20.20.20 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Dihydropteroate synthase-like 0.8947 1 254 3.20.20.20
6dayA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Dihydropteroate synthase-like 0.8919 1 255 3.20.20.20
2dzaA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Dihydropteroate synthase-like 0.8916 1 253 3.20.20.20
ID Description Score Start End GO Terms
AF-A0A831KIU4-F1-model_v4 Dihydropteroate synthase 0.9622 133 253 GO:0004156
GO:0005829
GO:0046654
AF-A0A662G2S3-F1-model_v4 Dihydropteroate synthase 0.9572 130 254 GO:0004156
GO:0005829
GO:0046654
AF-A0A1V5QGY5-F1-model_v4 deleted 0.9472 115 252
AF-R9C9G2-F1-model_v4 Dihydropteroate synthase 0.9258 115 255 GO:0004156
GO:0005829
GO:0046654
AF-A0A661AFD4-F1-model_v4 dihydropteroate synthase (EC 2.5.1.15) 0.9253 20 255 GO:0004156
GO:0005829
GO:0046654
GO:0046656
GO:0046872

Map