F405416

General Info

Members Datasets Scaffolds Average Seq Length
320 177 641 453

Family's Representative Sequence

Representative Sequence 3300005445|Ga0070708_100001303|Ga0070708_1000013035
Length 476
Sequence MNSTISDPAFWSRFQFGFTLTYHYLFPQLTMGLAWFLVYWKWRALRTGNEEYNRAVRFWAKIFGLNFAIGVVTGIPMEFQFGTNWASFTRYSGGVIGQTLAMESMFAFFLESAFIGALIWGEKRLGPRYHFVAALGVALGSWLSGFFILVTNAFMQHPVGYRSEANGQLGIASLSGYLLNPWAFVQFTHNQMAALVTGSFVVAAVGAFYVLRGLHPTQAKLYLRGGTFVALIASFLVAFPTGDQQAKMVGKHQPVTLAAMEGRFAGGRMAGVAVIGQPNVAARRLDNPIEVPGALSFLAYGTFASYVHGLEEYPVDAWPDNIELLYYSFHLMITLGTIFIVLMGYASFQNWRGRLMSSPWLLWVLMLAFPFPYIANTVGWMTAELGRQPWLVYGLFHTRDGYSKVVSSGDTIFTLIGFIGLYIVVGLLFLYLEGREIAHGPEEEIVPGGGAVAGNRQVLVPSPAELVANRKAESLV

Samples

Sample ID Description Type Environment
1 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
71 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
74 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
75 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
78 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
79 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
80 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
81 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
82 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
83 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
119 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
120 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
121 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
122 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
123 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
124 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
125 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
126 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
127 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
128 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
129 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
130 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
131 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
132 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
134 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
135 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
136 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
137 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
138 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
139 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
140 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
141 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
142 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
143 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
144 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
145 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
146 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
147 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
148 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
149 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
150 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
151 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
152 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
153 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
154 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
155 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
156 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
157 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
158 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
160 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
161 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
163 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
164 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
165 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
166 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
167 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
168 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
169 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
170 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
171 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
172 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
173 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
174 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
175 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
176 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
177 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.19
Nodule 0
Rhizoplane 2.5
Rhizosphere 91.88
Stem 0
Stem Tuber 0
Unclassified 10.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070708_100001303 3300005445 Bacteria 19134
2 JGI25406J46586_10010880 3300003203 Unclassified 4011
3 rootH2_10022203 3300003320 Bacteria 16754
4 rootH2_10036306 3300003320 Bacteria 6674
5 rootH1_10137265 3300003316 Bacteria 1593
6 rootH1_10137265 3300003323 Bacteria 3744
7 rootH1_10185557 3300003323 Bacteria 4074
8 Ga0065712_10090842 3300005290 Bacteria 2401
9 Ga0065712_10101841 3300005290 Bacteria 2023
10 Ga0065715_10007380 3300005293 Bacteria 3264
11 Ga0065715_10091086 3300005293 Bacteria 6134
12 Ga0065707_10129648 3300005295 Bacteria 1944
13 Ga0070683_100000006 3300005329 Bacteria 361071
14 Ga0070670_100003984 3300005331 Bacteria 12331
15 Ga0070670_100036742 3300005331 Bacteria 4214
16 Ga0070670_100050904 3300005331 Bacteria 3558
17 Ga0068869_100009429 3300005334 Bacteria 6335
18 Ga0070666_10063127 3300005335 Bacteria 2510
19 Ga0070661_100080472 3300005344 Bacteria 2405
20 Ga0070669_100053340 3300005353 Bacteria 2959
21 Ga0070675_100047922 3300005354 Bacteria 3503
22 Ga0070675_100124263 3300005354 Bacteria 2194
23 Ga0070671_100148522 3300005355 Bacteria 1979
24 Ga0070674_100000413 3300005356 Bacteria 21566
25 Ga0070673_100103910 3300005364 Bacteria 2345
26 Ga0070673_100136900 3300005364 Bacteria 2062
27 Ga0070667_100028488 3300005367 Bacteria 4651
28 Ga0070667_100102569 3300005367 Bacteria 2472
29 Ga0070714_100059489 3300005435 Bacteria 3276
30 Ga0070713_100091575 3300005436 Bacteria 2616
31 Ga0070713_100094010 3300005436 Unclassified 2584
32 Ga0070711_100050815 3300005439 Bacteria 2844
33 Ga0070711_100091975 3300005439 Bacteria 2188
34 Ga0070708_100023677 3300005445 Bacteria 5225
35 Ga0070708_100071176 3300005445 Unclassified 3130
36 Ga0070708_100174558 3300005445 Bacteria 2007
37 Ga0070708_100242859 3300005445 Bacteria 1691
38 Ga0070708_100278657 3300005445 Unclassified 1574
39 Ga0070678_100038845 3300005456 Bacteria 3354
40 Ga0070678_100048087 3300005456 Bacteria 3069
41 Ga0070662_100067786 3300005457 Bacteria 2621
42 Ga0068867_100157351 3300005459 Bacteria 1790
43 Ga0070685_10006726 3300005466 Bacteria 5866
44 Ga0070706_100001614 3300005467 Bacteria 23507
45 Ga0070706_100004570 3300005467 Bacteria 13291
46 Ga0070706_100023101 3300005467 Bacteria 5727
47 Ga0070706_100025349 3300005467 Bacteria 5456
48 Ga0070706_100061867 3300005467 Unclassified 3458
49 Ga0070706_100105976 3300005467 Bacteria 2615
50 Ga0070707_100065800 3300005468 Bacteria 3483
51 Ga0070707_100128026 3300005468 Unclassified 2467
52 Ga0070698_100002575 3300005471 Bacteria 19973
53 Ga0070698_100021339 3300005471 Bacteria 6785
54 Ga0070699_100001177 3300005518 Bacteria 24282
55 Ga0070699_100035579 3300005518 Bacteria 4305
56 Ga0070699_100082460 3300005518 Bacteria 2803
57 Ga0070684_100000064 3300005535 Bacteria 68614
58 Ga0070684_100122629 3300005535 Bacteria 2339
59 Ga0070697_100004580 3300005536 Bacteria 10620
60 Ga0070697_100032295 3300005536 Unclassified 4212
61 Ga0070697_100065641 3300005536 Unclassified 2966
62 Ga0070697_100107161 3300005536 Unclassified 2325
63 Ga0070697_100194232 3300005536 Bacteria 1723
64 Ga0068853_100095187 3300005539 Bacteria 2625
65 Ga0068853_100126596 3300005539 Bacteria 2282
66 Ga0070672_100034176 3300005543 Bacteria 3857
67 Ga0070665_100017856 3300005548 Bacteria 7123
68 Ga0070665_100070134 3300005548 Bacteria 3511
69 Ga0070704_100002992 3300005549 Bacteria 9610
70 Ga0070664_100009472 3300005564 Bacteria 7896
71 Ga0070664_100099461 3300005564 Bacteria 2528
72 Ga0068857_100001792 3300005577 Bacteria 17302
73 Ga0068856_100104307 3300005614 Bacteria 2829
74 Ga0070702_100011181 3300005615 Bacteria 4458
75 Ga0068859_100017772 3300005617 Bacteria 7148
76 Ga0068864_100055182 3300005618 Bacteria 3430
77 Ga0068870_10003464 3300005840 Bacteria 6686
78 Ga0068870_10038142 3300005840 Bacteria 2480
79 Ga0068863_100000249 3300005841 Bacteria 57044
80 Ga0068863_100032760 3300005841 Bacteria 4951
81 Ga0068858_100048646 3300005842 Bacteria 3927
82 Ga0068860_100008009 3300005843 Bacteria 10536
83 Ga0068860_100254352 3300005843 Bacteria 1711
84 Ga0081455_10012127 3300005937 Bacteria 8612
85 Ga0081539_10002374 3300005985 Bacteria 26942
86 Ga0070717_10008944 3300006028 Bacteria 7506
87 Ga0070717_10042188 3300006028 Unclassified 3721
88 Ga0070717_10057416 3300006028 Bacteria 3217
89 Ga0070715_10009734 3300006163 Bacteria 3399
90 Ga0070716_100077253 3300006173 Bacteria 1975
91 Ga0068871_100054728 3300006358 Bacteria 3238
92 Ga0075428_100001902 3300006844 Bacteria 22397
93 Ga0075428_100011286 3300006844 Bacteria 9937
94 Ga0075428_100018661 3300006844 Bacteria 7667
95 Ga0075428_100108269 3300006844 Bacteria 3029
96 Ga0075428_100330784 3300006844 Unclassified 1636
97 Ga0075430_100001142 3300006846 Bacteria 21182
98 Ga0075430_100144876 3300006846 Bacteria 1979
99 Ga0075431_100000595 3300006847 Bacteria 30575
100 Ga0075433_10002713 3300006852 Bacteria 13522
101 Ga0075433_10018102 3300006852 Bacteria 5849
102 Ga0075433_10030627 3300006852 Bacteria 4592
103 Ga0075434_100022826 3300006871 Bacteria 6092
104 Ga0075434_100023593 3300006871 Bacteria 5999
105 Ga0075434_100027958 3300006871 Bacteria 5537
106 Ga0075434_100044944 3300006871 Bacteria 4381
107 Ga0075429_100001570 3300006880 Bacteria 18757
108 Ga0068865_100047835 3300006881 Bacteria 2941
109 Ga0075436_100080449 3300006914 Bacteria 2258
110 Ga0075436_100110909 3300006914 Unclassified 1915
111 Ga0097620_100017774 3300006931 Bacteria 7148
112 Ga0105240_10113175 3300009093 Bacteria 3279
113 Ga0105240_10224883 3300009093 Bacteria 2184
114 Ga0111539_10016135 3300009094 Bacteria 9268
115 Ga0111539_10106749 3300009094 Bacteria 3285
116 Ga0105245_10000524 3300009098 Bacteria 35130
117 Ga0105245_10000600 3300009098 Bacteria 32652
118 Ga0105245_10010631 3300009098 Bacteria 8007
119 Ga0105245_10090404 3300009098 Bacteria 2816
120 Ga0114129_10009851 3300009147 Bacteria 13631
121 Ga0114129_10014528 3300009147 Bacteria 11221
122 Ga0114129_10041935 3300009147 Bacteria 6444
123 Ga0114129_10047635 3300009147 Bacteria 6023
124 Ga0114129_10049313 3300009147 Bacteria 5915
125 Ga0114129_10179101 3300009147 Bacteria 2886
126 Ga0114129_10571258 3300009147 Bacteria 1468
127 Ga0105241_10013843 3300009174 Bacteria 5908
128 Ga0105248_10017132 3300009177 Bacteria 7982
129 Ga0105248_10025116 3300009177 Bacteria 6624
130 Ga0105248_10061713 3300009177 Unclassified 4209
131 Ga0105237_10001174 3300009545 Bacteria 35013
132 Ga0105237_10010173 3300009545 Bacteria 10024
133 Ga0105237_10029434 3300009545 Bacteria 5583
134 Ga0105249_10026468 3300009553 Bacteria 5226
135 Ga0105249_10049309 3300009553 Bacteria 3840
136 Ga0105249_10106583 3300009553 Bacteria 2644
137 Ga0105249_10208244 3300009553 Bacteria 1917
138 Ga0105246_10005604 3300011119 Bacteria 7657
139 Ga0105246_10015230 3300011119 Bacteria 4852
140 Ga0157369_10030064 3300013105 Bacteria 5994
141 Ga0157374_10000179 3300013296 Bacteria 58866
142 Ga0157374_10357993 3300013296 Bacteria 1451
143 Ga0157374_10364794 3300013296 Unclassified 1437
144 Ga0157378_10007907 3300013297 Bacteria 9275
145 Ga0157378_10280240 3300013297 Bacteria 1607
146 Ga0163162_10025728 3300013306 Bacteria 5818
147 Ga0163162_10049319 3300013306 Bacteria 4219
148 Ga0163162_10068965 3300013306 Bacteria 3588
149 Ga0157375_10019115 3300013308 Bacteria 6223
150 Ga0157375_10088293 3300013308 Bacteria 3155
151 Ga0157375_10232920 3300013308 Bacteria 2001
152 Ga0163163_10000819 3300014325 Bacteria 26496
153 Ga0163163_10193211 3300014325 Bacteria 2083
154 Ga0163163_10384684 3300014325 Bacteria 1461
155 Ga0157380_10019185 3300014326 Bacteria 5093
156 Ga0157380_10174805 3300014326 Bacteria 1880
157 Ga0157380_10243046 3300014326 Bacteria 1624
158 Ga0157377_10002903 3300014745 Bacteria 7666
159 Ga0157379_10216909 3300014968 Bacteria 1733
160 Ga0157376_10000422 3300014969 Bacteria 27522
161 Ga0157376_10068305 3300014969 Bacteria 3009
162 Ga0213872_10070812 3300021361 Unclassified 1572
163 Ga0213875_10014487 3300021388 Unclassified 3847
164 Ga0213871_10013004 3300021441 Bacteria 1945
165 Ga0207666_1004350 3300025271 Bacteria 1774
166 Ga0207697_10013287 3300025315 Bacteria 3436
167 Ga0207682_10028291 3300025893 Bacteria 2236
168 Ga0207688_10007577 3300025901 Bacteria 5909
169 Ga0207688_10036202 3300025901 Bacteria 2736
170 Ga0207645_10003709 3300025907 Bacteria 11506
171 Ga0207645_10018572 3300025907 Bacteria 4571
172 Ga0207645_10035322 3300025907 Bacteria 3210
173 Ga0207643_10000084 3300025908 Bacteria 61474
174 Ga0207643_10015695 3300025908 Bacteria 4125
175 Ga0207684_10001587 3300025910 Bacteria 24190
176 Ga0207684_10009934 3300025910 Bacteria 8389
177 Ga0207684_10044872 3300025910 Unclassified 3749
178 Ga0207684_10060605 3300025910 Unclassified 3214
179 Ga0207684_10063068 3300025910 Unclassified 3147
180 Ga0207707_10133267 3300025912 Bacteria 2173
181 Ga0207695_10061081 3300025913 Bacteria 3896
182 Ga0207695_10096709 3300025913 Bacteria 2954
183 Ga0207671_10008629 3300025914 Bacteria 8612
184 Ga0207671_10015325 3300025914 Bacteria 6009
185 Ga0207671_10015553 3300025914 Bacteria 5952
186 Ga0207671_10024272 3300025914 Bacteria 4562
187 Ga0207693_10110193 3300025915 Bacteria 2158
188 Ga0207693_10139059 3300025915 Bacteria 1910
189 Ga0207663_10032996 3300025916 Unclassified 3080
190 Ga0207657_10107194 3300025919 Bacteria 2311
191 Ga0207649_10100957 3300025920 Bacteria 1909
192 Ga0207646_10004464 3300025922 Bacteria 15169
193 Ga0207646_10057841 3300025922 Unclassified 3464
194 Ga0207646_10113832 3300025922 Bacteria 2429
195 Ga0207681_10057163 3300025923 Bacteria 2664
196 Ga0207681_10086176 3300025923 Bacteria 2231
197 Ga0207650_10016786 3300025925 Bacteria 5120
198 Ga0207650_10133292 3300025925 Bacteria 1946
199 Ga0207659_10019957 3300025926 Bacteria 4422
200 Ga0207659_10152841 3300025926 Bacteria 1804
201 Ga0207687_10004086 3300025927 Bacteria 9783
202 Ga0207687_10056953 3300025927 Bacteria 2743
203 Ga0207706_10044767 3300025933 Bacteria 3922
204 Ga0207706_10132950 3300025933 Bacteria 2188
205 Ga0207669_10000982 3300025937 Bacteria 12105
206 Ga0207665_10024084 3300025939 Bacteria 4011
207 Ga0207665_10088038 3300025939 Bacteria 2148
208 Ga0207691_10029089 3300025940 Bacteria 5168
209 Ga0207691_10033931 3300025940 Bacteria 4750
210 Ga0207711_10008123 3300025941 Bacteria 8785
211 Ga0207711_10017682 3300025941 Bacteria 5923
212 Ga0207661_10000011 3300025944 Bacteria 361200
213 Ga0207661_10076672 3300025944 Bacteria 2746
214 Ga0207679_10098450 3300025945 Bacteria 2281
215 Ga0207679_10161140 3300025945 Unclassified 1837
216 Ga0207651_10093545 3300025960 Unclassified 2208
217 Ga0207651_10130949 3300025960 Bacteria 1920
218 Ga0207668_10167056 3300025972 Bacteria 1721
219 Ga0207641_10002532 3300026088 Bacteria 16824
220 Ga0207641_10043047 3300026088 Bacteria 3790
221 Ga0207674_10009697 3300026116 Bacteria 10976
222 Ga0207675_100004380 3300026118 Bacteria 13649
223 Ga0207683_10051630 3300026121 Bacteria 3603
224 Ga0207683_10144355 3300026121 Bacteria 2146
225 Ga0207428_10005990 3300027907 Bacteria 11256
226 Ga0268265_10116081 3300028380 Bacteria 2196
227 Ga0268264_10001013 3300028381 Bacteria 28452
228 Ga0268264_10045576 3300028381 Unclassified 3641
229 Ga0265337_1002171 3300028556 Bacteria 9190
230 Ga0265338_10050294 3300028800 Bacteria 3769
231 Ga0265330_10003568 3300031235 Bacteria 8108
232 Ga0265330_10004604 3300031235 Bacteria 6976
233 Ga0265325_10000571 3300031241 Bacteria 26726
234 Ga0265329_10000194 3300031242 Bacteria 31424
235 Ga0265331_10001149 3300031250 Bacteria 20190
236 Ga0265316_10001104 3300031344 Bacteria 29270
237 Ga0265316_10032541 3300031344 Bacteria 4255
238 Ga0307513_10107067 3300031456 Bacteria 2800
239 Ga0265313_10010174 3300031595 Bacteria 6001
240 Ga0265314_10000045 3300031711 Bacteria 201738
241 Ga0265314_10001056 3300031711 Bacteria 32032
242 Ga0265342_10000018 3300031712 Bacteria 180008
243 Ga0265342_10001206 3300031712 Bacteria 24507
244 Ga0373931_0083210 3300035691 Bacteria 1770
245 Ga0373947_0034363 3300035725 Bacteria 2998
246 Ga0373937_0013991 3300036401 Bacteria 7075
247 Ga0373925_0028733 3300037068 Bacteria 4076
248 Ga0436364_0586933 3300037853 Bacteria 3198
249 Ga0436364_0752667 3300037853 Unclassified 3509
250 Ga0436365_0197260 3300039437 Bacteria 27939
251 Ga0436365_0535504 3300039437 Unclassified 4152
252 Ga0436360_0430298 3300039438 Bacteria 3274
253 Ga0436360_0613124 3300039438 Bacteria 3607
254 Ga0436360_0613480 3300039438 Bacteria 11622
255 Ga0436360_1374092 3300039438 Bacteria 1443
256 Ga0436361_0206367 3300039447 Bacteria 3070
257 Ga0436361_0418564 3300039447 Bacteria 3392
258 Ga0436361_0881259 3300039447 Bacteria 7411
259 Ga0436361_1170609 3300039447 Bacteria 6658
260 Ga0436361_1185578 3300039447 Bacteria 2145
261 Ga0436362_1305009 3300039453 Bacteria 3595
262 Ga0451853_0048128 3300041512 Bacteria 1822
263 Ga0439435_0026645 3300042436 Bacteria 1541
264 Ga0451577_0000082 3300042876 Bacteria 214418
265 Ga0451577_0231086 3300042876 Bacteria 1673
266 Ga0453683_0048295 3300044673 Bacteria 2670
267 Ga0453684_0005967 3300044712 Bacteria 23613
268 Ga0453684_0033186 3300044712 Bacteria 7202
269 Ga0453684_0045315 3300044712 Bacteria 5869
270 Ga0453684_0145720 3300044712 Bacteria 2821
271 Ga0453684_0232799 3300044712 Unclassified 2126
272 Ga0451576_0106930 3300045051 Bacteria 2911
273 Ga0495638_0014310 3300046460 Bacteria 5369
274 Ga0495580_0065944 3300046472 Bacteria 2535
275 Ga0495652_0006431 3300046529 Bacteria 10927
276 Ga0495586_0021290 3300046535 Bacteria 3455
277 Ga0495587_0009326 3300046536 Bacteria 6291
278 Ga0495599_0007164 3300046678 Bacteria 6751
279 Ga0495613_0127021 3300046689 Bacteria 1828
280 Ga0495602_0002396 3300048088 Bacteria 19038
281 Ga0496102_0023160 3300048905 Bacteria 5512
282 Ga0496104_0096946 3300048907 Bacteria 2822
283 Ga0496104_0171371 3300048907 Bacteria 2081
284 Ga0496106_0021981 3300048909 Bacteria 4739
285 Ga0496106_0023928 3300048909 Bacteria 4539
286 Ga0496109_0004803 3300048912 Bacteria 11284
287 Ga0496113_0224066 3300048916 Bacteria 1499
288 Ga0496114_0046062 3300048917 Bacteria 3623
289 Ga0501032_0084618 3300049569 Unclassified 2109
290 Ga0501033_0034100 3300049570 Unclassified 3820
291 Ga0501080_0060342 3300049742 Bacteria 3530
292 Ga0501035_0123916 3300049822 Unclassified 2257
293 Ga0501044_0000129 3300049823 Bacteria 92557
294 nmdc:mga05p37_15492_c1 3300050507 Bacteria 9163
295 nmdc:mga05p37_37533_c1 3300050507 Bacteria 5941
296 nmdc:mga05p37_54958_c1 3300050507 Bacteria 4898
297 nmdc:mga05p37_78004_c1 3300050507 Unclassified 4078
298 nmdc:mga09592_74551_c1 3300050508 Bacteria 2883
299 nmdc:mga09592_8120_c1 3300050508 Bacteria 8535
300 nmdc:mga0qj67_104747_c1 3300050509 Bacteria 2282
301 nmdc:mga0qj67_70_c1 3300050509 Bacteria 73245
302 nmdc:mga06r32_1591_c1 3300050510 Bacteria 20444
303 nmdc:mga06r32_31374_c1 3300050510 Bacteria 4990
304 nmdc:mga06r32_44982_c1 3300050510 Bacteria 4206
305 nmdc:mga08y16_12941_c1 3300050511 Bacteria 8777
306 nmdc:mga08y16_310573_c1 3300050511 Bacteria 1624
307 nmdc:mga0n895_215966_c1 3300050512 Bacteria 1947
308 nmdc:mga0n895_25212_c1 3300050512 Bacteria 5616
309 nmdc:mga0n895_43686_c1 3300050512 Bacteria 4368
310 nmdc:mga08x19_97528_c1 3300050514 Unclassified 1946
311 nmdc:mga0a205_185593_c1 3300050515 Bacteria 1973
312 nmdc:mga0a205_2410_c1 3300050515 Bacteria 16494
313 nmdc:mga0a205_26318_c1 3300050515 Bacteria 5546
314 nmdc:mga0a205_31140_c2 3300050515 Bacteria 2641
315 Ga0500554_000072 3300053102 Bacteria 18186
316 Ga0500572_002963 3300053111 Bacteria 3977
317 Ga0500595_001371 3300053119 Bacteria 13098
318 Ga0500614_000110 3300053123 Bacteria 19658
319 Ga0500559_0004953 3300053136 Bacteria 6192
320 Ga0500564_044620 3300053138 Bacteria 2036
321 Ga0500645_021074 3300053730 Unclassified 2014
322 Ga0070708_100001303
323 JGI25406J46586_10010880
324 rootH2_10022203
325 rootH2_10036306
326 rootH1_10137265
327 rootH1_10185557
328 Ga0065712_10090842
329 Ga0065712_10101841
330 Ga0065715_10007380
331 Ga0065715_10091086
332 Ga0065707_10129648
333 Ga0070683_100000006
334 Ga0070670_100003984
335 Ga0070670_100036742
336 Ga0070670_100050904
337 Ga0068869_100009429
338 Ga0070666_10063127
339 Ga0070661_100080472
340 Ga0070669_100053340
341 Ga0070675_100047922
342 Ga0070675_100124263
343 Ga0070671_100148522
344 Ga0070674_100000413
345 Ga0070673_100103910
346 Ga0070673_100136900
347 Ga0070667_100028488
348 Ga0070667_100102569
349 Ga0070714_100059489
350 Ga0070713_100091575
351 Ga0070713_100094010
352 Ga0070711_100050815
353 Ga0070711_100091975
354 Ga0070708_100023677
355 Ga0070708_100071176
356 Ga0070708_100174558
357 Ga0070708_100242859
358 Ga0070708_100278657
359 Ga0070678_100038845
360 Ga0070678_100048087
361 Ga0070662_100067786
362 Ga0068867_100157351
363 Ga0070685_10006726
364 Ga0070706_100001614
365 Ga0070706_100004570
366 Ga0070706_100023101
367 Ga0070706_100025349
368 Ga0070706_100061867
369 Ga0070706_100105976
370 Ga0070707_100065800
371 Ga0070707_100128026
372 Ga0070698_100002575
373 Ga0070698_100021339
374 Ga0070699_100001177
375 Ga0070699_100035579
376 Ga0070699_100082460
377 Ga0070684_100000064
378 Ga0070684_100122629
379 Ga0070697_100004580
380 Ga0070697_100032295
381 Ga0070697_100065641
382 Ga0070697_100107161
383 Ga0070697_100194232
384 Ga0068853_100095187
385 Ga0068853_100126596
386 Ga0070672_100034176
387 Ga0070665_100017856
388 Ga0070665_100070134
389 Ga0070704_100002992
390 Ga0070664_100009472
391 Ga0070664_100099461
392 Ga0068857_100001792
393 Ga0068856_100104307
394 Ga0070702_100011181
395 Ga0068859_100017772
396 Ga0068864_100055182
397 Ga0068870_10003464
398 Ga0068870_10038142
399 Ga0068863_100000249
400 Ga0068863_100032760
401 Ga0068858_100048646
402 Ga0068860_100008009
403 Ga0068860_100254352
404 Ga0081455_10012127
405 Ga0081539_10002374
406 Ga0070717_10008944
407 Ga0070717_10042188
408 Ga0070717_10057416
409 Ga0070715_10009734
410 Ga0070716_100077253
411 Ga0068871_100054728
412 Ga0075428_100001902
413 Ga0075428_100011286
414 Ga0075428_100018661
415 Ga0075428_100108269
416 Ga0075428_100330784
417 Ga0075430_100001142
418 Ga0075430_100144876
419 Ga0075431_100000595
420 Ga0075433_10002713
421 Ga0075433_10018102
422 Ga0075433_10030627
423 Ga0075434_100022826
424 Ga0075434_100023593
425 Ga0075434_100027958
426 Ga0075434_100044944
427 Ga0075429_100001570
428 Ga0068865_100047835
429 Ga0075436_100080449
430 Ga0075436_100110909
431 Ga0097620_100017774
432 Ga0105240_10113175
433 Ga0105240_10224883
434 Ga0111539_10016135
435 Ga0111539_10106749
436 Ga0105245_10000524
437 Ga0105245_10000600
438 Ga0105245_10010631
439 Ga0105245_10090404
440 Ga0114129_10009851
441 Ga0114129_10014528
442 Ga0114129_10041935
443 Ga0114129_10047635
444 Ga0114129_10049313
445 Ga0114129_10179101
446 Ga0114129_10571258
447 Ga0105241_10013843
448 Ga0105248_10017132
449 Ga0105248_10025116
450 Ga0105248_10061713
451 Ga0105237_10001174
452 Ga0105237_10010173
453 Ga0105237_10029434
454 Ga0105249_10026468
455 Ga0105249_10049309
456 Ga0105249_10106583
457 Ga0105249_10208244
458 Ga0105246_10005604
459 Ga0105246_10015230
460 Ga0157369_10030064
461 Ga0157374_10000179
462 Ga0157374_10357993
463 Ga0157374_10364794
464 Ga0157378_10007907
465 Ga0157378_10280240
466 Ga0163162_10025728
467 Ga0163162_10049319
468 Ga0163162_10068965
469 Ga0157375_10019115
470 Ga0157375_10088293
471 Ga0157375_10232920
472 Ga0163163_10000819
473 Ga0163163_10193211
474 Ga0163163_10384684
475 Ga0157380_10019185
476 Ga0157380_10174805
477 Ga0157380_10243046
478 Ga0157377_10002903
479 Ga0157379_10216909
480 Ga0157376_10000422
481 Ga0157376_10068305
482 Ga0213872_10070812
483 Ga0213875_10014487
484 Ga0213871_10013004
485 Ga0207666_1004350
486 Ga0207697_10013287
487 Ga0207682_10028291
488 Ga0207688_10007577
489 Ga0207688_10036202
490 Ga0207645_10003709
491 Ga0207645_10018572
492 Ga0207645_10035322
493 Ga0207643_10000084
494 Ga0207643_10015695
495 Ga0207684_10001587
496 Ga0207684_10009934
497 Ga0207684_10044872
498 Ga0207684_10060605
499 Ga0207684_10063068
500 Ga0207707_10133267
501 Ga0207695_10061081
502 Ga0207695_10096709
503 Ga0207671_10008629
504 Ga0207671_10015325
505 Ga0207671_10015553
506 Ga0207671_10024272
507 Ga0207693_10110193
508 Ga0207693_10139059
509 Ga0207663_10032996
510 Ga0207657_10107194
511 Ga0207649_10100957
512 Ga0207646_10004464
513 Ga0207646_10057841
514 Ga0207646_10113832
515 Ga0207681_10057163
516 Ga0207681_10086176
517 Ga0207650_10016786
518 Ga0207650_10133292
519 Ga0207659_10019957
520 Ga0207659_10152841
521 Ga0207687_10004086
522 Ga0207687_10056953
523 Ga0207706_10044767
524 Ga0207706_10132950
525 Ga0207669_10000982
526 Ga0207665_10024084
527 Ga0207665_10088038
528 Ga0207691_10029089
529 Ga0207691_10033931
530 Ga0207711_10008123
531 Ga0207711_10017682
532 Ga0207661_10000011
533 Ga0207661_10076672
534 Ga0207679_10098450
535 Ga0207679_10161140
536 Ga0207651_10093545
537 Ga0207651_10130949
538 Ga0207668_10167056
539 Ga0207641_10002532
540 Ga0207641_10043047
541 Ga0207674_10009697
542 Ga0207675_100004380
543 Ga0207683_10051630
544 Ga0207683_10144355
545 Ga0207428_10005990
546 Ga0268265_10116081
547 Ga0268264_10001013
548 Ga0268264_10045576
549 Ga0265337_1002171
550 Ga0265338_10050294
551 Ga0265330_10003568
552 Ga0265330_10004604
553 Ga0265325_10000571
554 Ga0265329_10000194
555 Ga0265331_10001149
556 Ga0265316_10001104
557 Ga0265316_10032541
558 Ga0307513_10107067
559 Ga0265313_10010174
560 Ga0265314_10000045
561 Ga0265314_10001056
562 Ga0265342_10000018
563 Ga0265342_10001206
564 Ga0373931_0083210
565 Ga0373947_0034363
566 Ga0373937_0013991
567 Ga0373925_0028733
568 Ga0436364_0586933
569 Ga0436364_0752667
570 Ga0436365_0197260
571 Ga0436365_0535504
572 Ga0436360_0430298
573 Ga0436360_0613124
574 Ga0436360_0613480
575 Ga0436360_1374092
576 Ga0436361_0206367
577 Ga0436361_0418564
578 Ga0436361_0881259
579 Ga0436361_1170609
580 Ga0436361_1185578
581 Ga0436362_1305009
582 Ga0451853_0048128
583 Ga0439435_0026645
584 Ga0451577_0000082
585 Ga0451577_0231086
586 Ga0453683_0048295
587 Ga0453684_0005967
588 Ga0453684_0033186
589 Ga0453684_0045315
590 Ga0453684_0145720
591 Ga0453684_0232799
592 Ga0451576_0106930
593 Ga0495638_0014310
594 Ga0495580_0065944
595 Ga0495652_0006431
596 Ga0495586_0021290
597 Ga0495587_0009326
598 Ga0495599_0007164
599 Ga0495613_0127021
600 Ga0495602_0002396
601 Ga0496102_0023160
602 Ga0496104_0096946
603 Ga0496104_0171371
604 Ga0496106_0021981
605 Ga0496106_0023928
606 Ga0496109_0004803
607 Ga0496113_0224066
608 Ga0496114_0046062
609 Ga0501032_0084618
610 Ga0501033_0034100
611 Ga0501080_0060342
612 Ga0501035_0123916
613 Ga0501044_0000129
614 nmdc:mga05p37_15492_c1
615 nmdc:mga05p37_37533_c1
616 nmdc:mga05p37_54958_c1
617 nmdc:mga05p37_78004_c1
618 nmdc:mga09592_74551_c1
619 nmdc:mga09592_8120_c1
620 nmdc:mga0qj67_104747_c1
621 nmdc:mga0qj67_70_c1
622 nmdc:mga06r32_1591_c1
623 nmdc:mga06r32_31374_c1
624 nmdc:mga06r32_44982_c1
625 nmdc:mga08y16_12941_c1
626 nmdc:mga08y16_310573_c1
627 nmdc:mga0n895_215966_c1
628 nmdc:mga0n895_25212_c1
629 nmdc:mga0n895_43686_c1
630 nmdc:mga08x19_97528_c1
631 nmdc:mga0a205_185593_c1
632 nmdc:mga0a205_2410_c1
633 nmdc:mga0a205_26318_c1
634 nmdc:mga0a205_31140_c2
635 Ga0500554_000072
636 Ga0500572_002963
637 Ga0500595_001371
638 Ga0500614_000110
639 Ga0500559_0004953
640 Ga0500564_044620
641 Ga0500645_021074

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01654

Cyt_bd_oxida_I

Cytochrome bd terminal oxidase subunit I

11

441

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ose-assembly1.cif.gz_D cytochrome bd-ii type oxidase with bound aurachin d 0.9417 7 441
5ir6-assembly1.cif.gz_A the structure of bd oxidase from geobacillus thermodenitrificans 0.9337 6 441
5ir6-assembly1.cif.gz_A the structure of bd oxidase from geobacillus thermodenitrificans 0.9253 6 441
7nkz-assembly1.cif.gz_A cryo-em structure of the cytochrome bd oxidase from m. tuberculosis at 2.5 a resolution 0.9237 7 441
7ose-assembly1.cif.gz_D cytochrome bd-ii type oxidase with bound aurachin d 0.8994 7 441
ID Description Score Start End Superfamily
af_P76173_1_274_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.5686 16 380 1.20.1630.10
af_P76173_1_274_1.20.1630.10 Mainly Alpha;Up-down Bundle;Formate dehydrogenase/DMSO reductase fold;Formate dehydrogenase/DMSO reductase domain 0.5558 16 380 1.20.1630.10
af_A0A1D6ECN6_11_572_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4257 9 377 1.20.1250.20
af_A0A1D6MCX1_7_216_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.3909 155 429 1.20.120.1770
af_Q54W37_27_219_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.388 16 239 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A534XW23-F1-model_v4 Cytochrome ubiquinol oxidase subunit I 0.9876 5 445 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0020037
GO:0046872
GO:0070069
AF-A0A7C3NVL8-F1-model_v4 Cytochrome ubiquinol oxidase subunit I 0.9836 6 279 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0020037
GO:0046872
GO:0070069
AF-A0A535SJG0-F1-model_v4 Cytochrome d ubiquinol oxidase subunit II 0.9834 8 441 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0020037
GO:0046872
GO:0070069
AF-A0A2V9I041-F1-model_v4 Cytochrome ubiquinol oxidase subunit I 0.9827 7 232 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0020037
GO:0046872
GO:0070069
AF-A0A2V9CA03-F1-model_v4 Cytochrome ubiquinol oxidase subunit I 0.9789 6 201 GO:0005886
GO:0009055
GO:0016682
GO:0019646
GO:0020037
GO:0046872
GO:0070069

Map