F405037

General Info

Members Datasets Scaffolds Average Seq Length
319 188 638 317

Family's Representative Sequence

Representative Sequence 3300007265|Ga0099794_10017394|Ga0099794_100173942
Length 364
Sequence MPYREEQPQRGEEVLDPDRRRFLQAGLGAAGAIVAASSFARTETAASLLPLDMTTTGPEDIPRKPLGRTGERVSVLGLGGYHLGTIGSATEASRLVHEAVDAGVTFLDNAWEYNGGRSEEWMGQALQGRRHKVFLMTKVCTHGRDRKTAMRQLEESLGRLRTDHLDLWQIHEVIYENDPDLHFAKGGVIEALDQAKKEGKVRFVGFTGHKSPAIHLRMLAHDYPFDTVQMPLNCFDATYRSFEQQVLPELERRGIAALGMKSLGGDGQPIFHGAVTAEEALRYAMSLPVATTISGIDSLAVLRQNLAIARGFTPMTPEEMDVLRRRCASLAADGHLELFKSTKRYDGAVGREQHGYPPSAELPL

Samples

Sample ID Description Type Environment
1 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
77 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
78 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
81 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
113 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
114 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
118 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
119 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
120 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
121 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
122 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
123 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
124 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
125 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
126 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
127 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
128 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
129 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
130 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
131 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
132 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
133 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
134 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
135 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
136 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
137 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
138 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
139 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
140 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
141 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
142 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
143 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
144 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
145 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
146 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
147 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
148 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
149 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
150 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
151 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
152 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
153 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
154 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
155 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
156 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
157 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
158 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
159 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
162 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
164 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
168 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
169 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
170 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
171 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
172 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
173 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
174 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
175 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
176 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
177 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
178 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
179 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
180 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
181 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
182 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
183 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
184 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
185 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
186 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
187 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
188 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.75
Metatranscriptomes 1.25
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.25
Nodule 0
Rhizoplane 5.02
Rhizosphere 91.54
Stem 0
Stem Tuber 0
Unclassified 18.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0099794_10017394 3300007265 Bacteria 3204
2 JGI24751J29686_10002534 3300002459 Unclassified 3676
3 JGI25406J46586_10020492 3300003203 Bacteria 2673
4 rootH2_10006773 3300003320 Bacteria 12391
5 Ga0065712_10000714 3300005290 Bacteria 15921
6 Ga0065712_10075893 3300005290 Bacteria 3769
7 Ga0065715_10002662 3300005293 Bacteria 4776
8 Ga0065715_10113101 3300005293 Bacteria 2503
9 Ga0065715_10125129 3300005293 Bacteria 2138
10 Ga0065715_10181656 3300005293 Bacteria 1472
11 Ga0065707_10122107 3300005295 Bacteria 2095
12 Ga0065707_10177969 3300005295 Bacteria 1437
13 Ga0070658_10008498 3300005327 Bacteria 8255
14 Ga0070658_10211132 3300005327 Unclassified 1640
15 Ga0070683_100003650 3300005329 Bacteria 12541
16 Ga0070683_100135432 3300005329 Bacteria 2332
17 Ga0070690_100127482 3300005330 Bacteria 1715
18 Ga0070670_100006265 3300005331 Bacteria 10071
19 Ga0070670_100019044 3300005331 Bacteria 5886
20 Ga0070670_100021473 3300005331 Bacteria 5553
21 Ga0070670_100078922 3300005331 Bacteria 2828
22 Ga0070670_100108389 3300005331 Bacteria 2393
23 Ga0070677_10045683 3300005333 Bacteria 1748
24 Ga0068869_100061126 3300005334 Bacteria 2762
25 Ga0068868_100070842 3300005338 Bacteria 2780
26 Ga0068868_100176874 3300005338 Bacteria 1769
27 Ga0070691_10061342 3300005341 Bacteria 1809
28 Ga0070661_100082376 3300005344 Unclassified 2376
29 Ga0070668_100002965 3300005347 Bacteria 12547
30 Ga0070669_100029477 3300005353 Bacteria 3956
31 Ga0070675_100097060 3300005354 Bacteria 2477
32 Ga0070675_100107932 3300005354 Unclassified 2351
33 Ga0070675_100149112 3300005354 Bacteria 2004
34 Ga0070675_100186324 3300005354 Bacteria 1796
35 Ga0070674_100053268 3300005356 Bacteria 2793
36 Ga0070674_100060361 3300005356 Bacteria 2643
37 Ga0070673_100021801 3300005364 Bacteria 4653
38 Ga0070667_100123930 3300005367 Bacteria 2251
39 Ga0070667_100188521 3300005367 Bacteria 1826
40 Ga0070714_100055181 3300005435 Bacteria 3395
41 Ga0070711_100139252 3300005439 Unclassified 1817
42 Ga0070694_100086750 3300005444 Bacteria 2188
43 Ga0070694_100225681 3300005444 Bacteria 1407
44 Ga0070678_100151047 3300005456 Bacteria 1871
45 Ga0068867_100079785 3300005459 Bacteria 2463
46 Ga0070685_10022149 3300005466 Bacteria 3460
47 Ga0070706_100075684 3300005467 Unclassified 3115
48 Ga0070706_100148654 3300005467 Bacteria 2187
49 Ga0070706_100254375 3300005467 Bacteria 1640
50 Ga0070706_100399945 3300005467 Bacteria 1279
51 Ga0070707_100001212 3300005468 Bacteria 25378
52 Ga0070707_100011315 3300005468 Bacteria 8317
53 Ga0070707_100012329 3300005468 Bacteria 7981
54 Ga0070698_100022494 3300005471 Bacteria 6595
55 Ga0070698_100035119 3300005471 Bacteria 5184
56 Ga0070698_100057881 3300005471 Bacteria 3920
57 Ga0070698_100137522 3300005471 Bacteria 2396
58 Ga0070699_100009685 3300005518 Bacteria 8341
59 Ga0070699_100018630 3300005518 Bacteria 5961
60 Ga0070699_100025459 3300005518 Bacteria 5100
61 Ga0070679_100017722 3300005530 Bacteria 6895
62 Ga0070684_100001965 3300005535 Bacteria 15101
63 Ga0070684_100175213 3300005535 Bacteria 1949
64 Ga0070697_100001035 3300005536 Bacteria 21036
65 Ga0070672_100116563 3300005543 Unclassified 2182
66 Ga0070695_100058900 3300005545 Unclassified 2485
67 Ga0070693_100050886 3300005547 Bacteria 2370
68 Ga0068855_100004271 3300005563 Bacteria 17448
69 Ga0070664_100002291 3300005564 Bacteria 15388
70 Ga0070664_100059126 3300005564 Bacteria 3261
71 Ga0068857_100013772 3300005577 Bacteria 7046
72 Ga0068857_100111560 3300005577 Bacteria 2459
73 Ga0068857_100322743 3300005577 Unclassified 1426
74 Ga0068856_100138192 3300005614 Bacteria 2443
75 Ga0070702_100102632 3300005615 Bacteria 1757
76 Ga0068859_100022885 3300005617 Bacteria 6266
77 Ga0068864_100002114 3300005618 Bacteria 16422
78 Ga0068864_100008968 3300005618 Bacteria 8247
79 Ga0068866_10228403 3300005718 Bacteria 1127
80 Ga0068863_100178958 3300005841 Bacteria 2036
81 Ga0068862_100016138 3300005844 Bacteria 6212
82 Ga0068862_100058173 3300005844 Bacteria 3316
83 Ga0081455_10004959 3300005937 Bacteria 14722
84 Ga0081539_10000165 3300005985 Bacteria 153824
85 Ga0081539_10000796 3300005985 Bacteria 61233
86 Ga0081539_10146271 3300005985 Bacteria 1142
87 Ga0075367_10049810 3300006178 Unclassified 2470
88 Ga0075366_10014571 3300006195 Bacteria 4491
89 Ga0075366_10073818 3300006195 Bacteria 2034
90 Ga0068871_100263764 3300006358 Bacteria 1503
91 Ga0075428_100003525 3300006844 Bacteria 17140
92 Ga0075428_100021982 3300006844 Bacteria 7063
93 Ga0075428_100423431 3300006844 Bacteria 1426
94 Ga0075431_100041332 3300006847 Bacteria 4753
95 Ga0075431_100068987 3300006847 Unclassified 3648
96 Ga0075431_100077271 3300006847 Bacteria 3436
97 Ga0075431_100093556 3300006847 Bacteria 3102
98 Ga0075433_10014983 3300006852 Bacteria 6348
99 Ga0075433_10160758 3300006852 Unclassified 1999
100 Ga0075434_100090204 3300006871 Bacteria 3067
101 Ga0075434_100260193 3300006871 Bacteria 1754
102 Ga0075434_100466561 3300006871 Bacteria 1284
103 Ga0075429_100292710 3300006880 Bacteria 1426
104 Ga0068865_100158615 3300006881 Bacteria 1724
105 Ga0075436_100127968 3300006914 Bacteria 1780
106 Ga0097620_100022885 3300006931 Bacteria 6266
107 Ga0075435_100060514 3300007076 Bacteria 3071
108 Ga0075435_100139108 3300007076 Bacteria 2036
109 Ga0075435_100238939 3300007076 Bacteria 1545
110 Ga0099794_10011583 3300007265 Bacteria 3780
111 Ga0111539_10013569 3300009094 Bacteria 10186
112 Ga0111539_10014202 3300009094 Bacteria 9946
113 Ga0111539_10023035 3300009094 Bacteria 7649
114 Ga0111539_10155115 3300009094 Bacteria 2679
115 Ga0111539_10759894 3300009094 Bacteria 1128
116 Ga0105245_10179597 3300009098 Bacteria 2021
117 Ga0114129_10017975 3300009147 Bacteria 10067
118 Ga0114129_10025512 3300009147 Bacteria 8375
119 Ga0114129_10030752 3300009147 Bacteria 7593
120 Ga0114129_10247589 3300009147 Bacteria 2394
121 Ga0114129_10248701 3300009147 Bacteria 2388
122 Ga0105243_10136518 3300009148 Bacteria 2087
123 Ga0105242_10302380 3300009176 Bacteria 1461
124 Ga0105248_10006679 3300009177 Bacteria 12661
125 Ga0105248_10040804 3300009177 Bacteria 5203
126 Ga0105249_10015713 3300009553 Bacteria 6704
127 Ga0105249_10115658 3300009553 Bacteria 2542
128 Ga0105239_10088115 3300010375 Bacteria 3422
129 Ga0157370_10039708 3300013104 Bacteria 4547
130 Ga0157369_10187320 3300013105 Unclassified 2176
131 Ga0157374_10118896 3300013296 Unclassified 2549
132 Ga0157374_10342580 3300013296 Bacteria 1484
133 Ga0163162_10000002 3300013306 Bacteria 717331
134 Ga0163162_10037060 3300013306 Bacteria 4864
135 Ga0163162_10349739 3300013306 Bacteria 1611
136 Ga0157375_10135917 3300013308 Bacteria 2582
137 Ga0157375_10208270 3300013308 Bacteria 2112
138 Ga0163163_10040497 3300014325 Unclassified 4549
139 Ga0163163_10094275 3300014325 Unclassified 3011
140 Ga0157380_10036757 3300014326 Bacteria 3791
141 Ga0157377_10046684 3300014745 Bacteria 2424
142 Ga0157379_10320635 3300014968 Unclassified 1415
143 Ga0213876_10210991 3300021384 Bacteria 1032
144 Ga0207697_10000774 3300025315 Bacteria 18118
145 Ga0207697_10014634 3300025315 Bacteria 3252
146 Ga0207697_10038609 3300025315 Bacteria 1958
147 Ga0207688_10006424 3300025901 Bacteria 6402
148 Ga0207705_10068583 3300025909 Unclassified 2568
149 Ga0207705_10141900 3300025909 Unclassified 1794
150 Ga0207684_10021238 3300025910 Bacteria 5543
151 Ga0207684_10026889 3300025910 Bacteria 4906
152 Ga0207684_10237354 3300025910 Bacteria 1573
153 Ga0207663_10330752 3300025916 Unclassified 1148
154 Ga0207657_10237482 3300025919 Unclassified 1456
155 Ga0207649_10036400 3300025920 Unclassified 2964
156 Ga0207646_10004572 3300025922 Bacteria 14966
157 Ga0207681_10051071 3300025923 Bacteria 2800
158 Ga0207650_10004250 3300025925 Bacteria 9777
159 Ga0207650_10026170 3300025925 Unclassified 4159
160 Ga0207650_10140009 3300025925 Bacteria 1901
161 Ga0207650_10174153 3300025925 Bacteria 1712
162 Ga0207659_10083008 3300025926 Unclassified 2374
163 Ga0207659_10214207 3300025926 Bacteria 1545
164 Ga0207659_10305510 3300025926 Bacteria 1308
165 Ga0207664_10047508 3300025929 Bacteria 3372
166 Ga0207686_10171740 3300025934 Bacteria 1529
167 Ga0207665_10333685 3300025939 Bacteria 1141
168 Ga0207691_10052867 3300025940 Bacteria 3709
169 Ga0207691_10130470 3300025940 Unclassified 2221
170 Ga0207711_10007670 3300025941 Bacteria 9020
171 Ga0207711_10111603 3300025941 Unclassified 2432
172 Ga0207689_10038413 3300025942 Bacteria 3965
173 Ga0207661_10006787 3300025944 Bacteria 8109
174 Ga0207661_10107835 3300025944 Bacteria 2350
175 Ga0207679_10007076 3300025945 Bacteria 7113
176 Ga0207651_10010766 3300025960 Bacteria 5084
177 Ga0207712_10000041 3300025961 Bacteria 180000
178 Ga0207712_10007942 3300025961 Bacteria 6705
179 Ga0207712_10067303 3300025961 Bacteria 2563
180 Ga0207668_10000297 3300025972 Bacteria 32617
181 Ga0207668_10141495 3300025972 Bacteria 1851
182 Ga0207658_10077531 3300025986 Unclassified 2536
183 Ga0207677_10050699 3300026023 Bacteria 2809
184 Ga0207678_10146369 3300026067 Unclassified 2016
185 Ga0207676_10004971 3300026095 Bacteria 9418
186 Ga0207676_10011688 3300026095 Bacteria 6280
187 Ga0207674_10018883 3300026116 Bacteria 7478
188 Ga0207675_100057360 3300026118 Bacteria 3633
189 Ga0207683_10164584 3300026121 Bacteria 2006
190 Ga0209971_1010718 3300027682 Bacteria 2170
191 Ga0209974_10060397 3300027876 Bacteria 1283
192 Ga0207428_10042985 3300027907 Unclassified 3652
193 Ga0207428_10143172 3300027907 Unclassified 1823
194 Ga0265356_1002813 3300028017 Bacteria 2253
195 Ga0265762_1008128 3300030760 Bacteria 1867
196 Ga0265770_1001911 3300030878 Unclassified 2841
197 Ga0265760_10003316 3300031090 Bacteria 4712
198 Ga0265760_10004186 3300031090 Bacteria 4151
199 Ga0265325_10006025 3300031241 Bacteria 7417
200 Ga0265325_10033946 3300031241 Bacteria 2719
201 Ga0307513_10007135 3300031456 Bacteria 14529
202 Ga0307408_100077152 3300031548 Unclassified 2481
203 Ga0307409_100292600 3300031995 Bacteria 1511
204 Ga0373947_0068260 3300035725 Bacteria 2174
205 Ga0395900_0321781 3300037418 Unclassified 1527
206 Ga0395898_0058862 3300037466 Bacteria 3740
207 Ga0436364_1076548 3300037853 Unclassified 1534
208 Ga0436364_1171052 3300037853 Bacteria 10517
209 Ga0436365_1897700 3300039437 Bacteria 1393
210 Ga0436361_1066501 3300039447 Bacteria 11321
211 Ga0439439_0022341 3300041406 Bacteria 1580
212 Ga0450920_002246 3300042122 Bacteria 3270
213 Ga0450923_010410 3300042125 Unclassified 1650
214 Ga0450894_001579 3300042131 Bacteria 3223
215 Ga0450896_000534 3300042133 Bacteria 4025
216 Ga0450908_004121 3300042184 Bacteria 2809
217 Ga0450908_026221 3300042184 Bacteria 1017
218 Ga0450918_005811 3300042531 Bacteria 2208
219 Ga0453683_0100908 3300044673 Bacteria 1811
220 Ga0453684_0110239 3300044712 Bacteria 3346
221 Ga0466967_0149831 3300045976 Bacteria 2179
222 Ga0495639_0082349 3300046475 Bacteria 1500
223 Ga0495662_0013311 3300046476 Bacteria 4004
224 Ga0495630_0000518 3300046517 Bacteria 28423
225 Ga0495666_0014025 3300046526 Bacteria 3997
226 Ga0495586_0002579 3300046535 Bacteria 9803
227 Ga0495635_0275968 3300046663 Bacteria 1130
228 Ga0495600_0120089 3300046809 Bacteria 1709
229 Ga0495581_0051238 3300047315 Bacteria 2384
230 Ga0495674_0001365 3300047319 Bacteria 23807
231 Ga0495676_0007124 3300047321 Bacteria 10265
232 Ga0496100_0082956 3300048903 Bacteria 2169
233 Ga0496102_0048850 3300048905 Bacteria 3848
234 Ga0496104_0000830 3300048907 Bacteria 26651
235 Ga0496105_0033716 3300048908 Bacteria 4207
236 Ga0496106_0319667 3300048909 Bacteria 1246
237 Ga0496108_0001041 3300048911 Bacteria 21629
238 Ga0496108_0004654 3300048911 Bacteria 11064
239 Ga0496108_0090504 3300048911 Bacteria 2601
240 Ga0496109_0001707 3300048912 Bacteria 18320
241 Ga0496109_0004852 3300048912 Bacteria 11224
242 Ga0496110_0002605 3300048913 Bacteria 13566
243 Ga0496110_0093030 3300048913 Bacteria 2698
244 Ga0496112_0000626 3300048915 Bacteria 24545
245 Ga0496112_0001364 3300048915 Bacteria 18594
246 Ga0496112_0079882 3300048915 Bacteria 3235
247 Ga0496115_0193144 3300048918 Unclassified 1682
248 Ga0496125_0000006 3300048928 Bacteria 759385
249 Ga0501031_0169836 3300049568 Unclassified 1425
250 Ga0501034_0014728 3300049571 Bacteria 8048
251 Ga0501036_0056841 3300049572 Bacteria 3315
252 Ga0501036_0552116 3300049572 Bacteria 957
253 Ga0501039_0211224 3300049575 Unclassified 1526
254 Ga0501039_0213910 3300049575 Unclassified 1516
255 Ga0501040_0106736 3300049576 Bacteria 1957
256 Ga0501040_0198801 3300049576 Unclassified 1423
257 Ga0501041_0287917 3300049577 Bacteria 1034
258 Ga0501042_0055968 3300049578 Unclassified 2815
259 Ga0501046_0101956 3300049580 Unclassified 2201
260 Ga0501046_0157345 3300049580 Unclassified 1711
261 Ga0501048_0084817 3300049582 Unclassified 2234
262 Ga0501048_0093178 3300049582 Unclassified 2125
263 Ga0501048_0381591 3300049582 Bacteria 1006
264 Ga0501071_0151439 3300049587 Unclassified 1730
265 Ga0501071_0153239 3300049587 Bacteria 1720
266 Ga0501072_0060752 3300049588 Bacteria 2980
267 Ga0501072_0092482 3300049588 Bacteria 2402
268 Ga0501073_0186140 3300049589 Bacteria 1437
269 Ga0501074_0138318 3300049590 Bacteria 1742
270 Ga0501075_0015483 3300049591 Bacteria 5474
271 Ga0501075_0134449 3300049591 Bacteria 1884
272 Ga0501079_0112916 3300049741 Unclassified 2112
273 Ga0501080_0167106 3300049742 Bacteria 2030
274 Ga0501080_0245882 3300049742 Unclassified 1632
275 Ga0501081_0073998 3300049743 Bacteria 2377
276 Ga0501045_0090825 3300049824 Unclassified 2257
277 Ga0501045_0153774 3300049824 Bacteria 1712
278 nmdc:mga0k408_3724_c1 3300050493 Bacteria 8079
279 nmdc:mga05p37_261820_c1 3300050507 Bacteria 2069
280 nmdc:mga05p37_348531_c1 3300050507 Unclassified 1744
281 nmdc:mga05p37_56881_c1 3300050507 Bacteria 4816
282 nmdc:mga05p37_72437_c1 3300050507 Bacteria 4239
283 nmdc:mga05p37_91918_c1 3300050507 Bacteria 3739
284 nmdc:mga05p37_95321_c1 3300050507 Bacteria 3666
285 nmdc:mga09592_14839_c1 3300050508 Bacteria 3885
286 nmdc:mga09592_526269_c1 3300050508 Bacteria 1017
287 nmdc:mga0qj67_302318_c1 3300050509 Bacteria 1296
288 nmdc:mga06r32_18696_c1 3300050510 Bacteria 6349
289 nmdc:mga06r32_299617_c1 3300050510 Bacteria 1594
290 nmdc:mga06r32_30750_c1 3300050510 Bacteria 5039
291 nmdc:mga06r32_62150_c1 3300050510 Bacteria 3597
292 nmdc:mga06r32_87534_c1 3300050510 Bacteria 3039
293 nmdc:mga08y16_30684_c1 3300050511 Bacteria 5654
294 nmdc:mga08y16_38264_c1 3300050511 Bacteria 5038
295 nmdc:mga08y16_41717_c1 3300050511 Bacteria 4807
296 nmdc:mga08y16_503013_c1 3300050511 Bacteria 1231
297 nmdc:mga08y16_73796_c1 3300050511 Bacteria 3554
298 nmdc:mga08y16_74639_c1 3300050511 Bacteria 3534
299 nmdc:mga0n895_124856_c1 3300050512 Bacteria 2597
300 nmdc:mga0n895_223320_c1 3300050512 Unclassified 1912
301 nmdc:mga0n895_319351_c1 3300050512 Bacteria 1574
302 nmdc:mga0n895_345807_c1 3300050512 Unclassified 1506
303 nmdc:mga0n895_55923_c1 3300050512 Bacteria 3885
304 nmdc:mga0n895_67565_c1 3300050512 Bacteria 3540
305 nmdc:mga0rr50_217192_c1 3300050513 Bacteria 1577
306 nmdc:mga0rr50_28903_c1 3300050513 Bacteria 3902
307 nmdc:mga0rr50_624002_c1 3300050513 Unclassified 919
308 nmdc:mga0rr50_71451_c1 3300050513 Bacteria 2648
309 nmdc:mga0a205_17314_c2 3300050515 Bacteria 4725
310 nmdc:mga0a205_175603_c1 3300050515 Bacteria 2038
311 nmdc:mga0a205_181047_c1 3300050515 Unclassified 2002
312 nmdc:mga0a205_57994_c1 3300050515 Unclassified 3739
313 nmdc:mga0a205_6997_c1 3300050515 Bacteria 10191
314 Ga0495619_0206024 3300053085 Bacteria 1362
315 Ga0501084_0043447 3300054114 Unclassified 3760
316 Ga0501084_0091246 3300054114 Unclassified 2558
317 Ga0590071_007520 3300059421 Unclassified 2578
318 Ga0501082_0120231 3300060353 Bacteria 2277
319 Ga0501082_0538626 3300060353 Bacteria 1021
320 Ga0099794_10017394
321 JGI24751J29686_10002534
322 JGI25406J46586_10020492
323 rootH2_10006773
324 Ga0065712_10000714
325 Ga0065712_10075893
326 Ga0065715_10002662
327 Ga0065715_10113101
328 Ga0065715_10125129
329 Ga0065715_10181656
330 Ga0065707_10122107
331 Ga0065707_10177969
332 Ga0070658_10008498
333 Ga0070658_10211132
334 Ga0070683_100003650
335 Ga0070683_100135432
336 Ga0070690_100127482
337 Ga0070670_100006265
338 Ga0070670_100019044
339 Ga0070670_100021473
340 Ga0070670_100078922
341 Ga0070670_100108389
342 Ga0070677_10045683
343 Ga0068869_100061126
344 Ga0068868_100070842
345 Ga0068868_100176874
346 Ga0070691_10061342
347 Ga0070661_100082376
348 Ga0070668_100002965
349 Ga0070669_100029477
350 Ga0070675_100097060
351 Ga0070675_100107932
352 Ga0070675_100149112
353 Ga0070675_100186324
354 Ga0070674_100053268
355 Ga0070674_100060361
356 Ga0070673_100021801
357 Ga0070667_100123930
358 Ga0070667_100188521
359 Ga0070714_100055181
360 Ga0070711_100139252
361 Ga0070694_100086750
362 Ga0070694_100225681
363 Ga0070678_100151047
364 Ga0068867_100079785
365 Ga0070685_10022149
366 Ga0070706_100075684
367 Ga0070706_100148654
368 Ga0070706_100254375
369 Ga0070706_100399945
370 Ga0070707_100001212
371 Ga0070707_100011315
372 Ga0070707_100012329
373 Ga0070698_100022494
374 Ga0070698_100035119
375 Ga0070698_100057881
376 Ga0070698_100137522
377 Ga0070699_100009685
378 Ga0070699_100018630
379 Ga0070699_100025459
380 Ga0070679_100017722
381 Ga0070684_100001965
382 Ga0070684_100175213
383 Ga0070697_100001035
384 Ga0070672_100116563
385 Ga0070695_100058900
386 Ga0070693_100050886
387 Ga0068855_100004271
388 Ga0070664_100002291
389 Ga0070664_100059126
390 Ga0068857_100013772
391 Ga0068857_100111560
392 Ga0068857_100322743
393 Ga0068856_100138192
394 Ga0070702_100102632
395 Ga0068859_100022885
396 Ga0068864_100002114
397 Ga0068864_100008968
398 Ga0068866_10228403
399 Ga0068863_100178958
400 Ga0068862_100016138
401 Ga0068862_100058173
402 Ga0081455_10004959
403 Ga0081539_10000165
404 Ga0081539_10000796
405 Ga0081539_10146271
406 Ga0075367_10049810
407 Ga0075366_10014571
408 Ga0075366_10073818
409 Ga0068871_100263764
410 Ga0075428_100003525
411 Ga0075428_100021982
412 Ga0075428_100423431
413 Ga0075431_100041332
414 Ga0075431_100068987
415 Ga0075431_100077271
416 Ga0075431_100093556
417 Ga0075433_10014983
418 Ga0075433_10160758
419 Ga0075434_100090204
420 Ga0075434_100260193
421 Ga0075434_100466561
422 Ga0075429_100292710
423 Ga0068865_100158615
424 Ga0075436_100127968
425 Ga0097620_100022885
426 Ga0075435_100060514
427 Ga0075435_100139108
428 Ga0075435_100238939
429 Ga0099794_10011583
430 Ga0111539_10013569
431 Ga0111539_10014202
432 Ga0111539_10023035
433 Ga0111539_10155115
434 Ga0111539_10759894
435 Ga0105245_10179597
436 Ga0114129_10017975
437 Ga0114129_10025512
438 Ga0114129_10030752
439 Ga0114129_10247589
440 Ga0114129_10248701
441 Ga0105243_10136518
442 Ga0105242_10302380
443 Ga0105248_10006679
444 Ga0105248_10040804
445 Ga0105249_10015713
446 Ga0105249_10115658
447 Ga0105239_10088115
448 Ga0157370_10039708
449 Ga0157369_10187320
450 Ga0157374_10118896
451 Ga0157374_10342580
452 Ga0163162_10000002
453 Ga0163162_10037060
454 Ga0163162_10349739
455 Ga0157375_10135917
456 Ga0157375_10208270
457 Ga0163163_10040497
458 Ga0163163_10094275
459 Ga0157380_10036757
460 Ga0157377_10046684
461 Ga0157379_10320635
462 Ga0213876_10210991
463 Ga0207697_10000774
464 Ga0207697_10014634
465 Ga0207697_10038609
466 Ga0207688_10006424
467 Ga0207705_10068583
468 Ga0207705_10141900
469 Ga0207684_10021238
470 Ga0207684_10026889
471 Ga0207684_10237354
472 Ga0207663_10330752
473 Ga0207657_10237482
474 Ga0207649_10036400
475 Ga0207646_10004572
476 Ga0207681_10051071
477 Ga0207650_10004250
478 Ga0207650_10026170
479 Ga0207650_10140009
480 Ga0207650_10174153
481 Ga0207659_10083008
482 Ga0207659_10214207
483 Ga0207659_10305510
484 Ga0207664_10047508
485 Ga0207686_10171740
486 Ga0207665_10333685
487 Ga0207691_10052867
488 Ga0207691_10130470
489 Ga0207711_10007670
490 Ga0207711_10111603
491 Ga0207689_10038413
492 Ga0207661_10006787
493 Ga0207661_10107835
494 Ga0207679_10007076
495 Ga0207651_10010766
496 Ga0207712_10000041
497 Ga0207712_10007942
498 Ga0207712_10067303
499 Ga0207668_10000297
500 Ga0207668_10141495
501 Ga0207658_10077531
502 Ga0207677_10050699
503 Ga0207678_10146369
504 Ga0207676_10004971
505 Ga0207676_10011688
506 Ga0207674_10018883
507 Ga0207675_100057360
508 Ga0207683_10164584
509 Ga0209971_1010718
510 Ga0209974_10060397
511 Ga0207428_10042985
512 Ga0207428_10143172
513 Ga0265356_1002813
514 Ga0265762_1008128
515 Ga0265770_1001911
516 Ga0265760_10003316
517 Ga0265760_10004186
518 Ga0265325_10006025
519 Ga0265325_10033946
520 Ga0307513_10007135
521 Ga0307408_100077152
522 Ga0307409_100292600
523 Ga0373947_0068260
524 Ga0395900_0321781
525 Ga0395898_0058862
526 Ga0436364_1076548
527 Ga0436364_1171052
528 Ga0436365_1897700
529 Ga0436361_1066501
530 Ga0439439_0022341
531 Ga0450920_002246
532 Ga0450923_010410
533 Ga0450894_001579
534 Ga0450896_000534
535 Ga0450908_004121
536 Ga0450908_026221
537 Ga0450918_005811
538 Ga0453683_0100908
539 Ga0453684_0110239
540 Ga0466967_0149831
541 Ga0495639_0082349
542 Ga0495662_0013311
543 Ga0495630_0000518
544 Ga0495666_0014025
545 Ga0495586_0002579
546 Ga0495635_0275968
547 Ga0495600_0120089
548 Ga0495581_0051238
549 Ga0495674_0001365
550 Ga0495676_0007124
551 Ga0496100_0082956
552 Ga0496102_0048850
553 Ga0496104_0000830
554 Ga0496105_0033716
555 Ga0496106_0319667
556 Ga0496108_0001041
557 Ga0496108_0004654
558 Ga0496108_0090504
559 Ga0496109_0001707
560 Ga0496109_0004852
561 Ga0496110_0002605
562 Ga0496110_0093030
563 Ga0496112_0000626
564 Ga0496112_0001364
565 Ga0496112_0079882
566 Ga0496115_0193144
567 Ga0496125_0000006
568 Ga0501031_0169836
569 Ga0501034_0014728
570 Ga0501036_0056841
571 Ga0501036_0552116
572 Ga0501039_0211224
573 Ga0501039_0213910
574 Ga0501040_0106736
575 Ga0501040_0198801
576 Ga0501041_0287917
577 Ga0501042_0055968
578 Ga0501046_0101956
579 Ga0501046_0157345
580 Ga0501048_0084817
581 Ga0501048_0093178
582 Ga0501048_0381591
583 Ga0501071_0151439
584 Ga0501071_0153239
585 Ga0501072_0060752
586 Ga0501072_0092482
587 Ga0501073_0186140
588 Ga0501074_0138318
589 Ga0501075_0015483
590 Ga0501075_0134449
591 Ga0501079_0112916
592 Ga0501080_0167106
593 Ga0501080_0245882
594 Ga0501081_0073998
595 Ga0501045_0090825
596 Ga0501045_0153774
597 nmdc:mga0k408_3724_c1
598 nmdc:mga05p37_261820_c1
599 nmdc:mga05p37_348531_c1
600 nmdc:mga05p37_56881_c1
601 nmdc:mga05p37_72437_c1
602 nmdc:mga05p37_91918_c1
603 nmdc:mga05p37_95321_c1
604 nmdc:mga09592_14839_c1
605 nmdc:mga09592_526269_c1
606 nmdc:mga0qj67_302318_c1
607 nmdc:mga06r32_18696_c1
608 nmdc:mga06r32_299617_c1
609 nmdc:mga06r32_30750_c1
610 nmdc:mga06r32_62150_c1
611 nmdc:mga06r32_87534_c1
612 nmdc:mga08y16_30684_c1
613 nmdc:mga08y16_38264_c1
614 nmdc:mga08y16_41717_c1
615 nmdc:mga08y16_503013_c1
616 nmdc:mga08y16_73796_c1
617 nmdc:mga08y16_74639_c1
618 nmdc:mga0n895_124856_c1
619 nmdc:mga0n895_223320_c1
620 nmdc:mga0n895_319351_c1
621 nmdc:mga0n895_345807_c1
622 nmdc:mga0n895_55923_c1
623 nmdc:mga0n895_67565_c1
624 nmdc:mga0rr50_217192_c1
625 nmdc:mga0rr50_28903_c1
626 nmdc:mga0rr50_624002_c1
627 nmdc:mga0rr50_71451_c1
628 nmdc:mga0a205_17314_c2
629 nmdc:mga0a205_175603_c1
630 nmdc:mga0a205_181047_c1
631 nmdc:mga0a205_57994_c1
632 nmdc:mga0a205_6997_c1
633 Ga0495619_0206024
634 Ga0501084_0043447
635 Ga0501084_0091246
636 Ga0590071_007520
637 Ga0501082_0120231
638 Ga0501082_0538626

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

75

267

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
4exa-assembly2.cif.gz_C crystal structure of the pa4992, the putative aldo-keto reductase from pseudomona aeruginosa 0.8375 13 261
7svq-assembly2.cif.gz_B crystal structure of l-galactose dehydrogenase from spinacia oleracea in complex with nad+ 0.8354 11 286
4exa-assembly1.cif.gz_B crystal structure of the pa4992, the putative aldo-keto reductase from pseudomona aeruginosa 0.834 13 261
4exb-assembly2.cif.gz_C putative aldo-keto reductase from pseudomona aeruginosa 0.8308 4 261
4exb-assembly1.cif.gz_A putative aldo-keto reductase from pseudomona aeruginosa 0.8307 3 261
ID Description Score Start End Superfamily
af_A0A1D6KXU0_49_191_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.9078 11 121 3.20.20.100
af_Q9VGF2_1_211_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8763 11 182 3.20.20.100
af_A0A0R0FWW7_5_106_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8647 12 83 3.20.20.100
af_A0A0P0W8U8_11_146_3.20.20.100 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8422 11 122 3.20.20.100
1ynpB01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain 0.8383 11 277 3.20.20.100
ID Description Score Start End GO Terms
AF-A0A2V9S5H3-F1-model_v4 Aldo/keto reductase 0.996 9 256
AF-A0A534WDE4-F1-model_v4 Aldo/keto reductase 0.9948 11 241
AF-A0A2V8HTJ6-F1-model_v4 Aldo/keto reductase 0.9891 11 248
AF-A0A2V7I2G6-F1-model_v4 Aldo/keto reductase 0.9869 8 310
AF-A0A841JT75-F1-model_v4 Aryl-alcohol dehydrogenase-like predicted oxidoreductase 0.9841 8 307

Map