F405028
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 319 | 262 | 232 | 359 |
Family's Representative Sequence
| Representative Sequence | 3300006871|Ga0075434_100001780|Ga0075434_10000178012 |
| Length | 388 |
| Sequence | MPRGAAASGHARLPAAARQRPRTDGGPLMAAVTLEQVRKVYPGGVEAVKGVSLTIPNGSFTVLLGPSGCGKSTLLRMIAGLETVSAGTIRIAERRVNEIEPADRDIAMVFQNYALYPHMSVYDNMAYGLRNRGVPKIDIAARVAEAARLLAIEDFLARKPRALSGGQRQRVAMGRAIVREPQAFLFDEPLSNLDAKLRVQMRVEIRRLHNRLKATSIFVTHDQVEAMTLADMVVVMNAGRIEQTGGPTEVYRLPATRFVATFIGAPAMNLLPGRIAGPGIAEIKGGRIPFRAEAFAVALGQEVDVGVRPEDLVLGRAGAGNGLPFAPDFVEELGATRLIHGSIAEVPIVVAVATSSEAVVDGAGAVAVEPAAVHLFDRASGSSLRRGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 3 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 4 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 5 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 6 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 7 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 8 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 9 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 10 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 11 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 12 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 13 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 14 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 15 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 16 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 17 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 18 | 2643221734 | Bosea sp. Root670 | Isolate | Unclassified |
| 19 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 20 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 21 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 22 | 2773857925 | Microvirga vignae BR3299 | Isolate | Unclassified |
| 23 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 24 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 25 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 26 | 2818991467 | Bosea vestrisii 3192 | Isolate | Unclassified |
| 27 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 28 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 29 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 30 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 31 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 32 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 33 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 34 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 35 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 36 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 37 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 38 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 39 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 40 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 41 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 42 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 43 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 44 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 45 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 46 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 47 | 2882456835 | Microvirga sp. KLBC 81 | Isolate | Unclassified |
| 48 | 2884298095 | Microvirga thermotolerans HR1 | Isolate | Rhizosphere |
| 49 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 50 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 51 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 52 | 2891048133 | Martelella lutilitoris GH2-6 | Isolate | Rhizosphere |
| 53 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 54 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 55 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 56 | 2904699407 | |||
| 57 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 58 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 59 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 60 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 61 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 62 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 63 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 64 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 65 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 66 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 67 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 68 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 69 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 70 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 71 | 2989771324 | Rhizobium rhizolycopersici DBTS2 | Isolate | Rhizosphere |
| 72 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 73 | 3003665799 | Methylobacterium aquaticum BG2 | Isolate | Unclassified |
| 74 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 75 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 76 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 77 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 78 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 79 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 80 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 81 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 82 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 83 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 84 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 85 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 86 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 92 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 93 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 95 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 96 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 98 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 99 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 100 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 101 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 102 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 103 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 104 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 105 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 106 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 107 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 108 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 109 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 110 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 111 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 112 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 113 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 114 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 115 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 116 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 117 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 118 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 119 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 120 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 121 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 122 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 126 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 127 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 153 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 154 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 156 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 159 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 160 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 161 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 162 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 163 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 164 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 165 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 166 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 167 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 168 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 169 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 170 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 171 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 172 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 173 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 174 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 175 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 176 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 177 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 178 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 179 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 180 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 198 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 199 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 200 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 201 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 202 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 203 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 204 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 205 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 206 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 207 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 208 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 209 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 210 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 212 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 213 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 216 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 217 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 219 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049671 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought | Metagenome | Rhizosphere |
| 223 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 228 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 229 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 230 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 231 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 232 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 233 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 234 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 235 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 237 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 238 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 239 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 240 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 241 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 242 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 243 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 244 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 245 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 246 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 247 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 250 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 251 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 252 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 253 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 254 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 255 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 256 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 257 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 258 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 259 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 260 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 261 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 262 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 72.96 |
| Metatranscriptomes | 0 |
| Isolates | 27.04 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 20.38 |
| Nodule | 17.24 |
| Rhizoplane | 2.19 |
| Rhizosphere | 44.2 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 15.99 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25152J39213_1003864 | 3300002773 | Bacteria | 4931 |
| 2 | JGI25150J39212_1000064 | 3300002774 | Bacteria | 64002 |
| 3 | JGI25151J46595_10000030 | 3300003187 | Bacteria | 202084 |
| 4 | JGI25151J46595_10000242 | 3300003187 | Bacteria | 64028 |
| 5 | JGI25153J46596_10007551 | 3300003215 | Bacteria | 5326 |
| 6 | JGI25153J46596_10007816 | 3300003215 | Bacteria | 5195 |
| 7 | Ga0055526_1002596 | 3300003771 | Bacteria | 12077 |
| 8 | Ga0055526_1005337 | 3300003771 | Bacteria | 7424 |
| 9 | Ga0055526_1007057 | 3300003771 | Bacteria | 5939 |
| 10 | Ga0055524_1000069 | 3300003775 | Bacteria | 128956 |
| 11 | Ga0055524_1018387 | 3300003775 | Bacteria | 2429 |
| 12 | Ga0055531_10000007 | 3300003794 | Bacteria | 225289 |
| 13 | Ga0055543_1002869 | 3300004625 | Bacteria | 5424 |
| 14 | Ga0065165_1000016 | 3300005262 | Bacteria | 286248 |
| 15 | Ga0065165_1000132 | 3300005262 | Bacteria | 128732 |
| 16 | Ga0065165_1000942 | 3300005262 | Bacteria | 37104 |
| 17 | Ga0070680_100004110 | 3300005336 | Bacteria | 10900 |
| 18 | Ga0070680_100041529 | 3300005336 | Bacteria | 3729 |
| 19 | Ga0070682_100038701 | 3300005337 | Bacteria | 2926 |
| 20 | Ga0070692_10034109 | 3300005345 | Bacteria | 2568 |
| 21 | Ga0070705_100000027 | 3300005440 | Bacteria | 77032 |
| 22 | Ga0070700_100020573 | 3300005441 | Bacteria | 3824 |
| 23 | Ga0070694_100001546 | 3300005444 | Bacteria | 13533 |
| 24 | Ga0070694_100013684 | 3300005444 | Bacteria | 5070 |
| 25 | Ga0070708_100009708 | 3300005445 | Bacteria | 7767 |
| 26 | Ga0070681_10006430 | 3300005458 | Bacteria | 11436 |
| 27 | Ga0070681_10025242 | 3300005458 | Bacteria | 5977 |
| 28 | Ga0070707_100098854 | 3300005468 | Bacteria | 2827 |
| 29 | Ga0070699_100003991 | 3300005518 | Bacteria | 13036 |
| 30 | Ga0068853_100222271 | 3300005539 | Bacteria | 1725 |
| 31 | Ga0070695_100001000 | 3300005545 | Bacteria | 15394 |
| 32 | Ga0070695_100010258 | 3300005545 | Bacteria | 5590 |
| 33 | Ga0070696_100000051 | 3300005546 | Bacteria | 54480 |
| 34 | Ga0070704_100019794 | 3300005549 | Bacteria | 4330 |
| 35 | Ga0068855_100173919 | 3300005563 | Bacteria | 2437 |
| 36 | Ga0068857_100020408 | 3300005577 | Bacteria | 5826 |
| 37 | Ga0068864_100044924 | 3300005618 | Bacteria | 3788 |
| 38 | Ga0068861_100069828 | 3300005719 | Bacteria | 2719 |
| 39 | Ga0068861_100469623 | 3300005719 | Bacteria | 1131 |
| 40 | Ga0068870_10150690 | 3300005840 | Bacteria | 1370 |
| 41 | Ga0068860_100001599 | 3300005843 | Bacteria | 24324 |
| 42 | Ga0068862_100001717 | 3300005844 | Bacteria | 19834 |
| 43 | Ga0081455_10000371 | 3300005937 | Bacteria | 59407 |
| 44 | Ga0081455_10004673 | 3300005937 | Bacteria | 15244 |
| 45 | Ga0081455_10026871 | 3300005937 | Bacteria | 5285 |
| 46 | Ga0081540_1000604 | 3300005983 | Bacteria | 34243 |
| 47 | Ga0081540_1008119 | 3300005983 | Bacteria | 7370 |
| 48 | Ga0081540_1008142 | 3300005983 | Bacteria | 7355 |
| 49 | Ga0081539_10002206 | 3300005985 | Bacteria | 28466 |
| 50 | Ga0075365_10130992 | 3300006038 | Bacteria | 1736 |
| 51 | Ga0075368_10033732 | 3300006042 | Bacteria | 1992 |
| 52 | Ga0075363_100001691 | 3300006048 | Bacteria | 8557 |
| 53 | Ga0075364_10001862 | 3300006051 | Bacteria | 11705 |
| 54 | Ga0075364_10004957 | 3300006051 | Bacteria | 7714 |
| 55 | Ga0075367_10008609 | 3300006178 | Bacteria | 5293 |
| 56 | Ga0075367_10012644 | 3300006178 | Bacteria | 4512 |
| 57 | Ga0075367_10055206 | 3300006178 | Bacteria | 2357 |
| 58 | Ga0068871_100295394 | 3300006358 | Bacteria | 1421 |
| 59 | Ga0075428_100035096 | 3300006844 | Bacteria | 5529 |
| 60 | Ga0075430_100007057 | 3300006846 | Bacteria | 9471 |
| 61 | Ga0075431_100000924 | 3300006847 | Bacteria | 25914 |
| 62 | Ga0075431_100001379 | 3300006847 | Bacteria | 22276 |
| 63 | Ga0075431_100039447 | 3300006847 | Bacteria | 4865 |
| 64 | Ga0075431_100360911 | 3300006847 | Bacteria | 1459 |
| 65 | Ga0075434_100001780 | 3300006871 | Bacteria | 18578 |
| 66 | Ga0075429_100018697 | 3300006880 | Bacteria | 5999 |
| 67 | Ga0099823_1000075 | 3300006944 | Bacteria | 48013 |
| 68 | Ga0079104_1000033 | 3300006946 | Bacteria | 202636 |
| 69 | Ga0075435_100004467 | 3300007076 | Bacteria | 9611 |
| 70 | Ga0105240_10146608 | 3300009093 | Bacteria | 2816 |
| 71 | Ga0111539_10023722 | 3300009094 | Bacteria | 7537 |
| 72 | Ga0105246_10035123 | 3300011119 | Bacteria | 3348 |
| 73 | Ga0171462_1013 | 3300013250 | Bacteria | 202864 |
| 74 | Ga0213872_10071617 | 3300021361 | Bacteria | 1562 |
| 75 | Ga0207425_1000139 | 3300025245 | Bacteria | 64086 |
| 76 | Ga0209129_1000223 | 3300025258 | Bacteria | 64086 |
| 77 | Ga0209673_1003641 | 3300025273 | Bacteria | 8909 |
| 78 | Ga0209673_1004010 | 3300025273 | Bacteria | 8171 |
| 79 | Ga0209130_1000327 | 3300025284 | Bacteria | 54775 |
| 80 | Ga0209675_1000909 | 3300025291 | Bacteria | 18906 |
| 81 | Ga0209025_1000063 | 3300025294 | Bacteria | 303962 |
| 82 | Ga0209025_1000612 | 3300025294 | Bacteria | 64088 |
| 83 | Ga0209025_1008484 | 3300025294 | Bacteria | 7390 |
| 84 | Ga0209564_1000043 | 3300025295 | Bacteria | 388153 |
| 85 | Ga0209564_1000052 | 3300025295 | Bacteria | 356578 |
| 86 | Ga0209758_1000443 | 3300025297 | Bacteria | 69228 |
| 87 | Ga0209758_1000495 | 3300025297 | Bacteria | 64088 |
| 88 | Ga0209050_1004806 | 3300025298 | Bacteria | 8889 |
| 89 | Ga0209256_1000172 | 3300025299 | Bacteria | 129025 |
| 90 | Ga0209256_1000611 | 3300025299 | Bacteria | 49576 |
| 91 | Ga0209256_1001845 | 3300025299 | Bacteria | 19655 |
| 92 | Ga0207426_1004218 | 3300025302 | Bacteria | 7147 |
| 93 | Ga0209051_1002935 | 3300025303 | Bacteria | 11678 |
| 94 | Ga0209051_1005813 | 3300025303 | Bacteria | 7098 |
| 95 | Ga0209257_1000021 | 3300025304 | Bacteria | 771986 |
| 96 | Ga0209257_1002181 | 3300025304 | Bacteria | 20273 |
| 97 | Ga0207653_10000404 | 3300025885 | Bacteria | 18851 |
| 98 | Ga0207707_10011084 | 3300025912 | Bacteria | 7839 |
| 99 | Ga0207695_10023567 | 3300025913 | Bacteria | 6949 |
| 100 | Ga0207660_10001543 | 3300025917 | Bacteria | 15424 |
| 101 | Ga0207660_10042802 | 3300025917 | Bacteria | 3180 |
| 102 | Ga0207646_10018727 | 3300025922 | Bacteria | 6453 |
| 103 | Ga0207669_10227036 | 3300025937 | Bacteria | 1375 |
| 104 | Ga0207712_10006806 | 3300025961 | Bacteria | 7210 |
| 105 | Ga0207640_10203511 | 3300025981 | Bacteria | 1502 |
| 106 | Ga0207708_10052865 | 3300026075 | Bacteria | 3094 |
| 107 | Ga0207676_10029944 | 3300026095 | Bacteria | 4080 |
| 108 | Ga0207674_10123220 | 3300026116 | Bacteria | 2558 |
| 109 | Ga0207675_100268019 | 3300026118 | Bacteria | 1657 |
| 110 | Ga0209281_1000043 | 3300027111 | Bacteria | 341543 |
| 111 | Ga0209389_1000249 | 3300027296 | Bacteria | 34712 |
| 112 | Ga0209813_10000181 | 3300027866 | Bacteria | 20461 |
| 113 | Ga0209813_10009485 | 3300027866 | Bacteria | 2491 |
| 114 | Ga0207428_10045863 | 3300027907 | Bacteria | 3517 |
| 115 | Ga0207428_10054245 | 3300027907 | Bacteria | 3193 |
| 116 | Ga0268265_10009911 | 3300028380 | Bacteria | 6437 |
| 117 | Ga0268264_10004860 | 3300028381 | Bacteria | 11386 |
| 118 | Ga0307515_10077045 | 3300028794 | Bacteria | 4410 |
| 119 | Ga0307515_10097070 | 3300028794 | Bacteria | 3606 |
| 120 | Ga0307515_10168159 | 3300028794 | Bacteria | 2200 |
| 121 | Ga0265327_10000012 | 3300031251 | Bacteria | 530403 |
| 122 | Ga0307513_10008037 | 3300031456 | Bacteria | 13552 |
| 123 | Ga0307509_10207221 | 3300031507 | Bacteria | 1790 |
| 124 | Ga0265314_10001039 | 3300031711 | Bacteria | 32357 |
| 125 | Ga0307516_10058809 | 3300031730 | Bacteria | 3740 |
| 126 | Ga0307405_10003590 | 3300031731 | Bacteria | 7162 |
| 127 | Ga0307410_10192030 | 3300031852 | Bacteria | 1553 |
| 128 | Ga0307406_10154865 | 3300031901 | Bacteria | 1640 |
| 129 | Ga0307412_10004798 | 3300031911 | Bacteria | 7543 |
| 130 | Ga0307409_100283057 | 3300031995 | Bacteria | 1534 |
| 131 | Ga0307416_100139104 | 3300032002 | Bacteria | 2203 |
| 132 | Ga0307414_10039619 | 3300032004 | Bacteria | 3175 |
| 133 | Ga0307415_100175823 | 3300032126 | Bacteria | 1674 |
| 134 | Ga0315911_1000013 | 3300033442 | Bacteria | 239334 |
| 135 | Ga0373939_0020504 | 3300035114 | Bacteria | 1797 |
| 136 | Ga0373962_0005748 | 3300035242 | Bacteria | 2995 |
| 137 | Ga0373931_0000738 | 3300035691 | Bacteria | 13611 |
| 138 | Ga0373931_0003302 | 3300035691 | Bacteria | 7222 |
| 139 | Ga0436361_1214496 | 3300039447 | Bacteria | 9572 |
| 140 | Ga0439434_0034449 | 3300042435 | Bacteria | 1546 |
| 141 | Ga0466972_0087492 | 3300044658 | Bacteria | 1480 |
| 142 | Ga0451576_0541167 | 3300045051 | Bacteria | 1223 |
| 143 | Ga0495627_028990 | 3300046453 | Bacteria | 1764 |
| 144 | Ga0495590_0026101 | 3300046457 | Bacteria | 2052 |
| 145 | Ga0495605_0002954 | 3300046474 | Bacteria | 10294 |
| 146 | Ga0495607_0086472 | 3300046501 | Bacteria | 1709 |
| 147 | Ga0495583_0016172 | 3300046506 | Bacteria | 4021 |
| 148 | Ga0495610_0007227 | 3300046512 | Bacteria | 7449 |
| 149 | Ga0495620_0025262 | 3300046515 | Bacteria | 2813 |
| 150 | Ga0495620_0048343 | 3300046515 | Bacteria | 1826 |
| 151 | Ga0495631_0005687 | 3300046518 | Bacteria | 6505 |
| 152 | Ga0495632_0003099 | 3300046519 | Bacteria | 12045 |
| 153 | Ga0495643_0080196 | 3300046522 | Bacteria | 1700 |
| 154 | Ga0495668_0008208 | 3300046616 | Bacteria | 6556 |
| 155 | Ga0495611_0013344 | 3300046648 | Bacteria | 3497 |
| 156 | Ga0495670_0061617 | 3300046691 | Bacteria | 1886 |
| 157 | Ga0495660_0008560 | 3300046810 | Bacteria | 5990 |
| 158 | Ga0495672_0006265 | 3300047320 | Bacteria | 9267 |
| 159 | Ga0495687_021545 | 3300047443 | Bacteria | 3115 |
| 160 | Ga0495686_0031787 | 3300047472 | Bacteria | 3419 |
| 161 | Ga0496102_0036874 | 3300048905 | Bacteria | 4407 |
| 162 | Ga0496103_0020482 | 3300048906 | Bacteria | 3973 |
| 163 | Ga0496106_0000132 | 3300048909 | Bacteria | 56128 |
| 164 | Ga0496107_0002892 | 3300048910 | Bacteria | 11349 |
| 165 | Ga0496110_0285478 | 3300048913 | Bacteria | 1503 |
| 166 | Ga0496116_0013325 | 3300048919 | Bacteria | 6638 |
| 167 | Ga0496116_0031866 | 3300048919 | Bacteria | 3765 |
| 168 | Ga0496117_0020727 | 3300048920 | Bacteria | 5349 |
| 169 | Ga0496118_0043406 | 3300048921 | Bacteria | 3535 |
| 170 | Ga0496118_0047040 | 3300048921 | Bacteria | 3349 |
| 171 | Ga0496119_0055606 | 3300048922 | Bacteria | 2403 |
| 172 | Ga0496121_0001089 | 3300048924 | Bacteria | 48004 |
| 173 | Ga0496121_0034185 | 3300048924 | Bacteria | 4580 |
| 174 | Ga0496122_0081834 | 3300048925 | Bacteria | 2245 |
| 175 | Ga0496123_0028170 | 3300048926 | Bacteria | 4165 |
| 176 | Ga0496123_0043809 | 3300048926 | Bacteria | 3069 |
| 177 | Ga0496123_0068621 | 3300048926 | Bacteria | 2231 |
| 178 | Ga0496124_0008518 | 3300048927 | Bacteria | 10706 |
| 179 | Ga0496124_0009266 | 3300048927 | Bacteria | 10155 |
| 180 | Ga0496124_0013699 | 3300048927 | Bacteria | 7897 |
| 181 | Ga0495678_033793 | 3300049459 | Bacteria | 2109 |
| 182 | Ga0501034_0219966 | 3300049571 | Bacteria | 1852 |
| 183 | Ga0501039_0150735 | 3300049575 | Bacteria | 1827 |
| 184 | Ga0501040_0048229 | 3300049576 | Bacteria | 2911 |
| 185 | Ga0501046_0039982 | 3300049580 | Bacteria | 3751 |
| 186 | Ga0501048_0105126 | 3300049582 | Bacteria | 1993 |
| 187 | Ga0501069_0207699 | 3300049585 | Bacteria | 1136 |
| 188 | Ga0501070_0092915 | 3300049586 | Bacteria | 2497 |
| 189 | Ga0501072_0028231 | 3300049588 | Bacteria | 4381 |
| 190 | Ga0501074_0079744 | 3300049590 | Bacteria | 2349 |
| 191 | Ga0501075_0058397 | 3300049591 | Bacteria | 2906 |
| 192 | Ga0501077_0008325 | 3300049593 | Bacteria | 6416 |
| 193 | Ga0501077_0094409 | 3300049593 | Bacteria | 1896 |
| 194 | Ga0501238_001035 | 3300049671 | Bacteria | 3168 |
| 195 | Ga0501079_0060146 | 3300049741 | Bacteria | 2931 |
| 196 | Ga0501079_0078144 | 3300049741 | Bacteria | 2560 |
| 197 | Ga0501080_0080154 | 3300049742 | Bacteria | 3035 |
| 198 | Ga0501080_0269058 | 3300049742 | Bacteria | 1551 |
| 199 | Ga0501035_0014562 | 3300049822 | Bacteria | 7260 |
| 200 | Ga0501045_0083747 | 3300049824 | Bacteria | 2353 |
| 201 | Ga0501045_0143761 | 3300049824 | Bacteria | 1774 |
| 202 | nmdc:mga03n38_2668_c1 | 3300050490 | Bacteria | 5571 |
| 203 | nmdc:mga00v17_11981_c1 | 3300050491 | Bacteria | 4773 |
| 204 | nmdc:mga00v17_26_c4 | 3300050491 | Bacteria | 47279 |
| 205 | nmdc:mga06z11_32949_c1 | 3300050494 | Bacteria | 2531 |
| 206 | nmdc:mga06z11_36713_c1 | 3300050494 | Bacteria | 2421 |
| 207 | nmdc:mga04h51_578_c1 | 3300050495 | Bacteria | 8745 |
| 208 | nmdc:mga04h51_957_c1 | 3300050495 | Bacteria | 6665 |
| 209 | nmdc:mga09592_233350_c1 | 3300050508 | Bacteria | 1594 |
| 210 | nmdc:mga09592_89143_c1 | 3300050508 | Bacteria | 2635 |
| 211 | nmdc:mga0qj67_43501_c1 | 3300050509 | Bacteria | 3537 |
| 212 | nmdc:mga0qj67_74131_c1 | 3300050509 | Bacteria | 2720 |
| 213 | nmdc:mga06r32_84243_c1 | 3300050510 | Bacteria | 3098 |
| 214 | nmdc:mga06r32_89126_c1 | 3300050510 | Bacteria | 3012 |
| 215 | nmdc:mga08y16_174822_c1 | 3300050511 | Bacteria | 2230 |
| 216 | nmdc:mga0n895_18112_c1 | 3300050512 | Bacteria | 6512 |
| 217 | nmdc:mga0rr50_3777_c1 | 3300050513 | Bacteria | 8785 |
| 218 | Ga0500557_001701 | 3300053105 | Bacteria | 3733 |
| 219 | Ga0500562_015718 | 3300053108 | Bacteria | 1943 |
| 220 | Ga0500618_000096 | 3300053125 | Bacteria | 72003 |
| 221 | Ga0500559_0008032 | 3300053136 | Bacteria | 4647 |
| 222 | Ga0500568_0001000 | 3300053139 | Bacteria | 19361 |
| 223 | Ga0500603_000275 | 3300053150 | Bacteria | 13576 |
| 224 | Ga0500616_0045532 | 3300053153 | Bacteria | 2337 |
| 225 | Ga0500622_0018132 | 3300053156 | Bacteria | 3743 |
| 226 | Ga0500637_0000247 | 3300053178 | Bacteria | 20090 |
| 227 | Ga0500599_000577 | 3300053736 | Bacteria | 3879 |
| 228 | Ga0501084_0085050 | 3300054114 | Bacteria | 2656 |
| 229 | Ga0501084_0245891 | 3300054114 | Bacteria | 1510 |
| 230 | Ga0501082_0041034 | 3300060353 | Bacteria | 3990 |
| 231 | Ga0501082_0171092 | 3300060353 | Bacteria | 1889 |
| 232 | Ga0530510_0047242 | 3300061734 | Bacteria | 3110 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050509 | nmdc:mga0qj67_43501_c1 | nmdc:mga0qj67_43501_c1_2565_3509 | 301 |
| 2 | 3300011119 | Ga0105246_10035123 | Ga0105246_100351234 | 303 |
| 3 | 3300003187 | JGI25151J46595_10000030 | JGI25151J46595_1000003097 | 315 |
| 4 | 3300025294 | Ga0209025_1000063 | Ga0209025_1000063129 | 315 |
| 5 | 3300053136 | Ga0500559_0008032 | Ga0500559_0008032_1019_2101 | 325 |
| 6 | 3300044658 | Ga0466972_0087492 | Ga0466972_0087492_429_1451 | 326 |
| 7 | 3300005336 | Ga0070680_100041529 | Ga0070680_1000415294 | 327 |
| 8 | 3300005337 | Ga0070682_100038701 | Ga0070682_1000387013 | 327 |
| 9 | 3300005458 | Ga0070681_10025242 | Ga0070681_100252426 | 327 |
| 10 | 3300005539 | Ga0068853_100222271 | Ga0068853_1002222712 | 327 |
| 11 | 3300005563 | Ga0068855_100173919 | Ga0068855_1001739192 | 327 |
| 12 | 3300006358 | Ga0068871_100295394 | Ga0068871_1002953942 | 327 |
| 13 | 3300009093 | Ga0105240_10146608 | Ga0105240_101466081 | 327 |
| 14 | 3300025912 | Ga0207707_10011084 | Ga0207707_100110849 | 327 |
| 15 | 3300025913 | Ga0207695_10023567 | Ga0207695_100235677 | 327 |
| 16 | 3300025917 | Ga0207660_10042802 | Ga0207660_100428023 | 327 |
| 17 | 3300025981 | Ga0207640_10203511 | Ga0207640_102035112 | 327 |
| 18 | 3300031711 | Ga0265314_10001039 | Ga0265314_1000103918 | 327 |
| 19 | iso_pu_bacteria | 2507262055 | 2507505131 | 328 |
| 20 | iso_pu_bacteria | 2508501009 | 2508539066 | 328 |
| 21 | iso_pu_bacteria | 2513237137 | 2513860471 | 328 |
| 22 | iso_pu_bacteria | 2515154112 | 2515625602 | 328 |
| 23 | iso_pu_bacteria | 2517572143 | 2517888727 | 328 |
| 24 | iso_pu_bacteria | 2524023205 | 2524435985 | 328 |
| 25 | iso_pu_bacteria | 2524023228 | 2524538822 | 328 |
| 26 | iso_pu_bacteria | 2791355197 | 2793067546 | 328 |
| 27 | iso_pu_bacteria | 2874590934 | 2874597130 | 328 |
| 28 | iso_pu_bacteria | 2874645413 | 2874646936 | 328 |
| 29 | iso_pu_bacteria | 2876771140 | 2876777594 | 328 |
| 30 | iso_pu_bacteria | 2876818435 | 2876825676 | 328 |
| 31 | iso_pu_bacteria | 2879074833 | 2879076155 | 328 |
| 32 | iso_pu_bacteria | 2879127579 | 2879130960 | 328 |
| 33 | iso_pu_bacteria | 2879142872 | 2879148805 | 328 |
| 34 | iso_pu_bacteria | 2885374607 | 2885376926 | 328 |
| 35 | iso_pu_bacteria | 2885383462 | 2885391010 | 328 |
| 36 | iso_pu_bacteria | 2885409591 | 2885410500 | 328 |
| 37 | iso_pu_bacteria | 2903748898 | 2903756375 | 328 |
| 38 | iso_pu_bacteria | 2904699407 | 2904708850 | 328 |
| 39 | iso_pu_bacteria | 2906626472 | 2906633393 | 328 |
| 40 | iso_pu_bacteria | 2906635258 | 2906640091 | 328 |
| 41 | iso_pu_bacteria | 2906660503 | 2906667485 | 328 |
| 42 | iso_pu_bacteria | 2908739725 | 2908747320 | 328 |
| 43 | iso_pu_bacteria | 2935648319 | 2935653660 | 328 |
| 44 | iso_pu_bacteria | 2935656913 | 2935662409 | 328 |
| 45 | iso_pu_bacteria | 2935975950 | 2935977642 | 328 |
| 46 | iso_pu_bacteria | 2935984226 | 2935985124 | 328 |
| 47 | iso_pu_bacteria | 2936011229 | 2936016711 | 328 |
| 48 | iso_pu_bacteria | 2936019824 | 2936025344 | 328 |
| 49 | iso_pu_bacteria | 2936028420 | 2936034186 | 328 |
| 50 | iso_pu_bacteria | 2936046547 | 2936052243 | 328 |
| 51 | iso_pu_bacteria | 2936055302 | 2936056296 | 328 |
| 52 | iso_pu_bacteria | 3005474847 | 3005474958 | 328 |
| 53 | iso_pu_bacteria | 8006933436 | 8006936374 | 328 |
| 54 | iso_pu_bacteria | 8006973647 | 8006976343 | 328 |
| 55 | iso_pu_bacteria | 8016583857 | 8016586484 | 328 |
| 56 | iso_pu_bacteria | 8016630954 | 8016635651 | 328 |
| 57 | iso_pu_bacteria | 8019619141 | 8019622863 | 328 |
| 58 | iso_pu_bacteria | 8019629233 | 8019630250 | 328 |
| 59 | iso_pu_bacteria | 8019638758 | 8019640360 | 328 |
| 60 | iso_pu_bacteria | 8019659431 | 8019667080 | 328 |
| 61 | iso_pu_bacteria | 8019668869 | 8019676869 | 328 |
| 62 | iso_pu_bacteria | 8019678201 | 8019679120 | 328 |
| 63 | iso_pu_bacteria | 8056681323 | 8056687496 | 328 |
| 64 | 3300049822 | Ga0501035_0014562 | Ga0501035_0014562_2409_3461 | 329 |
| 65 | 3300013250 | Ga0171462_1013 | Ga0171462_1013128 | 331 |
| 66 | 3300003215 | JGI25153J46596_10007816 | JGI25153J46596_100078164 | 332 |
| 67 | 3300005937 | Ga0081455_10004673 | Ga0081455_100046732 | 332 |
| 68 | 3300005937 | Ga0081455_10026871 | Ga0081455_100268715 | 332 |
| 69 | 3300005983 | Ga0081540_1008119 | Ga0081540_10081191 | 332 |
| 70 | 3300005983 | Ga0081540_1008142 | Ga0081540_10081425 | 332 |
| 71 | 3300005985 | Ga0081539_10002206 | Ga0081539_1000220629 | 332 |
| 72 | 3300025297 | Ga0209758_1000443 | Ga0209758_100044358 | 332 |
| 73 | 3300031995 | Ga0307409_100283057 | Ga0307409_1002830572 | 332 |
| 74 | 3300033442 | Ga0315911_1000013 | Ga0315911_100001386 | 332 |
| 75 | 3300053153 | Ga0500616_0045532 | Ga0500616_0045532_658_1740 | 332 |
| 76 | 3300053156 | Ga0500622_0018132 | Ga0500622_0018132_1535_2617 | 332 |
| 77 | 3300053736 | Ga0500599_000577 | Ga0500599_000577_358_1440 | 332 |
| 78 | 3300028794 | Ga0307515_10168159 | Ga0307515_101681592 | 333 |
| 79 | 3300005468 | Ga0070707_100098854 | Ga0070707_1000988543 | 334 |
| 80 | 3300025922 | Ga0207646_10018727 | Ga0207646_100187275 | 334 |
| 81 | 3300031507 | Ga0307509_10207221 | Ga0307509_102072211 | 334 |
| 82 | 3300053150 | Ga0500603_000275 | Ga0500603_000275_4382_5476 | 334 |
| 83 | 3300053178 | Ga0500637_0000247 | Ga0500637_0000247_11578_12672 | 334 |
| 84 | 3300003771 | Ga0055526_1005337 | Ga0055526_10053377 | 335 |
| 85 | 3300003771 | Ga0055526_1007057 | Ga0055526_10070574 | 335 |
| 86 | 3300003775 | Ga0055524_1000069 | Ga0055524_100006949 | 335 |
| 87 | 3300025291 | Ga0209675_1000909 | Ga0209675_100090920 | 335 |
| 88 | 3300025295 | Ga0209564_1000052 | Ga0209564_100005275 | 335 |
| 89 | 3300025299 | Ga0209256_1000172 | Ga0209256_100017278 | 335 |
| 90 | iso_pu_bacteria | 3003665799 | 3003667299 | 337 |
| 91 | iso_pu_bacteria | 2643221639 | 2644222771 | 339 |
| 92 | iso_pu_bacteria | 2643221646 | 2644260691 | 339 |
| 93 | iso_pu_bacteria | 2738541337 | 2739058932 | 339 |
| 94 | 3300005262 | Ga0065165_1000132 | Ga0065165_100013290 | 340 |
| 95 | 3300025284 | Ga0209130_1000327 | Ga0209130_100032715 | 340 |
| 96 | 3300025294 | Ga0209025_1008484 | Ga0209025_10084845 | 340 |
| 97 | 3300025302 | Ga0207426_1004218 | Ga0207426_10042182 | 340 |
| 98 | 3300049585 | Ga0501069_0207699 | Ga0501069_0207699_60_1124 | 340 |
| 99 | 3300049742 | Ga0501080_0080154 | Ga0501080_0080154_1789_2853 | 340 |
| 100 | 3300060353 | Ga0501082_0171092 | Ga0501082_0171092_623_1687 | 340 |
| 101 | iso_pu_bacteria | 2508501114 | 2509076998 | 340 |
| 102 | iso_pu_bacteria | 2775506901 | 2776262637 | 340 |
| 103 | iso_pu_bacteria | 2835312727 | 2835313103 | 340 |
| 104 | iso_pu_bacteria | 2884298095 | 2884298700 | 340 |
| 105 | iso_pu_bacteria | 2894232714 | 2894233003 | 340 |
| 106 | iso_pu_bacteria | 2643221734 | 2644737543 | 341 |
| 107 | iso_pu_bacteria | 2643221736 | 2644743483 | 341 |
| 108 | iso_pu_bacteria | 2773857925 | 2774868427 | 341 |
| 109 | iso_pu_bacteria | 2818991467 | 2819720500 | 341 |
| 110 | iso_pu_bacteria | 2841760612 | 2841764612 | 341 |
| 111 | iso_pu_bacteria | 2841911363 | 2841913848 | 341 |
| 112 | iso_pu_bacteria | 2841917233 | 2841919543 | 341 |
| 113 | iso_pu_bacteria | 2844104063 | 2844107940 | 341 |
| 114 | iso_pu_bacteria | 2851182111 | 2851187872 | 341 |
| 115 | iso_pu_bacteria | 2851246043 | 2851250046 | 341 |
| 116 | iso_pu_bacteria | 2882456835 | 2882459223 | 341 |
| 117 | iso_pu_bacteria | 2917699015 | 2917702895 | 341 |
| 118 | 3300031901 | Ga0307406_10154865 | Ga0307406_101548652 | 342 |
| 119 | 3300003794 | Ga0055531_10000007 | Ga0055531_10000007123 | 343 |
| 120 | 3300006038 | Ga0075365_10130992 | Ga0075365_101309922 | 343 |
| 121 | 3300006042 | Ga0075368_10033732 | Ga0075368_100337322 | 343 |
| 122 | 3300006178 | Ga0075367_10055206 | Ga0075367_100552062 | 343 |
| 123 | 3300021361 | Ga0213872_10071617 | Ga0213872_100716172 | 343 |
| 124 | 3300025298 | Ga0209050_1004806 | Ga0209050_10048065 | 343 |
| 125 | 3300025303 | Ga0209051_1005813 | Ga0209051_10058135 | 343 |
| 126 | 3300025304 | Ga0209257_1000021 | Ga0209257_1000021105 | 343 |
| 127 | 3300027866 | Ga0209813_10000181 | Ga0209813_100001812 | 343 |
| 128 | 3300028794 | Ga0307515_10077045 | Ga0307515_100770452 | 343 |
| 129 | 3300031251 | Ga0265327_10000012 | Ga0265327_1000001261 | 343 |
| 130 | 3300039447 | Ga0436361_1214496 | Ga0436361_1214496_5793_6893 | 343 |
| 131 | 3300049593 | Ga0501077_0094409 | Ga0501077_0094409_450_1529 | 343 |
| 132 | 3300049741 | Ga0501079_0078144 | Ga0501079_0078144_1251_2330 | 343 |
| 133 | 3300050495 | nmdc:mga04h51_578_c1 | nmdc:mga04h51_578_c1_7266_8357 | 343 |
| 134 | 3300054114 | Ga0501084_0245891 | Ga0501084_0245891_170_1249 | 343 |
| 135 | 3300061734 | Ga0530510_0047242 | Ga0530510_0047242_1822_2901 | 343 |
| 136 | 3300005336 | Ga0070680_100004110 | Ga0070680_1000041104 | 344 |
| 137 | 3300005345 | Ga0070692_10034109 | Ga0070692_100341093 | 344 |
| 138 | 3300005440 | Ga0070705_100000027 | Ga0070705_10000002734 | 344 |
| 139 | 3300005441 | Ga0070700_100020573 | Ga0070700_1000205732 | 344 |
| 140 | 3300005444 | Ga0070694_100001546 | Ga0070694_1000015466 | 344 |
| 141 | 3300005445 | Ga0070708_100009708 | Ga0070708_1000097085 | 344 |
| 142 | 3300005458 | Ga0070681_10006430 | Ga0070681_1000643010 | 344 |
| 143 | 3300005518 | Ga0070699_100003991 | Ga0070699_10000399110 | 344 |
| 144 | 3300005545 | Ga0070695_100001000 | Ga0070695_1000010008 | 344 |
| 145 | 3300005546 | Ga0070696_100000051 | Ga0070696_10000005147 | 344 |
| 146 | 3300005549 | Ga0070704_100019794 | Ga0070704_1000197942 | 344 |
| 147 | 3300005577 | Ga0068857_100020408 | Ga0068857_1000204082 | 344 |
| 148 | 3300005618 | Ga0068864_100044924 | Ga0068864_1000449241 | 344 |
| 149 | 3300005719 | Ga0068861_100069828 | Ga0068861_1000698283 | 344 |
| 150 | 3300005840 | Ga0068870_10150690 | Ga0068870_101506901 | 344 |
| 151 | 3300005843 | Ga0068860_100001599 | Ga0068860_10000159920 | 344 |
| 152 | 3300005844 | Ga0068862_100001717 | Ga0068862_1000017178 | 344 |
| 153 | 3300006847 | Ga0075431_100000924 | Ga0075431_10000092418 | 344 |
| 154 | 3300006880 | Ga0075429_100018697 | Ga0075429_1000186972 | 344 |
| 155 | 3300025885 | Ga0207653_10000404 | Ga0207653_1000040418 | 344 |
| 156 | 3300025917 | Ga0207660_10001543 | Ga0207660_100015434 | 344 |
| 157 | 3300025937 | Ga0207669_10227036 | Ga0207669_102270361 | 344 |
| 158 | 3300025961 | Ga0207712_10006806 | Ga0207712_100068066 | 344 |
| 159 | 3300026075 | Ga0207708_10052865 | Ga0207708_100528653 | 344 |
| 160 | 3300026095 | Ga0207676_10029944 | Ga0207676_100299441 | 344 |
| 161 | 3300026116 | Ga0207674_10123220 | Ga0207674_101232202 | 344 |
| 162 | 3300026118 | Ga0207675_100268019 | Ga0207675_1002680192 | 344 |
| 163 | 3300028380 | Ga0268265_10009911 | Ga0268265_100099114 | 344 |
| 164 | 3300028381 | Ga0268264_10004860 | Ga0268264_100048603 | 344 |
| 165 | 3300031852 | Ga0307410_10192030 | Ga0307410_101920302 | 344 |
| 166 | 3300032126 | Ga0307415_100175823 | Ga0307415_1001758232 | 344 |
| 167 | 3300035114 | Ga0373939_0020504 | Ga0373939_0020504_688_1764 | 344 |
| 168 | 3300035242 | Ga0373962_0005748 | Ga0373962_0005748_165_1325 | 344 |
| 169 | 3300035691 | Ga0373931_0003302 | Ga0373931_0003302_3726_4886 | 344 |
| 170 | 3300048905 | Ga0496102_0036874 | Ga0496102_0036874_2691_3764 | 344 |
| 171 | 3300048906 | Ga0496103_0020482 | Ga0496103_0020482_2230_3303 | 344 |
| 172 | 3300048909 | Ga0496106_0000132 | Ga0496106_0000132_48490_49563 | 344 |
| 173 | 3300048910 | Ga0496107_0002892 | Ga0496107_0002892_2679_3752 | 344 |
| 174 | 3300049575 | Ga0501039_0150735 | Ga0501039_0150735_628_1701 | 344 |
| 175 | 3300049582 | Ga0501048_0105126 | Ga0501048_0105126_107_1180 | 344 |
| 176 | 3300049586 | Ga0501070_0092915 | Ga0501070_0092915_871_1941 | 344 |
| 177 | 3300049588 | Ga0501072_0028231 | Ga0501072_0028231_1698_2771 | 344 |
| 178 | 3300049590 | Ga0501074_0079744 | Ga0501074_0079744_916_1989 | 344 |
| 179 | 3300049591 | Ga0501075_0058397 | Ga0501075_0058397_1064_2137 | 344 |
| 180 | 3300049593 | Ga0501077_0008325 | Ga0501077_0008325_3739_4812 | 344 |
| 181 | 3300049741 | Ga0501079_0060146 | Ga0501079_0060146_620_1693 | 344 |
| 182 | 3300049742 | Ga0501080_0269058 | Ga0501080_0269058_437_1510 | 344 |
| 183 | 3300049824 | Ga0501045_0143761 | Ga0501045_0143761_223_1296 | 344 |
| 184 | 3300060353 | Ga0501082_0041034 | Ga0501082_0041034_1202_2275 | 344 |
| 185 | 3300003771 | Ga0055526_1002596 | Ga0055526_100259611 | 345 |
| 186 | 3300003775 | Ga0055524_1018387 | Ga0055524_10183872 | 345 |
| 187 | 3300025295 | Ga0209564_1000043 | Ga0209564_1000043172 | 345 |
| 188 | 3300025299 | Ga0209256_1000611 | Ga0209256_100061129 | 345 |
| 189 | 3300032004 | Ga0307414_10039619 | Ga0307414_100396192 | 345 |
| 190 | 3300045051 | Ga0451576_0541167 | Ga0451576_0541167_11_1072 | 345 |
| 191 | 3300048926 | Ga0496123_0028170 | Ga0496123_0028170_3019_4098 | 345 |
| 192 | 3300049671 | Ga0501238_001035 | Ga0501238_001035_217_1296 | 345 |
| 193 | iso_pu_bacteria | 2831864461 | 2831869234 | 345 |
| 194 | 3300005937 | Ga0081455_10000371 | Ga0081455_1000037154 | 346 |
| 195 | 3300006871 | Ga0075434_100001780 | Ga0075434_10000178012 | 346 |
| 196 | 3300007076 | Ga0075435_100004467 | Ga0075435_10000446711 | 346 |
| 197 | 3300009094 | Ga0111539_10023722 | Ga0111539_100237223 | 346 |
| 198 | 3300027907 | Ga0207428_10054245 | Ga0207428_100542453 | 346 |
| 199 | 3300031456 | Ga0307513_10008037 | Ga0307513_100080375 | 346 |
| 200 | 3300031730 | Ga0307516_10058809 | Ga0307516_100588092 | 346 |
| 201 | 3300032002 | Ga0307416_100139104 | Ga0307416_1001391042 | 346 |
| 202 | 3300042435 | Ga0439434_0034449 | Ga0439434_0034449_219_1280 | 346 |
| 203 | 3300049571 | Ga0501034_0219966 | Ga0501034_0219966_342_1427 | 346 |
| 204 | 3300050511 | nmdc:mga08y16_174822_c1 | nmdc:mga08y16_174822_c1_457_1539 | 346 |
| 205 | 3300050512 | nmdc:mga0n895_18112_c1 | nmdc:mga0n895_18112_c1_905_1987 | 346 |
| 206 | 3300050513 | nmdc:mga0rr50_3777_c1 | nmdc:mga0rr50_3777_c1_884_1966 | 346 |
| 207 | 3300005444 | Ga0070694_100013684 | Ga0070694_1000136843 | 347 |
| 208 | 3300005545 | Ga0070695_100010258 | Ga0070695_1000102583 | 347 |
| 209 | 3300005719 | Ga0068861_100469623 | Ga0068861_1004696231 | 347 |
| 210 | 3300005983 | Ga0081540_1000604 | Ga0081540_10006044 | 347 |
| 211 | 3300028794 | Ga0307515_10097070 | Ga0307515_100970704 | 347 |
| 212 | 3300035691 | Ga0373931_0000738 | Ga0373931_0000738_5547_6626 | 347 |
| 213 | 3300049824 | Ga0501045_0083747 | Ga0501045_0083747_987_2072 | 348 |
| 214 | 3300004625 | Ga0055543_1002869 | Ga0055543_10028695 | 349 |
| 215 | 3300005262 | Ga0065165_1000016 | Ga0065165_10000165 | 349 |
| 216 | 3300006844 | Ga0075428_100035096 | Ga0075428_1000350967 | 349 |
| 217 | 3300006846 | Ga0075430_100007057 | Ga0075430_10000705710 | 349 |
| 218 | 3300006847 | Ga0075431_100001379 | Ga0075431_10000137914 | 349 |
| 219 | 3300006847 | Ga0075431_100039447 | Ga0075431_1000394475 | 349 |
| 220 | 3300006847 | Ga0075431_100360911 | Ga0075431_1003609112 | 349 |
| 221 | 3300006944 | Ga0099823_1000075 | Ga0099823_100007516 | 349 |
| 222 | 3300025273 | Ga0209673_1004010 | Ga0209673_10040103 | 349 |
| 223 | 3300025299 | Ga0209256_1001845 | Ga0209256_10018455 | 349 |
| 224 | 3300025303 | Ga0209051_1002935 | Ga0209051_10029356 | 349 |
| 225 | 3300025304 | Ga0209257_1002181 | Ga0209257_100218121 | 349 |
| 226 | 3300027296 | Ga0209389_1000249 | Ga0209389_100024916 | 349 |
| 227 | 3300027907 | Ga0207428_10045863 | Ga0207428_100458633 | 349 |
| 228 | 3300050508 | nmdc:mga09592_233350_c1 | nmdc:mga09592_233350_c1_266_1351 | 349 |
| 229 | 3300050508 | nmdc:mga09592_89143_c1 | nmdc:mga09592_89143_c1_129_1214 | 349 |
| 230 | 3300050509 | nmdc:mga0qj67_74131_c1 | nmdc:mga0qj67_74131_c1_214_1299 | 349 |
| 231 | 3300050510 | nmdc:mga06r32_84243_c1 | nmdc:mga06r32_84243_c1_1712_2797 | 349 |
| 232 | 3300050510 | nmdc:mga06r32_89126_c1 | nmdc:mga06r32_89126_c1_1144_2229 | 349 |
| 233 | 3300005262 | Ga0065165_1000942 | Ga0065165_10009425 | 350 |
| 234 | 3300006048 | Ga0075363_100001691 | Ga0075363_1000016914 | 350 |
| 235 | 3300006051 | Ga0075364_10001862 | Ga0075364_100018628 | 350 |
| 236 | 3300006178 | Ga0075367_10008609 | Ga0075367_100086092 | 350 |
| 237 | 3300006178 | Ga0075367_10012644 | Ga0075367_100126442 | 350 |
| 238 | 3300027866 | Ga0209813_10009485 | Ga0209813_100094852 | 350 |
| 239 | 3300050490 | nmdc:mga03n38_2668_c1 | nmdc:mga03n38_2668_c1_3470_4558 | 350 |
| 240 | 3300050491 | nmdc:mga00v17_11981_c1 | nmdc:mga00v17_11981_c1_3193_4281 | 350 |
| 241 | 3300050494 | nmdc:mga06z11_32949_c1 | nmdc:mga06z11_32949_c1_497_1585 | 350 |
| 242 | 3300050494 | nmdc:mga06z11_36713_c1 | nmdc:mga06z11_36713_c1_37_1125 | 350 |
| 243 | 3300050495 | nmdc:mga04h51_957_c1 | nmdc:mga04h51_957_c1_2985_4073 | 350 |
| 244 | iso_pu_bacteria | 2891048133 | 2891048232 | 353 |
| 245 | iso_pu_bacteria | 8005658619 | 8005661614 | 354 |
| 246 | 3300049576 | Ga0501040_0048229 | Ga0501040_0048229_436_1554 | 357 |
| 247 | 3300049580 | Ga0501046_0039982 | Ga0501046_0039982_2532_3650 | 357 |
| 248 | 3300054114 | Ga0501084_0085050 | Ga0501084_0085050_692_1810 | 357 |
| 249 | iso_pu_bacteria | 2643221558 | 2643812624 | 357 |
| 250 | iso_pu_bacteria | 2558860983 | 2561469089 | 359 |
| 251 | iso_pu_bacteria | 2821123053 | 2821123339 | 360 |
| 252 | iso_pu_bacteria | 2838736955 | 2838739638 | 360 |
| 253 | iso_pu_bacteria | 2841840854 | 2841844238 | 360 |
| 254 | iso_pu_bacteria | 2842140634 | 2842143959 | 360 |
| 255 | iso_pu_bacteria | 2857531043 | 2857533710 | 360 |
| 256 | iso_pu_bacteria | 2643221643 | 2644237548 | 362 |
| 257 | iso_pu_bacteria | 2643221653 | 2644297967 | 362 |
| 258 | iso_pu_bacteria | 2643221719 | 2644656220 | 362 |
| 259 | iso_pu_bacteria | 2818991272 | 2819244436 | 362 |
| 260 | iso_pu_bacteria | 2989776772 | 2989777084 | 362 |
| 261 | 3300006051 | Ga0075364_10004957 | Ga0075364_100049578 | 363 |
| 262 | 3300048924 | Ga0496121_0001089 | Ga0496121_0001089_6701_7804 | 363 |
| 263 | 3300050491 | nmdc:mga00v17_26_c4 | nmdc:mga00v17_26_c4_24073_25176 | 363 |
| 264 | iso_pu_bacteria | 2585427594 | 2585843837 | 363 |
| 265 | iso_pu_bacteria | 2599185236 | 2599718903 | 363 |
| 266 | iso_pu_bacteria | 2738541293 | 2738800913 | 363 |
| 267 | iso_pu_bacteria | 2899803654 | 2899805679 | 363 |
| 268 | iso_pu_bacteria | 2989771324 | 2989772464 | 363 |
| 269 | iso_pu_bacteria | 8054460903 | 8054461078 | 363 |
| 270 | 3300006946 | Ga0079104_1000033 | Ga0079104_100003361 | 364 |
| 271 | 3300027111 | Ga0209281_1000043 | Ga0209281_1000043199 | 364 |
| 272 | 3300048924 | Ga0496121_0034185 | Ga0496121_0034185_1377_2474 | 364 |
| 273 | 3300053125 | Ga0500618_000096 | Ga0500618_000096_67405_68502 | 364 |
| 274 | 3300046453 | Ga0495627_028990 | Ga0495627_028990_389_1492 | 366 |
| 275 | 3300046457 | Ga0495590_0026101 | Ga0495590_0026101_450_1553 | 366 |
| 276 | 3300046474 | Ga0495605_0002954 | Ga0495605_0002954_1636_2739 | 366 |
| 277 | 3300046501 | Ga0495607_0086472 | Ga0495607_0086472_547_1650 | 366 |
| 278 | 3300046506 | Ga0495583_0016172 | Ga0495583_0016172_1842_2945 | 366 |
| 279 | 3300046512 | Ga0495610_0007227 | Ga0495610_0007227_5239_6342 | 366 |
| 280 | 3300046515 | Ga0495620_0025262 | Ga0495620_0025262_393_1496 | 366 |
| 281 | 3300046515 | Ga0495620_0048343 | Ga0495620_0048343_146_1249 | 366 |
| 282 | 3300046518 | Ga0495631_0005687 | Ga0495631_0005687_3767_4870 | 366 |
| 283 | 3300046519 | Ga0495632_0003099 | Ga0495632_0003099_298_1401 | 366 |
| 284 | 3300046522 | Ga0495643_0080196 | Ga0495643_0080196_293_1396 | 366 |
| 285 | 3300046616 | Ga0495668_0008208 | Ga0495668_0008208_3279_4382 | 366 |
| 286 | 3300046648 | Ga0495611_0013344 | Ga0495611_0013344_1328_2431 | 366 |
| 287 | 3300046691 | Ga0495670_0061617 | Ga0495670_0061617_44_1147 | 366 |
| 288 | 3300046810 | Ga0495660_0008560 | Ga0495660_0008560_1370_2473 | 366 |
| 289 | 3300047320 | Ga0495672_0006265 | Ga0495672_0006265_839_1942 | 366 |
| 290 | 3300047443 | Ga0495687_021545 | Ga0495687_021545_394_1497 | 366 |
| 291 | 3300047472 | Ga0495686_0031787 | Ga0495686_0031787_1259_2362 | 366 |
| 292 | 3300049459 | Ga0495678_033793 | Ga0495678_033793_690_1793 | 366 |
| 293 | 3300053105 | Ga0500557_001701 | Ga0500557_001701_895_1998 | 366 |
| 294 | 3300053108 | Ga0500562_015718 | Ga0500562_015718_229_1332 | 366 |
| 295 | 3300053139 | Ga0500568_0001000 | Ga0500568_0001000_7496_8599 | 366 |
| 296 | 3300002773 | JGI25152J39213_1003864 | JGI25152J39213_10038643 | 367 |
| 297 | 3300002774 | JGI25150J39212_1000064 | JGI25150J39212_10000643 | 367 |
| 298 | 3300003187 | JGI25151J46595_10000242 | JGI25151J46595_1000024270 | 367 |
| 299 | 3300003215 | JGI25153J46596_10007551 | JGI25153J46596_100075513 | 367 |
| 300 | 3300025245 | Ga0207425_1000139 | Ga0207425_100013971 | 367 |
| 301 | 3300025258 | Ga0209129_1000223 | Ga0209129_10002234 | 367 |
| 302 | 3300025273 | Ga0209673_1003641 | Ga0209673_10036413 | 367 |
| 303 | 3300025294 | Ga0209025_1000612 | Ga0209025_10006124 | 367 |
| 304 | 3300025297 | Ga0209758_1000495 | Ga0209758_10004954 | 367 |
| 305 | 3300031731 | Ga0307405_10003590 | Ga0307405_100035903 | 367 |
| 306 | 3300031911 | Ga0307412_10004798 | Ga0307412_100047983 | 367 |
| 307 | 3300048913 | Ga0496110_0285478 | Ga0496110_0285478_279_1382 | 367 |
| 308 | 3300048919 | Ga0496116_0013325 | Ga0496116_0013325_4698_5801 | 367 |
| 309 | 3300048919 | Ga0496116_0031866 | Ga0496116_0031866_1867_2970 | 367 |
| 310 | 3300048920 | Ga0496117_0020727 | Ga0496117_0020727_2079_3182 | 367 |
| 311 | 3300048921 | Ga0496118_0043406 | Ga0496118_0043406_903_2006 | 367 |
| 312 | 3300048921 | Ga0496118_0047040 | Ga0496118_0047040_918_2024 | 367 |
| 313 | 3300048922 | Ga0496119_0055606 | Ga0496119_0055606_330_1433 | 367 |
| 314 | 3300048925 | Ga0496122_0081834 | Ga0496122_0081834_768_1871 | 367 |
| 315 | 3300048926 | Ga0496123_0043809 | Ga0496123_0043809_1136_2239 | 367 |
| 316 | 3300048926 | Ga0496123_0068621 | Ga0496123_0068621_837_1940 | 367 |
| 317 | 3300048927 | Ga0496124_0008518 | Ga0496124_0008518_5093_6196 | 367 |
| 318 | 3300048927 | Ga0496124_0009266 | Ga0496124_0009266_8420_9526 | 367 |
| 319 | 3300048927 | Ga0496124_0013699 | Ga0496124_0013699_78_1181 | 367 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2onk-assembly1.cif.gz_B | abc transporter modbc in complex with its binding protein moda | 0.9454 | 4 | 234 |
| 7x0q-assembly1.cif.gz_A | crystal structure of atpase clo1313_2554 from clostridium thermocellum | 0.945 | 4 | 350 |
| 4tqu-assembly1.cif.gz_T | crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate | 0.9436 | 2 | 350 |
| 4mki-assembly1.cif.gz_B | cobalt transporter atp-binding subunit | 0.9413 | 4 | 225 |
| 8ja7-assembly1.cif.gz_D | cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose | 0.9392 | 1 | 349 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2awoD01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9744 | 3 | 217 | 3.40.50.300 |
| 1oxuA01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9692 | 1 | 236 | 3.40.50.300 |
| af_P77795_1_218_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9661 | 1 | 218 | 3.40.50.300 |
| af_Q58762_1_229_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9632 | 4 | 236 | 3.40.50.300 |
| af_P77795_1_218_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9618 | 1 | 218 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A382Y1F8-F1-model_v4 | ABC transporter domain-containing protein | 0.9871 | 1 | 200 |
GO:0001407
GO:0005524 GO:0008643 GO:0015794 GO:0016887 GO:0055052 GO:0140359 |
| AF-A0A7J9YE84-F1-model_v4 | ATP-binding cassette domain-containing protein | 0.984 | 1 | 222 |
GO:0005524
GO:0016887 GO:0055052 |
| AF-A0A382Y1F8-F1-model_v4 | ABC transporter domain-containing protein | 0.9822 | 1 | 200 |
GO:0001407
GO:0005524 GO:0008643 GO:0015794 GO:0016887 GO:0055052 GO:0140359 |
| AF-A0A382ZAC4-F1-model_v4 | ABC transporter domain-containing protein | 0.9818 | 2 | 211 |
GO:0005524
GO:0005886 GO:0015408 GO:0016887 |
| AF-A0A366ZI61-F1-model_v4 | ABC transporter ATP-binding protein | 0.975 | 5 | 237 |
GO:0005524
GO:0016887 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar