F405028

General Info

Members Datasets Scaffolds Average Seq Length
319 262 232 359

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_100001780|Ga0075434_10000178012
Length 388
Sequence MPRGAAASGHARLPAAARQRPRTDGGPLMAAVTLEQVRKVYPGGVEAVKGVSLTIPNGSFTVLLGPSGCGKSTLLRMIAGLETVSAGTIRIAERRVNEIEPADRDIAMVFQNYALYPHMSVYDNMAYGLRNRGVPKIDIAARVAEAARLLAIEDFLARKPRALSGGQRQRVAMGRAIVREPQAFLFDEPLSNLDAKLRVQMRVEIRRLHNRLKATSIFVTHDQVEAMTLADMVVVMNAGRIEQTGGPTEVYRLPATRFVATFIGAPAMNLLPGRIAGPGIAEIKGGRIPFRAEAFAVALGQEVDVGVRPEDLVLGRAGAGNGLPFAPDFVEELGATRLIHGSIAEVPIVVAVATSSEAVVDGAGAVAVEPAAVHLFDRASGSSLRRGA

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
4 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
5 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
6 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
7 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
8 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
9 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
10 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
11 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
12 2643221558 Rhizobium sp. Root149 Isolate Unclassified
13 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
14 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
15 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
16 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
17 2643221719 Rhizobium sp. Root274 Isolate Unclassified
18 2643221734 Bosea sp. Root670 Isolate Unclassified
19 2643221736 Bosea sp. Root483D1 Isolate Unclassified
20 2738541293 Rhizobium sp. GV031 Isolate Unclassified
21 2738541337 Pelomonas sp. BT06 Isolate Unclassified
22 2773857925 Microvirga vignae BR3299 Isolate Unclassified
23 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
24 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
25 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
26 2818991467 Bosea vestrisii 3192 Isolate Unclassified
27 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
28 2831864461 Roseateles noduli HZ7 Isolate Nodule
29 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
30 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
31 2841760612 Bosea sp. Tri-49 Isolate Nodule
32 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
33 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
34 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
35 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
36 2844104063 Bosea sp. Tri-39 Isolate Nodule
37 2851182111 Bosea sp. Tri-44 Isolate Nodule
38 2851246043 Bosea sp. Tri-54 Isolate Nodule
39 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
40 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
41 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
42 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
43 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
44 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
45 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
46 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
47 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
48 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
49 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
50 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
51 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
52 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
53 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
54 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
55 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
56 2904699407
57 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
58 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
59 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
60 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
61 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
62 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
63 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
64 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
65 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
66 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
67 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
68 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
69 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
70 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
71 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
72 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
73 3003665799 Methylobacterium aquaticum BG2 Isolate Unclassified
74 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
75 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
76 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
77 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
78 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
79 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
80 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
81 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
82 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
83 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
84 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
85 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
86 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
87 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
88 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
89 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
90 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
91 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
92 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
93 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
94 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
95 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
96 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
97 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
98 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
99 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
100 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
101 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
102 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
103 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
104 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
105 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
106 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
107 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
108 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
109 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
110 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
111 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
112 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
113 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
114 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
115 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
116 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
117 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
118 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
119 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
120 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
121 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
122 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
123 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
124 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
125 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
126 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
127 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
128 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
129 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
131 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
133 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
135 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
138 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
153 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
154 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
155 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
159 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
160 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
161 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
162 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
163 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
164 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
165 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
166 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
167 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
168 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
171 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
172 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
173 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
174 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
175 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
176 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
177 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
178 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
179 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
180 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
181 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
182 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
183 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
184 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
185 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
186 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
187 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
188 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
189 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
190 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
191 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
192 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
193 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
194 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
195 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
196 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
201 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
202 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
203 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
204 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
205 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
206 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
207 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
208 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
209 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
210 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
211 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
217 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
218 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
219 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
220 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
221 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
222 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
223 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
224 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
225 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
227 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
228 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
229 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
230 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
231 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
232 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
233 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
234 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
235 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
236 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
237 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
238 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
239 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
240 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
241 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
242 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
243 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
244 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
245 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
246 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
247 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
248 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
249 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
250 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
251 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
252 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
253 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
254 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
255 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
256 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
257 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
258 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
259 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
260 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
261 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
262 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 72.96
Metatranscriptomes 0
Isolates 27.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.38
Nodule 17.24
Rhizoplane 2.19
Rhizosphere 44.2
Stem 0
Stem Tuber 0
Unclassified 15.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1003864 3300002773 Bacteria 4931
2 JGI25150J39212_1000064 3300002774 Bacteria 64002
3 JGI25151J46595_10000030 3300003187 Bacteria 202084
4 JGI25151J46595_10000242 3300003187 Bacteria 64028
5 JGI25153J46596_10007551 3300003215 Bacteria 5326
6 JGI25153J46596_10007816 3300003215 Bacteria 5195
7 Ga0055526_1002596 3300003771 Bacteria 12077
8 Ga0055526_1005337 3300003771 Bacteria 7424
9 Ga0055526_1007057 3300003771 Bacteria 5939
10 Ga0055524_1000069 3300003775 Bacteria 128956
11 Ga0055524_1018387 3300003775 Bacteria 2429
12 Ga0055531_10000007 3300003794 Bacteria 225289
13 Ga0055543_1002869 3300004625 Bacteria 5424
14 Ga0065165_1000016 3300005262 Bacteria 286248
15 Ga0065165_1000132 3300005262 Bacteria 128732
16 Ga0065165_1000942 3300005262 Bacteria 37104
17 Ga0070680_100004110 3300005336 Bacteria 10900
18 Ga0070680_100041529 3300005336 Bacteria 3729
19 Ga0070682_100038701 3300005337 Bacteria 2926
20 Ga0070692_10034109 3300005345 Bacteria 2568
21 Ga0070705_100000027 3300005440 Bacteria 77032
22 Ga0070700_100020573 3300005441 Bacteria 3824
23 Ga0070694_100001546 3300005444 Bacteria 13533
24 Ga0070694_100013684 3300005444 Bacteria 5070
25 Ga0070708_100009708 3300005445 Bacteria 7767
26 Ga0070681_10006430 3300005458 Bacteria 11436
27 Ga0070681_10025242 3300005458 Bacteria 5977
28 Ga0070707_100098854 3300005468 Bacteria 2827
29 Ga0070699_100003991 3300005518 Bacteria 13036
30 Ga0068853_100222271 3300005539 Bacteria 1725
31 Ga0070695_100001000 3300005545 Bacteria 15394
32 Ga0070695_100010258 3300005545 Bacteria 5590
33 Ga0070696_100000051 3300005546 Bacteria 54480
34 Ga0070704_100019794 3300005549 Bacteria 4330
35 Ga0068855_100173919 3300005563 Bacteria 2437
36 Ga0068857_100020408 3300005577 Bacteria 5826
37 Ga0068864_100044924 3300005618 Bacteria 3788
38 Ga0068861_100069828 3300005719 Bacteria 2719
39 Ga0068861_100469623 3300005719 Bacteria 1131
40 Ga0068870_10150690 3300005840 Bacteria 1370
41 Ga0068860_100001599 3300005843 Bacteria 24324
42 Ga0068862_100001717 3300005844 Bacteria 19834
43 Ga0081455_10000371 3300005937 Bacteria 59407
44 Ga0081455_10004673 3300005937 Bacteria 15244
45 Ga0081455_10026871 3300005937 Bacteria 5285
46 Ga0081540_1000604 3300005983 Bacteria 34243
47 Ga0081540_1008119 3300005983 Bacteria 7370
48 Ga0081540_1008142 3300005983 Bacteria 7355
49 Ga0081539_10002206 3300005985 Bacteria 28466
50 Ga0075365_10130992 3300006038 Bacteria 1736
51 Ga0075368_10033732 3300006042 Bacteria 1992
52 Ga0075363_100001691 3300006048 Bacteria 8557
53 Ga0075364_10001862 3300006051 Bacteria 11705
54 Ga0075364_10004957 3300006051 Bacteria 7714
55 Ga0075367_10008609 3300006178 Bacteria 5293
56 Ga0075367_10012644 3300006178 Bacteria 4512
57 Ga0075367_10055206 3300006178 Bacteria 2357
58 Ga0068871_100295394 3300006358 Bacteria 1421
59 Ga0075428_100035096 3300006844 Bacteria 5529
60 Ga0075430_100007057 3300006846 Bacteria 9471
61 Ga0075431_100000924 3300006847 Bacteria 25914
62 Ga0075431_100001379 3300006847 Bacteria 22276
63 Ga0075431_100039447 3300006847 Bacteria 4865
64 Ga0075431_100360911 3300006847 Bacteria 1459
65 Ga0075434_100001780 3300006871 Bacteria 18578
66 Ga0075429_100018697 3300006880 Bacteria 5999
67 Ga0099823_1000075 3300006944 Bacteria 48013
68 Ga0079104_1000033 3300006946 Bacteria 202636
69 Ga0075435_100004467 3300007076 Bacteria 9611
70 Ga0105240_10146608 3300009093 Bacteria 2816
71 Ga0111539_10023722 3300009094 Bacteria 7537
72 Ga0105246_10035123 3300011119 Bacteria 3348
73 Ga0171462_1013 3300013250 Bacteria 202864
74 Ga0213872_10071617 3300021361 Bacteria 1562
75 Ga0207425_1000139 3300025245 Bacteria 64086
76 Ga0209129_1000223 3300025258 Bacteria 64086
77 Ga0209673_1003641 3300025273 Bacteria 8909
78 Ga0209673_1004010 3300025273 Bacteria 8171
79 Ga0209130_1000327 3300025284 Bacteria 54775
80 Ga0209675_1000909 3300025291 Bacteria 18906
81 Ga0209025_1000063 3300025294 Bacteria 303962
82 Ga0209025_1000612 3300025294 Bacteria 64088
83 Ga0209025_1008484 3300025294 Bacteria 7390
84 Ga0209564_1000043 3300025295 Bacteria 388153
85 Ga0209564_1000052 3300025295 Bacteria 356578
86 Ga0209758_1000443 3300025297 Bacteria 69228
87 Ga0209758_1000495 3300025297 Bacteria 64088
88 Ga0209050_1004806 3300025298 Bacteria 8889
89 Ga0209256_1000172 3300025299 Bacteria 129025
90 Ga0209256_1000611 3300025299 Bacteria 49576
91 Ga0209256_1001845 3300025299 Bacteria 19655
92 Ga0207426_1004218 3300025302 Bacteria 7147
93 Ga0209051_1002935 3300025303 Bacteria 11678
94 Ga0209051_1005813 3300025303 Bacteria 7098
95 Ga0209257_1000021 3300025304 Bacteria 771986
96 Ga0209257_1002181 3300025304 Bacteria 20273
97 Ga0207653_10000404 3300025885 Bacteria 18851
98 Ga0207707_10011084 3300025912 Bacteria 7839
99 Ga0207695_10023567 3300025913 Bacteria 6949
100 Ga0207660_10001543 3300025917 Bacteria 15424
101 Ga0207660_10042802 3300025917 Bacteria 3180
102 Ga0207646_10018727 3300025922 Bacteria 6453
103 Ga0207669_10227036 3300025937 Bacteria 1375
104 Ga0207712_10006806 3300025961 Bacteria 7210
105 Ga0207640_10203511 3300025981 Bacteria 1502
106 Ga0207708_10052865 3300026075 Bacteria 3094
107 Ga0207676_10029944 3300026095 Bacteria 4080
108 Ga0207674_10123220 3300026116 Bacteria 2558
109 Ga0207675_100268019 3300026118 Bacteria 1657
110 Ga0209281_1000043 3300027111 Bacteria 341543
111 Ga0209389_1000249 3300027296 Bacteria 34712
112 Ga0209813_10000181 3300027866 Bacteria 20461
113 Ga0209813_10009485 3300027866 Bacteria 2491
114 Ga0207428_10045863 3300027907 Bacteria 3517
115 Ga0207428_10054245 3300027907 Bacteria 3193
116 Ga0268265_10009911 3300028380 Bacteria 6437
117 Ga0268264_10004860 3300028381 Bacteria 11386
118 Ga0307515_10077045 3300028794 Bacteria 4410
119 Ga0307515_10097070 3300028794 Bacteria 3606
120 Ga0307515_10168159 3300028794 Bacteria 2200
121 Ga0265327_10000012 3300031251 Bacteria 530403
122 Ga0307513_10008037 3300031456 Bacteria 13552
123 Ga0307509_10207221 3300031507 Bacteria 1790
124 Ga0265314_10001039 3300031711 Bacteria 32357
125 Ga0307516_10058809 3300031730 Bacteria 3740
126 Ga0307405_10003590 3300031731 Bacteria 7162
127 Ga0307410_10192030 3300031852 Bacteria 1553
128 Ga0307406_10154865 3300031901 Bacteria 1640
129 Ga0307412_10004798 3300031911 Bacteria 7543
130 Ga0307409_100283057 3300031995 Bacteria 1534
131 Ga0307416_100139104 3300032002 Bacteria 2203
132 Ga0307414_10039619 3300032004 Bacteria 3175
133 Ga0307415_100175823 3300032126 Bacteria 1674
134 Ga0315911_1000013 3300033442 Bacteria 239334
135 Ga0373939_0020504 3300035114 Bacteria 1797
136 Ga0373962_0005748 3300035242 Bacteria 2995
137 Ga0373931_0000738 3300035691 Bacteria 13611
138 Ga0373931_0003302 3300035691 Bacteria 7222
139 Ga0436361_1214496 3300039447 Bacteria 9572
140 Ga0439434_0034449 3300042435 Bacteria 1546
141 Ga0466972_0087492 3300044658 Bacteria 1480
142 Ga0451576_0541167 3300045051 Bacteria 1223
143 Ga0495627_028990 3300046453 Bacteria 1764
144 Ga0495590_0026101 3300046457 Bacteria 2052
145 Ga0495605_0002954 3300046474 Bacteria 10294
146 Ga0495607_0086472 3300046501 Bacteria 1709
147 Ga0495583_0016172 3300046506 Bacteria 4021
148 Ga0495610_0007227 3300046512 Bacteria 7449
149 Ga0495620_0025262 3300046515 Bacteria 2813
150 Ga0495620_0048343 3300046515 Bacteria 1826
151 Ga0495631_0005687 3300046518 Bacteria 6505
152 Ga0495632_0003099 3300046519 Bacteria 12045
153 Ga0495643_0080196 3300046522 Bacteria 1700
154 Ga0495668_0008208 3300046616 Bacteria 6556
155 Ga0495611_0013344 3300046648 Bacteria 3497
156 Ga0495670_0061617 3300046691 Bacteria 1886
157 Ga0495660_0008560 3300046810 Bacteria 5990
158 Ga0495672_0006265 3300047320 Bacteria 9267
159 Ga0495687_021545 3300047443 Bacteria 3115
160 Ga0495686_0031787 3300047472 Bacteria 3419
161 Ga0496102_0036874 3300048905 Bacteria 4407
162 Ga0496103_0020482 3300048906 Bacteria 3973
163 Ga0496106_0000132 3300048909 Bacteria 56128
164 Ga0496107_0002892 3300048910 Bacteria 11349
165 Ga0496110_0285478 3300048913 Bacteria 1503
166 Ga0496116_0013325 3300048919 Bacteria 6638
167 Ga0496116_0031866 3300048919 Bacteria 3765
168 Ga0496117_0020727 3300048920 Bacteria 5349
169 Ga0496118_0043406 3300048921 Bacteria 3535
170 Ga0496118_0047040 3300048921 Bacteria 3349
171 Ga0496119_0055606 3300048922 Bacteria 2403
172 Ga0496121_0001089 3300048924 Bacteria 48004
173 Ga0496121_0034185 3300048924 Bacteria 4580
174 Ga0496122_0081834 3300048925 Bacteria 2245
175 Ga0496123_0028170 3300048926 Bacteria 4165
176 Ga0496123_0043809 3300048926 Bacteria 3069
177 Ga0496123_0068621 3300048926 Bacteria 2231
178 Ga0496124_0008518 3300048927 Bacteria 10706
179 Ga0496124_0009266 3300048927 Bacteria 10155
180 Ga0496124_0013699 3300048927 Bacteria 7897
181 Ga0495678_033793 3300049459 Bacteria 2109
182 Ga0501034_0219966 3300049571 Bacteria 1852
183 Ga0501039_0150735 3300049575 Bacteria 1827
184 Ga0501040_0048229 3300049576 Bacteria 2911
185 Ga0501046_0039982 3300049580 Bacteria 3751
186 Ga0501048_0105126 3300049582 Bacteria 1993
187 Ga0501069_0207699 3300049585 Bacteria 1136
188 Ga0501070_0092915 3300049586 Bacteria 2497
189 Ga0501072_0028231 3300049588 Bacteria 4381
190 Ga0501074_0079744 3300049590 Bacteria 2349
191 Ga0501075_0058397 3300049591 Bacteria 2906
192 Ga0501077_0008325 3300049593 Bacteria 6416
193 Ga0501077_0094409 3300049593 Bacteria 1896
194 Ga0501238_001035 3300049671 Bacteria 3168
195 Ga0501079_0060146 3300049741 Bacteria 2931
196 Ga0501079_0078144 3300049741 Bacteria 2560
197 Ga0501080_0080154 3300049742 Bacteria 3035
198 Ga0501080_0269058 3300049742 Bacteria 1551
199 Ga0501035_0014562 3300049822 Bacteria 7260
200 Ga0501045_0083747 3300049824 Bacteria 2353
201 Ga0501045_0143761 3300049824 Bacteria 1774
202 nmdc:mga03n38_2668_c1 3300050490 Bacteria 5571
203 nmdc:mga00v17_11981_c1 3300050491 Bacteria 4773
204 nmdc:mga00v17_26_c4 3300050491 Bacteria 47279
205 nmdc:mga06z11_32949_c1 3300050494 Bacteria 2531
206 nmdc:mga06z11_36713_c1 3300050494 Bacteria 2421
207 nmdc:mga04h51_578_c1 3300050495 Bacteria 8745
208 nmdc:mga04h51_957_c1 3300050495 Bacteria 6665
209 nmdc:mga09592_233350_c1 3300050508 Bacteria 1594
210 nmdc:mga09592_89143_c1 3300050508 Bacteria 2635
211 nmdc:mga0qj67_43501_c1 3300050509 Bacteria 3537
212 nmdc:mga0qj67_74131_c1 3300050509 Bacteria 2720
213 nmdc:mga06r32_84243_c1 3300050510 Bacteria 3098
214 nmdc:mga06r32_89126_c1 3300050510 Bacteria 3012
215 nmdc:mga08y16_174822_c1 3300050511 Bacteria 2230
216 nmdc:mga0n895_18112_c1 3300050512 Bacteria 6512
217 nmdc:mga0rr50_3777_c1 3300050513 Bacteria 8785
218 Ga0500557_001701 3300053105 Bacteria 3733
219 Ga0500562_015718 3300053108 Bacteria 1943
220 Ga0500618_000096 3300053125 Bacteria 72003
221 Ga0500559_0008032 3300053136 Bacteria 4647
222 Ga0500568_0001000 3300053139 Bacteria 19361
223 Ga0500603_000275 3300053150 Bacteria 13576
224 Ga0500616_0045532 3300053153 Bacteria 2337
225 Ga0500622_0018132 3300053156 Bacteria 3743
226 Ga0500637_0000247 3300053178 Bacteria 20090
227 Ga0500599_000577 3300053736 Bacteria 3879
228 Ga0501084_0085050 3300054114 Bacteria 2656
229 Ga0501084_0245891 3300054114 Bacteria 1510
230 Ga0501082_0041034 3300060353 Bacteria 3990
231 Ga0501082_0171092 3300060353 Bacteria 1889
232 Ga0530510_0047242 3300061734 Bacteria 3110

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050509 nmdc:mga0qj67_43501_c1 nmdc:mga0qj67_43501_c1_2565_3509 301
2 3300011119 Ga0105246_10035123 Ga0105246_100351234 303
3 3300003187 JGI25151J46595_10000030 JGI25151J46595_1000003097 315
4 3300025294 Ga0209025_1000063 Ga0209025_1000063129 315
5 3300053136 Ga0500559_0008032 Ga0500559_0008032_1019_2101 325
6 3300044658 Ga0466972_0087492 Ga0466972_0087492_429_1451 326
7 3300005336 Ga0070680_100041529 Ga0070680_1000415294 327
8 3300005337 Ga0070682_100038701 Ga0070682_1000387013 327
9 3300005458 Ga0070681_10025242 Ga0070681_100252426 327
10 3300005539 Ga0068853_100222271 Ga0068853_1002222712 327
11 3300005563 Ga0068855_100173919 Ga0068855_1001739192 327
12 3300006358 Ga0068871_100295394 Ga0068871_1002953942 327
13 3300009093 Ga0105240_10146608 Ga0105240_101466081 327
14 3300025912 Ga0207707_10011084 Ga0207707_100110849 327
15 3300025913 Ga0207695_10023567 Ga0207695_100235677 327
16 3300025917 Ga0207660_10042802 Ga0207660_100428023 327
17 3300025981 Ga0207640_10203511 Ga0207640_102035112 327
18 3300031711 Ga0265314_10001039 Ga0265314_1000103918 327
19 iso_pu_bacteria 2507262055 2507505131 328
20 iso_pu_bacteria 2508501009 2508539066 328
21 iso_pu_bacteria 2513237137 2513860471 328
22 iso_pu_bacteria 2515154112 2515625602 328
23 iso_pu_bacteria 2517572143 2517888727 328
24 iso_pu_bacteria 2524023205 2524435985 328
25 iso_pu_bacteria 2524023228 2524538822 328
26 iso_pu_bacteria 2791355197 2793067546 328
27 iso_pu_bacteria 2874590934 2874597130 328
28 iso_pu_bacteria 2874645413 2874646936 328
29 iso_pu_bacteria 2876771140 2876777594 328
30 iso_pu_bacteria 2876818435 2876825676 328
31 iso_pu_bacteria 2879074833 2879076155 328
32 iso_pu_bacteria 2879127579 2879130960 328
33 iso_pu_bacteria 2879142872 2879148805 328
34 iso_pu_bacteria 2885374607 2885376926 328
35 iso_pu_bacteria 2885383462 2885391010 328
36 iso_pu_bacteria 2885409591 2885410500 328
37 iso_pu_bacteria 2903748898 2903756375 328
38 iso_pu_bacteria 2904699407 2904708850 328
39 iso_pu_bacteria 2906626472 2906633393 328
40 iso_pu_bacteria 2906635258 2906640091 328
41 iso_pu_bacteria 2906660503 2906667485 328
42 iso_pu_bacteria 2908739725 2908747320 328
43 iso_pu_bacteria 2935648319 2935653660 328
44 iso_pu_bacteria 2935656913 2935662409 328
45 iso_pu_bacteria 2935975950 2935977642 328
46 iso_pu_bacteria 2935984226 2935985124 328
47 iso_pu_bacteria 2936011229 2936016711 328
48 iso_pu_bacteria 2936019824 2936025344 328
49 iso_pu_bacteria 2936028420 2936034186 328
50 iso_pu_bacteria 2936046547 2936052243 328
51 iso_pu_bacteria 2936055302 2936056296 328
52 iso_pu_bacteria 3005474847 3005474958 328
53 iso_pu_bacteria 8006933436 8006936374 328
54 iso_pu_bacteria 8006973647 8006976343 328
55 iso_pu_bacteria 8016583857 8016586484 328
56 iso_pu_bacteria 8016630954 8016635651 328
57 iso_pu_bacteria 8019619141 8019622863 328
58 iso_pu_bacteria 8019629233 8019630250 328
59 iso_pu_bacteria 8019638758 8019640360 328
60 iso_pu_bacteria 8019659431 8019667080 328
61 iso_pu_bacteria 8019668869 8019676869 328
62 iso_pu_bacteria 8019678201 8019679120 328
63 iso_pu_bacteria 8056681323 8056687496 328
64 3300049822 Ga0501035_0014562 Ga0501035_0014562_2409_3461 329
65 3300013250 Ga0171462_1013 Ga0171462_1013128 331
66 3300003215 JGI25153J46596_10007816 JGI25153J46596_100078164 332
67 3300005937 Ga0081455_10004673 Ga0081455_100046732 332
68 3300005937 Ga0081455_10026871 Ga0081455_100268715 332
69 3300005983 Ga0081540_1008119 Ga0081540_10081191 332
70 3300005983 Ga0081540_1008142 Ga0081540_10081425 332
71 3300005985 Ga0081539_10002206 Ga0081539_1000220629 332
72 3300025297 Ga0209758_1000443 Ga0209758_100044358 332
73 3300031995 Ga0307409_100283057 Ga0307409_1002830572 332
74 3300033442 Ga0315911_1000013 Ga0315911_100001386 332
75 3300053153 Ga0500616_0045532 Ga0500616_0045532_658_1740 332
76 3300053156 Ga0500622_0018132 Ga0500622_0018132_1535_2617 332
77 3300053736 Ga0500599_000577 Ga0500599_000577_358_1440 332
78 3300028794 Ga0307515_10168159 Ga0307515_101681592 333
79 3300005468 Ga0070707_100098854 Ga0070707_1000988543 334
80 3300025922 Ga0207646_10018727 Ga0207646_100187275 334
81 3300031507 Ga0307509_10207221 Ga0307509_102072211 334
82 3300053150 Ga0500603_000275 Ga0500603_000275_4382_5476 334
83 3300053178 Ga0500637_0000247 Ga0500637_0000247_11578_12672 334
84 3300003771 Ga0055526_1005337 Ga0055526_10053377 335
85 3300003771 Ga0055526_1007057 Ga0055526_10070574 335
86 3300003775 Ga0055524_1000069 Ga0055524_100006949 335
87 3300025291 Ga0209675_1000909 Ga0209675_100090920 335
88 3300025295 Ga0209564_1000052 Ga0209564_100005275 335
89 3300025299 Ga0209256_1000172 Ga0209256_100017278 335
90 iso_pu_bacteria 3003665799 3003667299 337
91 iso_pu_bacteria 2643221639 2644222771 339
92 iso_pu_bacteria 2643221646 2644260691 339
93 iso_pu_bacteria 2738541337 2739058932 339
94 3300005262 Ga0065165_1000132 Ga0065165_100013290 340
95 3300025284 Ga0209130_1000327 Ga0209130_100032715 340
96 3300025294 Ga0209025_1008484 Ga0209025_10084845 340
97 3300025302 Ga0207426_1004218 Ga0207426_10042182 340
98 3300049585 Ga0501069_0207699 Ga0501069_0207699_60_1124 340
99 3300049742 Ga0501080_0080154 Ga0501080_0080154_1789_2853 340
100 3300060353 Ga0501082_0171092 Ga0501082_0171092_623_1687 340
101 iso_pu_bacteria 2508501114 2509076998 340
102 iso_pu_bacteria 2775506901 2776262637 340
103 iso_pu_bacteria 2835312727 2835313103 340
104 iso_pu_bacteria 2884298095 2884298700 340
105 iso_pu_bacteria 2894232714 2894233003 340
106 iso_pu_bacteria 2643221734 2644737543 341
107 iso_pu_bacteria 2643221736 2644743483 341
108 iso_pu_bacteria 2773857925 2774868427 341
109 iso_pu_bacteria 2818991467 2819720500 341
110 iso_pu_bacteria 2841760612 2841764612 341
111 iso_pu_bacteria 2841911363 2841913848 341
112 iso_pu_bacteria 2841917233 2841919543 341
113 iso_pu_bacteria 2844104063 2844107940 341
114 iso_pu_bacteria 2851182111 2851187872 341
115 iso_pu_bacteria 2851246043 2851250046 341
116 iso_pu_bacteria 2882456835 2882459223 341
117 iso_pu_bacteria 2917699015 2917702895 341
118 3300031901 Ga0307406_10154865 Ga0307406_101548652 342
119 3300003794 Ga0055531_10000007 Ga0055531_10000007123 343
120 3300006038 Ga0075365_10130992 Ga0075365_101309922 343
121 3300006042 Ga0075368_10033732 Ga0075368_100337322 343
122 3300006178 Ga0075367_10055206 Ga0075367_100552062 343
123 3300021361 Ga0213872_10071617 Ga0213872_100716172 343
124 3300025298 Ga0209050_1004806 Ga0209050_10048065 343
125 3300025303 Ga0209051_1005813 Ga0209051_10058135 343
126 3300025304 Ga0209257_1000021 Ga0209257_1000021105 343
127 3300027866 Ga0209813_10000181 Ga0209813_100001812 343
128 3300028794 Ga0307515_10077045 Ga0307515_100770452 343
129 3300031251 Ga0265327_10000012 Ga0265327_1000001261 343
130 3300039447 Ga0436361_1214496 Ga0436361_1214496_5793_6893 343
131 3300049593 Ga0501077_0094409 Ga0501077_0094409_450_1529 343
132 3300049741 Ga0501079_0078144 Ga0501079_0078144_1251_2330 343
133 3300050495 nmdc:mga04h51_578_c1 nmdc:mga04h51_578_c1_7266_8357 343
134 3300054114 Ga0501084_0245891 Ga0501084_0245891_170_1249 343
135 3300061734 Ga0530510_0047242 Ga0530510_0047242_1822_2901 343
136 3300005336 Ga0070680_100004110 Ga0070680_1000041104 344
137 3300005345 Ga0070692_10034109 Ga0070692_100341093 344
138 3300005440 Ga0070705_100000027 Ga0070705_10000002734 344
139 3300005441 Ga0070700_100020573 Ga0070700_1000205732 344
140 3300005444 Ga0070694_100001546 Ga0070694_1000015466 344
141 3300005445 Ga0070708_100009708 Ga0070708_1000097085 344
142 3300005458 Ga0070681_10006430 Ga0070681_1000643010 344
143 3300005518 Ga0070699_100003991 Ga0070699_10000399110 344
144 3300005545 Ga0070695_100001000 Ga0070695_1000010008 344
145 3300005546 Ga0070696_100000051 Ga0070696_10000005147 344
146 3300005549 Ga0070704_100019794 Ga0070704_1000197942 344
147 3300005577 Ga0068857_100020408 Ga0068857_1000204082 344
148 3300005618 Ga0068864_100044924 Ga0068864_1000449241 344
149 3300005719 Ga0068861_100069828 Ga0068861_1000698283 344
150 3300005840 Ga0068870_10150690 Ga0068870_101506901 344
151 3300005843 Ga0068860_100001599 Ga0068860_10000159920 344
152 3300005844 Ga0068862_100001717 Ga0068862_1000017178 344
153 3300006847 Ga0075431_100000924 Ga0075431_10000092418 344
154 3300006880 Ga0075429_100018697 Ga0075429_1000186972 344
155 3300025885 Ga0207653_10000404 Ga0207653_1000040418 344
156 3300025917 Ga0207660_10001543 Ga0207660_100015434 344
157 3300025937 Ga0207669_10227036 Ga0207669_102270361 344
158 3300025961 Ga0207712_10006806 Ga0207712_100068066 344
159 3300026075 Ga0207708_10052865 Ga0207708_100528653 344
160 3300026095 Ga0207676_10029944 Ga0207676_100299441 344
161 3300026116 Ga0207674_10123220 Ga0207674_101232202 344
162 3300026118 Ga0207675_100268019 Ga0207675_1002680192 344
163 3300028380 Ga0268265_10009911 Ga0268265_100099114 344
164 3300028381 Ga0268264_10004860 Ga0268264_100048603 344
165 3300031852 Ga0307410_10192030 Ga0307410_101920302 344
166 3300032126 Ga0307415_100175823 Ga0307415_1001758232 344
167 3300035114 Ga0373939_0020504 Ga0373939_0020504_688_1764 344
168 3300035242 Ga0373962_0005748 Ga0373962_0005748_165_1325 344
169 3300035691 Ga0373931_0003302 Ga0373931_0003302_3726_4886 344
170 3300048905 Ga0496102_0036874 Ga0496102_0036874_2691_3764 344
171 3300048906 Ga0496103_0020482 Ga0496103_0020482_2230_3303 344
172 3300048909 Ga0496106_0000132 Ga0496106_0000132_48490_49563 344
173 3300048910 Ga0496107_0002892 Ga0496107_0002892_2679_3752 344
174 3300049575 Ga0501039_0150735 Ga0501039_0150735_628_1701 344
175 3300049582 Ga0501048_0105126 Ga0501048_0105126_107_1180 344
176 3300049586 Ga0501070_0092915 Ga0501070_0092915_871_1941 344
177 3300049588 Ga0501072_0028231 Ga0501072_0028231_1698_2771 344
178 3300049590 Ga0501074_0079744 Ga0501074_0079744_916_1989 344
179 3300049591 Ga0501075_0058397 Ga0501075_0058397_1064_2137 344
180 3300049593 Ga0501077_0008325 Ga0501077_0008325_3739_4812 344
181 3300049741 Ga0501079_0060146 Ga0501079_0060146_620_1693 344
182 3300049742 Ga0501080_0269058 Ga0501080_0269058_437_1510 344
183 3300049824 Ga0501045_0143761 Ga0501045_0143761_223_1296 344
184 3300060353 Ga0501082_0041034 Ga0501082_0041034_1202_2275 344
185 3300003771 Ga0055526_1002596 Ga0055526_100259611 345
186 3300003775 Ga0055524_1018387 Ga0055524_10183872 345
187 3300025295 Ga0209564_1000043 Ga0209564_1000043172 345
188 3300025299 Ga0209256_1000611 Ga0209256_100061129 345
189 3300032004 Ga0307414_10039619 Ga0307414_100396192 345
190 3300045051 Ga0451576_0541167 Ga0451576_0541167_11_1072 345
191 3300048926 Ga0496123_0028170 Ga0496123_0028170_3019_4098 345
192 3300049671 Ga0501238_001035 Ga0501238_001035_217_1296 345
193 iso_pu_bacteria 2831864461 2831869234 345
194 3300005937 Ga0081455_10000371 Ga0081455_1000037154 346
195 3300006871 Ga0075434_100001780 Ga0075434_10000178012 346
196 3300007076 Ga0075435_100004467 Ga0075435_10000446711 346
197 3300009094 Ga0111539_10023722 Ga0111539_100237223 346
198 3300027907 Ga0207428_10054245 Ga0207428_100542453 346
199 3300031456 Ga0307513_10008037 Ga0307513_100080375 346
200 3300031730 Ga0307516_10058809 Ga0307516_100588092 346
201 3300032002 Ga0307416_100139104 Ga0307416_1001391042 346
202 3300042435 Ga0439434_0034449 Ga0439434_0034449_219_1280 346
203 3300049571 Ga0501034_0219966 Ga0501034_0219966_342_1427 346
204 3300050511 nmdc:mga08y16_174822_c1 nmdc:mga08y16_174822_c1_457_1539 346
205 3300050512 nmdc:mga0n895_18112_c1 nmdc:mga0n895_18112_c1_905_1987 346
206 3300050513 nmdc:mga0rr50_3777_c1 nmdc:mga0rr50_3777_c1_884_1966 346
207 3300005444 Ga0070694_100013684 Ga0070694_1000136843 347
208 3300005545 Ga0070695_100010258 Ga0070695_1000102583 347
209 3300005719 Ga0068861_100469623 Ga0068861_1004696231 347
210 3300005983 Ga0081540_1000604 Ga0081540_10006044 347
211 3300028794 Ga0307515_10097070 Ga0307515_100970704 347
212 3300035691 Ga0373931_0000738 Ga0373931_0000738_5547_6626 347
213 3300049824 Ga0501045_0083747 Ga0501045_0083747_987_2072 348
214 3300004625 Ga0055543_1002869 Ga0055543_10028695 349
215 3300005262 Ga0065165_1000016 Ga0065165_10000165 349
216 3300006844 Ga0075428_100035096 Ga0075428_1000350967 349
217 3300006846 Ga0075430_100007057 Ga0075430_10000705710 349
218 3300006847 Ga0075431_100001379 Ga0075431_10000137914 349
219 3300006847 Ga0075431_100039447 Ga0075431_1000394475 349
220 3300006847 Ga0075431_100360911 Ga0075431_1003609112 349
221 3300006944 Ga0099823_1000075 Ga0099823_100007516 349
222 3300025273 Ga0209673_1004010 Ga0209673_10040103 349
223 3300025299 Ga0209256_1001845 Ga0209256_10018455 349
224 3300025303 Ga0209051_1002935 Ga0209051_10029356 349
225 3300025304 Ga0209257_1002181 Ga0209257_100218121 349
226 3300027296 Ga0209389_1000249 Ga0209389_100024916 349
227 3300027907 Ga0207428_10045863 Ga0207428_100458633 349
228 3300050508 nmdc:mga09592_233350_c1 nmdc:mga09592_233350_c1_266_1351 349
229 3300050508 nmdc:mga09592_89143_c1 nmdc:mga09592_89143_c1_129_1214 349
230 3300050509 nmdc:mga0qj67_74131_c1 nmdc:mga0qj67_74131_c1_214_1299 349
231 3300050510 nmdc:mga06r32_84243_c1 nmdc:mga06r32_84243_c1_1712_2797 349
232 3300050510 nmdc:mga06r32_89126_c1 nmdc:mga06r32_89126_c1_1144_2229 349
233 3300005262 Ga0065165_1000942 Ga0065165_10009425 350
234 3300006048 Ga0075363_100001691 Ga0075363_1000016914 350
235 3300006051 Ga0075364_10001862 Ga0075364_100018628 350
236 3300006178 Ga0075367_10008609 Ga0075367_100086092 350
237 3300006178 Ga0075367_10012644 Ga0075367_100126442 350
238 3300027866 Ga0209813_10009485 Ga0209813_100094852 350
239 3300050490 nmdc:mga03n38_2668_c1 nmdc:mga03n38_2668_c1_3470_4558 350
240 3300050491 nmdc:mga00v17_11981_c1 nmdc:mga00v17_11981_c1_3193_4281 350
241 3300050494 nmdc:mga06z11_32949_c1 nmdc:mga06z11_32949_c1_497_1585 350
242 3300050494 nmdc:mga06z11_36713_c1 nmdc:mga06z11_36713_c1_37_1125 350
243 3300050495 nmdc:mga04h51_957_c1 nmdc:mga04h51_957_c1_2985_4073 350
244 iso_pu_bacteria 2891048133 2891048232 353
245 iso_pu_bacteria 8005658619 8005661614 354
246 3300049576 Ga0501040_0048229 Ga0501040_0048229_436_1554 357
247 3300049580 Ga0501046_0039982 Ga0501046_0039982_2532_3650 357
248 3300054114 Ga0501084_0085050 Ga0501084_0085050_692_1810 357
249 iso_pu_bacteria 2643221558 2643812624 357
250 iso_pu_bacteria 2558860983 2561469089 359
251 iso_pu_bacteria 2821123053 2821123339 360
252 iso_pu_bacteria 2838736955 2838739638 360
253 iso_pu_bacteria 2841840854 2841844238 360
254 iso_pu_bacteria 2842140634 2842143959 360
255 iso_pu_bacteria 2857531043 2857533710 360
256 iso_pu_bacteria 2643221643 2644237548 362
257 iso_pu_bacteria 2643221653 2644297967 362
258 iso_pu_bacteria 2643221719 2644656220 362
259 iso_pu_bacteria 2818991272 2819244436 362
260 iso_pu_bacteria 2989776772 2989777084 362
261 3300006051 Ga0075364_10004957 Ga0075364_100049578 363
262 3300048924 Ga0496121_0001089 Ga0496121_0001089_6701_7804 363
263 3300050491 nmdc:mga00v17_26_c4 nmdc:mga00v17_26_c4_24073_25176 363
264 iso_pu_bacteria 2585427594 2585843837 363
265 iso_pu_bacteria 2599185236 2599718903 363
266 iso_pu_bacteria 2738541293 2738800913 363
267 iso_pu_bacteria 2899803654 2899805679 363
268 iso_pu_bacteria 2989771324 2989772464 363
269 iso_pu_bacteria 8054460903 8054461078 363
270 3300006946 Ga0079104_1000033 Ga0079104_100003361 364
271 3300027111 Ga0209281_1000043 Ga0209281_1000043199 364
272 3300048924 Ga0496121_0034185 Ga0496121_0034185_1377_2474 364
273 3300053125 Ga0500618_000096 Ga0500618_000096_67405_68502 364
274 3300046453 Ga0495627_028990 Ga0495627_028990_389_1492 366
275 3300046457 Ga0495590_0026101 Ga0495590_0026101_450_1553 366
276 3300046474 Ga0495605_0002954 Ga0495605_0002954_1636_2739 366
277 3300046501 Ga0495607_0086472 Ga0495607_0086472_547_1650 366
278 3300046506 Ga0495583_0016172 Ga0495583_0016172_1842_2945 366
279 3300046512 Ga0495610_0007227 Ga0495610_0007227_5239_6342 366
280 3300046515 Ga0495620_0025262 Ga0495620_0025262_393_1496 366
281 3300046515 Ga0495620_0048343 Ga0495620_0048343_146_1249 366
282 3300046518 Ga0495631_0005687 Ga0495631_0005687_3767_4870 366
283 3300046519 Ga0495632_0003099 Ga0495632_0003099_298_1401 366
284 3300046522 Ga0495643_0080196 Ga0495643_0080196_293_1396 366
285 3300046616 Ga0495668_0008208 Ga0495668_0008208_3279_4382 366
286 3300046648 Ga0495611_0013344 Ga0495611_0013344_1328_2431 366
287 3300046691 Ga0495670_0061617 Ga0495670_0061617_44_1147 366
288 3300046810 Ga0495660_0008560 Ga0495660_0008560_1370_2473 366
289 3300047320 Ga0495672_0006265 Ga0495672_0006265_839_1942 366
290 3300047443 Ga0495687_021545 Ga0495687_021545_394_1497 366
291 3300047472 Ga0495686_0031787 Ga0495686_0031787_1259_2362 366
292 3300049459 Ga0495678_033793 Ga0495678_033793_690_1793 366
293 3300053105 Ga0500557_001701 Ga0500557_001701_895_1998 366
294 3300053108 Ga0500562_015718 Ga0500562_015718_229_1332 366
295 3300053139 Ga0500568_0001000 Ga0500568_0001000_7496_8599 366
296 3300002773 JGI25152J39213_1003864 JGI25152J39213_10038643 367
297 3300002774 JGI25150J39212_1000064 JGI25150J39212_10000643 367
298 3300003187 JGI25151J46595_10000242 JGI25151J46595_1000024270 367
299 3300003215 JGI25153J46596_10007551 JGI25153J46596_100075513 367
300 3300025245 Ga0207425_1000139 Ga0207425_100013971 367
301 3300025258 Ga0209129_1000223 Ga0209129_10002234 367
302 3300025273 Ga0209673_1003641 Ga0209673_10036413 367
303 3300025294 Ga0209025_1000612 Ga0209025_10006124 367
304 3300025297 Ga0209758_1000495 Ga0209758_10004954 367
305 3300031731 Ga0307405_10003590 Ga0307405_100035903 367
306 3300031911 Ga0307412_10004798 Ga0307412_100047983 367
307 3300048913 Ga0496110_0285478 Ga0496110_0285478_279_1382 367
308 3300048919 Ga0496116_0013325 Ga0496116_0013325_4698_5801 367
309 3300048919 Ga0496116_0031866 Ga0496116_0031866_1867_2970 367
310 3300048920 Ga0496117_0020727 Ga0496117_0020727_2079_3182 367
311 3300048921 Ga0496118_0043406 Ga0496118_0043406_903_2006 367
312 3300048921 Ga0496118_0047040 Ga0496118_0047040_918_2024 367
313 3300048922 Ga0496119_0055606 Ga0496119_0055606_330_1433 367
314 3300048925 Ga0496122_0081834 Ga0496122_0081834_768_1871 367
315 3300048926 Ga0496123_0043809 Ga0496123_0043809_1136_2239 367
316 3300048926 Ga0496123_0068621 Ga0496123_0068621_837_1940 367
317 3300048927 Ga0496124_0008518 Ga0496124_0008518_5093_6196 367
318 3300048927 Ga0496124_0009266 Ga0496124_0009266_8420_9526 367
319 3300048927 Ga0496124_0013699 Ga0496124_0013699_78_1181 367

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

48

191

0.98

PF17912

OB_MalK

MalK OB fold domain

264

312

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
2onk-assembly1.cif.gz_B abc transporter modbc in complex with its binding protein moda 0.9454 4 234
7x0q-assembly1.cif.gz_A crystal structure of atpase clo1313_2554 from clostridium thermocellum 0.945 4 350
4tqu-assembly1.cif.gz_T crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate 0.9436 2 350
4mki-assembly1.cif.gz_B cobalt transporter atp-binding subunit 0.9413 4 225
8ja7-assembly1.cif.gz_D cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.9392 1 349
ID Description Score Start End Superfamily
2awoD01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9744 3 217 3.40.50.300
1oxuA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9692 1 236 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9661 1 218 3.40.50.300
af_Q58762_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9632 4 236 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9618 1 218 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A382Y1F8-F1-model_v4 ABC transporter domain-containing protein 0.9871 1 200 GO:0001407
GO:0005524
GO:0008643
GO:0015794
GO:0016887
GO:0055052
GO:0140359
AF-A0A7J9YE84-F1-model_v4 ATP-binding cassette domain-containing protein 0.984 1 222 GO:0005524
GO:0016887
GO:0055052
AF-A0A382Y1F8-F1-model_v4 ABC transporter domain-containing protein 0.9822 1 200 GO:0001407
GO:0005524
GO:0008643
GO:0015794
GO:0016887
GO:0055052
GO:0140359
AF-A0A382ZAC4-F1-model_v4 ABC transporter domain-containing protein 0.9818 2 211 GO:0005524
GO:0005886
GO:0015408
GO:0016887
AF-A0A366ZI61-F1-model_v4 ABC transporter ATP-binding protein 0.975 5 237 GO:0005524
GO:0016887

Feature Viewer

pLDDT pTM Quality
90.9 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map