F404953

General Info

Members Datasets Scaffolds Average Seq Length
319 176 638 132

Family's Representative Sequence

Representative Sequence 3300005356|Ga0070674_100534474|Ga0070674_1005344741
Length 123
Sequence MTPFNRPGRQRVDNQVIYRGRGTIAGALFDLGIYPAAVPAADGRVWGELYEMTQPAAVLHVLDEIEGFRPSEPENSLYTRLEVPVTLEEGGRVVSAWAYFYNAPLGRAERIESGDYLEHLKAR

Samples

Sample ID Description Type Environment
1 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
58 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
59 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
118 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
119 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
120 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
121 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
122 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
123 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
124 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
128 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
129 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
130 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
131 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
132 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
133 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
134 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
135 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
136 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
137 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
139 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
140 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
141 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
142 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
143 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
144 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
145 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
146 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
147 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
148 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
149 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
150 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
151 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
152 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
153 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
156 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
157 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
158 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
159 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
160 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
161 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
162 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
163 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
164 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
165 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
166 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
167 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
168 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
169 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
170 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
171 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
172 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
173 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
174 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
175 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
176 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.43
Metatranscriptomes 1.57
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.63
Rhizosphere 99.06
Stem 0
Stem Tuber 0
Unclassified 39.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070674_100534474 3300005356 Unclassified 981
2 JGI24751J29686_10009006 3300002459 Bacteria 2048
3 Ga0058859_11299410 3300004798 Unclassified 522
4 Ga0058863_11967846 3300004799 Archaea 1853
5 Ga0058861_10068812 3300004800 Archaea 2323
6 Ga0058862_10093738 3300004803 Unclassified 2025
7 Ga0065712_10274088 3300005290 Unclassified 909
8 Ga0065712_10280029 3300005290 Bacteria 898
9 Ga0065715_10096053 3300005293 Unclassified 3951
10 Ga0065715_10113320 3300005293 Unclassified 2495
11 Ga0065715_10553899 3300005293 Unclassified 734
12 Ga0065715_11035209 3300005293 Unclassified 536
13 Ga0070676_10029075 3300005328 Bacteria 3142
14 Ga0070690_100253146 3300005330 Bacteria 1246
15 Ga0070670_100006032 3300005331 Bacteria 10247
16 Ga0070670_100012253 3300005331 Bacteria 7336
17 Ga0070666_10804754 3300005335 Unclassified 692
18 Ga0070680_100852111 3300005336 Bacteria 786
19 Ga0070682_100101384 3300005337 Archaea 1901
20 Ga0068868_101582849 3300005338 Unclassified 615
21 Ga0070660_100131120 3300005339 Archaea 2006
22 Ga0070691_10006601 3300005341 Bacteria 5310
23 Ga0070691_10259988 3300005341 Unclassified 934
24 Ga0070687_100044837 3300005343 Unclassified 2255
25 Ga0070687_101068504 3300005343 Unclassified 589
26 Ga0070661_100397243 3300005344 Unclassified 1089
27 Ga0070668_100011989 3300005347 Bacteria 6457
28 Ga0070668_100182515 3300005347 Unclassified 1715
29 Ga0070669_100190802 3300005353 Bacteria 1607
30 Ga0070675_100000352 3300005354 Bacteria 31035
31 Ga0070675_100028923 3300005354 Bacteria 4465
32 Ga0070675_100186550 3300005354 Bacteria 1795
33 Ga0070675_100727556 3300005354 Unclassified 905
34 Ga0070671_100121233 3300005355 Unclassified 2201
35 Ga0070674_100221042 3300005356 Bacteria 1473
36 Ga0070674_100695132 3300005356 Bacteria 869
37 Ga0070673_100061778 3300005364 Bacteria 2974
38 Ga0070673_100131448 3300005364 Bacteria 2101
39 Ga0070673_101154266 3300005364 Bacteria 725
40 Ga0070688_100015586 3300005365 Bacteria 4330
41 Ga0070659_100067091 3300005366 Unclassified 2845
42 Ga0070703_10403342 3300005406 Unclassified 596
43 Ga0070701_10008022 3300005438 Bacteria 4541
44 Ga0070705_100006785 3300005440 Bacteria 5631
45 Ga0070700_100012180 3300005441 Bacteria 4790
46 Ga0070700_100100960 3300005441 Bacteria 1901
47 Ga0070694_100009258 3300005444 Bacteria 6043
48 Ga0070694_100465774 3300005444 Bacteria 1000
49 Ga0070694_101268384 3300005444 Unclassified 619
50 Ga0070662_100386780 3300005457 Unclassified 1152
51 Ga0070681_10047941 3300005458 Unclassified 4270
52 Ga0068867_100058487 3300005459 Bacteria 2857
53 Ga0070707_100249020 3300005468 Bacteria 1729
54 Ga0070707_101265313 3300005468 Unclassified 704
55 Ga0070698_100032536 3300005471 Bacteria 5401
56 Ga0070698_101893250 3300005471 Unclassified 549
57 Ga0070699_100155940 3300005518 Bacteria 2020
58 Ga0070699_100833318 3300005518 Unclassified 844
59 Ga0070679_100156967 3300005530 Unclassified 2250
60 Ga0070697_100009648 3300005536 Bacteria 7540
61 Ga0070697_100354392 3300005536 Bacteria 1268
62 Ga0070697_100993657 3300005536 Bacteria 746
63 Ga0070697_101025385 3300005536 Unclassified 734
64 Ga0070672_101393857 3300005543 Unclassified 627
65 Ga0070686_100007728 3300005544 Bacteria 6012
66 Ga0070695_100001042 3300005545 Bacteria 15156
67 Ga0070695_100145231 3300005545 Bacteria 1650
68 Ga0070695_100373388 3300005545 Unclassified 1074
69 Ga0070695_101253839 3300005545 Bacteria 611
70 Ga0070696_100065636 3300005546 Bacteria 2544
71 Ga0070696_101319204 3300005546 Unclassified 613
72 Ga0070704_100114495 3300005549 Bacteria 2058
73 Ga0070704_100549674 3300005549 Unclassified 1009
74 Ga0068855_100455586 3300005563 Archaea 1395
75 Ga0070664_100020362 3300005564 Bacteria 5463
76 Ga0070664_101291355 3300005564 Bacteria 689
77 Ga0070664_101883048 3300005564 Unclassified 567
78 Ga0068857_100138817 3300005577 Unclassified 2196
79 Ga0068857_100792609 3300005577 Bacteria 904
80 Ga0068854_100050123 3300005578 Bacteria 2986
81 Ga0068854_100664061 3300005578 Bacteria 896
82 Ga0070702_100001792 3300005615 Bacteria 8922
83 Ga0068859_100008418 3300005617 Bacteria 10446
84 Ga0068859_100078261 3300005617 Unclassified 3347
85 Ga0068859_100322042 3300005617 Unclassified 1640
86 Ga0068859_101038311 3300005617 Unclassified 901
87 Ga0068864_100094962 3300005618 Unclassified 2636
88 Ga0068864_100199972 3300005618 Bacteria 1835
89 Ga0068861_100173748 3300005719 Bacteria 1788
90 Ga0068861_100282707 3300005719 Bacteria 1429
91 Ga0068861_100361546 3300005719 Unclassified 1277
92 Ga0068863_100729706 3300005841 Unclassified 986
93 Ga0068863_101915880 3300005841 Unclassified 603
94 Ga0068858_100326962 3300005842 Bacteria 1466
95 Ga0068858_100381500 3300005842 Unclassified 1353
96 Ga0068860_100256166 3300005843 Unclassified 1705
97 Ga0068860_100616078 3300005843 Unclassified 1092
98 Ga0068862_100129845 3300005844 Bacteria 2228
99 Ga0068862_100361439 3300005844 Unclassified 1349
100 Ga0068862_100504648 3300005844 Bacteria 1149
101 Ga0068862_102006656 3300005844 Bacteria 589
102 Ga0081455_10498073 3300005937 Bacteria 819
103 Ga0081538_10149800 3300005981 Bacteria 1059
104 Ga0075432_10080072 3300006058 Bacteria 1183
105 Ga0070716_100070355 3300006173 Bacteria 2054
106 Ga0075431_100241613 3300006847 Bacteria 1837
107 Ga0075433_10003905 3300006852 Bacteria 11538
108 Ga0075433_10011221 3300006852 Bacteria 7211
109 Ga0075433_10391637 3300006852 Bacteria 1226
110 Ga0075433_10999529 3300006852 Unclassified 729
111 Ga0075434_100003159 3300006871 Bacteria 14687
112 Ga0075434_100008156 3300006871 Bacteria 9715
113 Ga0075434_100432642 3300006871 Unclassified 1337
114 Ga0075434_100447688 3300006871 Bacteria 1313
115 Ga0075429_100213924 3300006880 Unclassified 1689
116 Ga0075436_100013595 3300006914 Bacteria 5575
117 Ga0075436_100024028 3300006914 Bacteria 4189
118 Ga0075436_100065357 3300006914 Bacteria 2515
119 Ga0097620_100008418 3300006931 Bacteria 10446
120 Ga0097620_100078264 3300006931 Unclassified 3347
121 Ga0097620_100322075 3300006931 Unclassified 1640
122 Ga0097620_101038271 3300006931 Unclassified 901
123 Ga0075435_100000950 3300007076 Bacteria 18270
124 Ga0075435_100012767 3300007076 Bacteria 6223
125 Ga0075435_101310997 3300007076 Unclassified 634
126 Ga0105240_11164969 3300009093 Bacteria 818
127 Ga0111539_10000509 3300009094 Bacteria 49359
128 Ga0111539_10000892 3300009094 Bacteria 38949
129 Ga0111539_10026099 3300009094 Bacteria 7151
130 Ga0111539_10866716 3300009094 Bacteria 1050
131 Ga0105247_10616141 3300009101 Unclassified 807
132 Ga0114129_10002451 3300009147 Bacteria 25770
133 Ga0114129_10164287 3300009147 Unclassified 3031
134 Ga0114129_10581068 3300009147 Bacteria 1454
135 Ga0114129_11945766 3300009147 Bacteria 712
136 Ga0105243_10012023 3300009148 Bacteria 6545
137 Ga0105242_10380061 3300009176 Bacteria 1313
138 Ga0105248_10485934 3300009177 Bacteria 1392
139 Ga0105248_10692224 3300009177 Bacteria 1150
140 Ga0105248_11002462 3300009177 Bacteria 943
141 Ga0105248_12557747 3300009177 Unclassified 582
142 Ga0105237_11646662 3300009545 Unclassified 649
143 Ga0105238_10153534 3300009551 Unclassified 2277
144 Ga0105249_10489412 3300009553 Bacteria 1274
145 Ga0105249_10787220 3300009553 Bacteria 1015
146 Ga0105246_11209183 3300011119 Bacteria 696
147 Ga0157372_10292915 3300013307 Archaea 1893
148 Ga0163163_10027154 3300014325 Bacteria 5481
149 Ga0163163_10035337 3300014325 Bacteria 4847
150 Ga0157380_10142112 3300014326 Bacteria 2064
151 Ga0182008_10437879 3300014497 Unclassified 708
152 Ga0157377_10015308 3300014745 Unclassified 3920
153 Ga0157377_10058536 3300014745 Bacteria 2194
154 Ga0157379_11377364 3300014968 Unclassified 683
155 Ga0207697_10203123 3300025315 Unclassified 872
156 Ga0207697_10287131 3300025315 Bacteria 729
157 Ga0207682_10078803 3300025893 Unclassified 1408
158 Ga0207682_10250424 3300025893 Bacteria 825
159 Ga0207688_10335266 3300025901 Unclassified 930
160 Ga0207645_10003113 3300025907 Bacteria 12717
161 Ga0207645_10361819 3300025907 Bacteria 972
162 Ga0207643_10051188 3300025908 Bacteria 2344
163 Ga0207662_10034114 3300025918 Bacteria 2970
164 Ga0207662_10218322 3300025918 Bacteria 1240
165 Ga0207662_10958229 3300025918 Unclassified 607
166 Ga0207649_10461175 3300025920 Unclassified 961
167 Ga0207646_10421758 3300025922 Bacteria 1204
168 Ga0207650_10005312 3300025925 Bacteria 8786
169 Ga0207650_10914459 3300025925 Bacteria 745
170 Ga0207659_10000348 3300025926 Bacteria 27635
171 Ga0207659_10049442 3300025926 Bacteria 2983
172 Ga0207659_10064006 3300025926 Unclassified 2660
173 Ga0207659_10297426 3300025926 Unclassified 1325
174 Ga0207659_11402473 3300025926 Unclassified 599
175 Ga0207706_10029567 3300025933 Bacteria 4890
176 Ga0207706_10125873 3300025933 Unclassified 2254
177 Ga0207706_10421487 3300025933 Unclassified 1156
178 Ga0207709_10008404 3300025935 Bacteria 5711
179 Ga0207670_10354137 3300025936 Unclassified 1163
180 Ga0207669_11132244 3300025937 Bacteria 661
181 Ga0207665_10082210 3300025939 Bacteria 2219
182 Ga0207691_10264556 3300025940 Bacteria 1482
183 Ga0207711_11735945 3300025941 Bacteria 567
184 Ga0207679_10100047 3300025945 Unclassified 2265
185 Ga0207679_11571903 3300025945 Unclassified 603
186 Ga0207651_10046153 3300025960 Bacteria 2927
187 Ga0207651_10159560 3300025960 Bacteria 1766
188 Ga0207668_10077975 3300025972 Bacteria 2391
189 Ga0207668_10208917 3300025972 Unclassified 1560
190 Ga0207668_11375733 3300025972 Unclassified 636
191 Ga0207640_10069428 3300025981 Bacteria 2366
192 Ga0207640_10943509 3300025981 Bacteria 756
193 Ga0207640_12049894 3300025981 Bacteria 519
194 Ga0207703_10100517 3300026035 Unclassified 2451
195 Ga0207703_10207392 3300026035 Bacteria 1745
196 Ga0207703_10456257 3300026035 Unclassified 1195
197 Ga0207708_10009769 3300026075 Bacteria 7119
198 Ga0207708_10009869 3300026075 Bacteria 7088
199 Ga0207708_10364431 3300026075 Bacteria 1188
200 Ga0207641_10267870 3300026088 Unclassified 1602
201 Ga0207641_11800757 3300026088 Unclassified 614
202 Ga0207648_10005095 3300026089 Bacteria 13315
203 Ga0207676_10007385 3300026095 Bacteria 7795
204 Ga0207676_10472849 3300026095 Bacteria 1185
205 Ga0207676_11182245 3300026095 Unclassified 758
206 Ga0207674_10196029 3300026116 Bacteria 1969
207 Ga0207674_10555427 3300026116 Unclassified 1109
208 Ga0207675_100006747 3300026118 Bacteria 10855
209 Ga0207675_100245039 3300026118 Bacteria 1733
210 Ga0209974_10278829 3300027876 Bacteria 635
211 Ga0207428_10003437 3300027907 Bacteria 15383
212 Ga0207428_10008532 3300027907 Bacteria 9246
213 Ga0207428_10011820 3300027907 Bacteria 7694
214 Ga0207428_10595025 3300027907 Bacteria 797
215 Ga0268265_10040994 3300028380 Unclassified 3423
216 Ga0268265_10152289 3300028380 Unclassified 1952
217 Ga0268265_10298757 3300028380 Unclassified 1449
218 Ga0268265_10818642 3300028380 Bacteria 909
219 Ga0268265_11107149 3300028380 Unclassified 786
220 Ga0268264_10217413 3300028381 Unclassified 1758
221 Ga0268264_10244858 3300028381 Unclassified 1662
222 Ga0268264_10847163 3300028381 Unclassified 915
223 Ga0265330_10292172 3300031235 Bacteria 687
224 Ga0265316_10546428 3300031344 Bacteria 825
225 Ga0307408_100038327 3300031548 Unclassified 3381
226 Ga0307408_100270188 3300031548 Bacteria 1411
227 Ga0307408_100485040 3300031548 Unclassified 1079
228 Ga0307405_10000780 3300031731 Bacteria 12489
229 Ga0307405_10166438 3300031731 Unclassified 1568
230 Ga0307405_10203042 3300031731 Bacteria 1441
231 Ga0307405_11221003 3300031731 Bacteria 651
232 Ga0307413_10007701 3300031824 Bacteria 5024
233 Ga0307413_11544350 3300031824 Unclassified 588
234 Ga0307413_11826693 3300031824 Bacteria 544
235 Ga0307410_10904038 3300031852 Unclassified 756
236 Ga0307407_11097596 3300031903 Unclassified 618
237 Ga0307412_10048342 3300031911 Bacteria 2797
238 Ga0307412_10072159 3300031911 Unclassified 2359
239 Ga0307409_100014921 3300031995 Bacteria 5076
240 Ga0307409_100051256 3300031995 Bacteria 3157
241 Ga0307409_101151790 3300031995 Bacteria 798
242 Ga0307416_100028684 3300032002 Bacteria 4144
243 Ga0307416_100852309 3300032002 Unclassified 1009
244 Ga0307414_10056542 3300032004 Unclassified 2753
245 Ga0307411_10020227 3300032005 Bacteria 3866
246 Ga0307411_10030260 3300032005 Bacteria 3317
247 Ga0307411_10096420 3300032005 Unclassified 2079
248 Ga0307411_10176471 3300032005 Unclassified 1617
249 Ga0307411_10598433 3300032005 Unclassified 948
250 Ga0307415_100015320 3300032126 Bacteria 4536
251 Ga0307415_100111476 3300032126 Bacteria 2031
252 Ga0373934_0379025 3300035086 Unclassified 590
253 Ga0373939_0073266 3300035114 Bacteria 1120
254 Ga0373943_0127912 3300035170 Bacteria 1357
255 Ga0373943_0249173 3300035170 Unclassified 997
256 Ga0373955_0079117 3300035172 Unclassified 1854
257 Ga0373935_0984058 3300035692 Unclassified 626
258 Ga0373933_0235105 3300035724 Bacteria 1178
259 Ga0373947_0732606 3300035725 Bacteria 674
260 Ga0373937_0179963 3300036401 Unclassified 1985
261 Ga0373925_0105747 3300037068 Bacteria 2169
262 Ga0439461_0105729 3300041410 Unclassified 690
263 Ga0451802_0441384 3300041460 Unclassified 659
264 Ga0495651_0786573 3300046462 Unclassified 588
265 Ga0495582_0112917 3300046473 Unclassified 1527
266 Ga0495643_0003490 3300046522 Bacteria 11458
267 Ga0495640_0488003 3300046533 Unclassified 750
268 Ga0495640_0631730 3300046533 Bacteria 645
269 Ga0495598_0141557 3300046537 Bacteria 832
270 Ga0495621_0095173 3300046539 Unclassified 1127
271 Ga0495588_0130976 3300046674 Bacteria 1323
272 Ga0495658_0542261 3300046683 Bacteria 745
273 Ga0495669_0427815 3300046684 Unclassified 642
274 Ga0495624_0156108 3300046690 Unclassified 1395
275 Ga0496112_1308957 3300048915 Bacteria 640
276 Ga0501308_069259 3300049128 Bacteria 545
277 Ga0501036_1608157 3300049572 Bacteria 525
278 Ga0501040_0663936 3300049576 Bacteria 754
279 Ga0501068_0842982 3300049584 Unclassified 602
280 Ga0501069_0761746 3300049585 Archaea 586
281 Ga0501081_0638817 3300049743 Unclassified 798
282 Ga0501267_041981 3300049764 Unclassified 573
283 Ga0501044_0590179 3300049823 Bacteria 1005
284 nmdc:mga05p37_1324018_c1 3300050507 Bacteria 732
285 nmdc:mga05p37_170956_c1 3300050507 Bacteria 619
286 nmdc:mga05p37_33054_c1 3300050507 Bacteria 6335
287 nmdc:mga09592_1055968_c1 3300050508 Unclassified 677
288 nmdc:mga06r32_456439_c1 3300050510 Bacteria 1257
289 nmdc:mga08y16_16606_c1 3300050511 Bacteria 7743
290 nmdc:mga08y16_319080_c1 3300050511 Bacteria 1017
291 nmdc:mga08y16_3391_c1 3300050511 Bacteria 16521
292 nmdc:mga08y16_4635_c1 3300050511 Bacteria 14325
293 nmdc:mga0n895_104718_c1 3300050512 Bacteria 2842
294 nmdc:mga0n895_1465377_c1 3300050512 Unclassified 650
295 nmdc:mga0n895_9736_c1 3300050512 Bacteria 8429
296 nmdc:mga0rr50_183036_c1 3300050513 Unclassified 1714
297 nmdc:mga0rr50_298332_c1 3300050513 Bacteria 1348
298 nmdc:mga08x19_19582_c1 3300050514 Bacteria 4155
299 nmdc:mga08x19_196485_c1 3300050514 Unclassified 1381
300 nmdc:mga08x19_4176_c1 3300050514 Bacteria 8561
301 nmdc:mga0a205_1451756_c1 3300050515 Bacteria 534
302 nmdc:mga0a205_197077_c1 3300050515 Bacteria 1905
303 nmdc:mga0a205_619018_c1 3300050515 Unclassified 935
304 Ga0495601_0176164 3300053077 Unclassified 1398
305 Ga0495595_0061796 3300053084 Bacteria 1755
306 Ga0495619_0206247 3300053085 Unclassified 1361
307 Ga0495619_0247243 3300053085 Unclassified 1236
308 Ga0590071_000220 3300059421 Bacteria 16847
309 Ga0590071_000269 3300059421 Bacteria 15136
310 Ga0590074_001134 3300059423 Bacteria 4192
311 Ga0590074_005876 3300059423 Bacteria 2037
312 Ga0590075_000497 3300059424 Bacteria 10655
313 Ga0590075_000677 3300059424 Bacteria 9064
314 Ga0590077_000591 3300059426 Bacteria 9967
315 Ga0590077_001411 3300059426 Bacteria 5632
316 Ga0590077_090759 3300059426 Unclassified 709
317 Ga0501082_0704354 3300060353 Unclassified 884
318 Ga0501082_1616404 3300060353 Unclassified 566
319 Ga0530510_1136365 3300061734 Bacteria 599
320 Ga0070674_100534474
321 JGI24751J29686_10009006
322 Ga0058859_11299410
323 Ga0058863_11967846
324 Ga0058861_10068812
325 Ga0058862_10093738
326 Ga0065712_10274088
327 Ga0065712_10280029
328 Ga0065715_10096053
329 Ga0065715_10113320
330 Ga0065715_10553899
331 Ga0065715_11035209
332 Ga0070676_10029075
333 Ga0070690_100253146
334 Ga0070670_100006032
335 Ga0070670_100012253
336 Ga0070666_10804754
337 Ga0070680_100852111
338 Ga0070682_100101384
339 Ga0068868_101582849
340 Ga0070660_100131120
341 Ga0070691_10006601
342 Ga0070691_10259988
343 Ga0070687_100044837
344 Ga0070687_101068504
345 Ga0070661_100397243
346 Ga0070668_100011989
347 Ga0070668_100182515
348 Ga0070669_100190802
349 Ga0070675_100000352
350 Ga0070675_100028923
351 Ga0070675_100186550
352 Ga0070675_100727556
353 Ga0070671_100121233
354 Ga0070674_100221042
355 Ga0070674_100695132
356 Ga0070673_100061778
357 Ga0070673_100131448
358 Ga0070673_101154266
359 Ga0070688_100015586
360 Ga0070659_100067091
361 Ga0070703_10403342
362 Ga0070701_10008022
363 Ga0070705_100006785
364 Ga0070700_100012180
365 Ga0070700_100100960
366 Ga0070694_100009258
367 Ga0070694_100465774
368 Ga0070694_101268384
369 Ga0070662_100386780
370 Ga0070681_10047941
371 Ga0068867_100058487
372 Ga0070707_100249020
373 Ga0070707_101265313
374 Ga0070698_100032536
375 Ga0070698_101893250
376 Ga0070699_100155940
377 Ga0070699_100833318
378 Ga0070679_100156967
379 Ga0070697_100009648
380 Ga0070697_100354392
381 Ga0070697_100993657
382 Ga0070697_101025385
383 Ga0070672_101393857
384 Ga0070686_100007728
385 Ga0070695_100001042
386 Ga0070695_100145231
387 Ga0070695_100373388
388 Ga0070695_101253839
389 Ga0070696_100065636
390 Ga0070696_101319204
391 Ga0070704_100114495
392 Ga0070704_100549674
393 Ga0068855_100455586
394 Ga0070664_100020362
395 Ga0070664_101291355
396 Ga0070664_101883048
397 Ga0068857_100138817
398 Ga0068857_100792609
399 Ga0068854_100050123
400 Ga0068854_100664061
401 Ga0070702_100001792
402 Ga0068859_100008418
403 Ga0068859_100078261
404 Ga0068859_100322042
405 Ga0068859_101038311
406 Ga0068864_100094962
407 Ga0068864_100199972
408 Ga0068861_100173748
409 Ga0068861_100282707
410 Ga0068861_100361546
411 Ga0068863_100729706
412 Ga0068863_101915880
413 Ga0068858_100326962
414 Ga0068858_100381500
415 Ga0068860_100256166
416 Ga0068860_100616078
417 Ga0068862_100129845
418 Ga0068862_100361439
419 Ga0068862_100504648
420 Ga0068862_102006656
421 Ga0081455_10498073
422 Ga0081538_10149800
423 Ga0075432_10080072
424 Ga0070716_100070355
425 Ga0075431_100241613
426 Ga0075433_10003905
427 Ga0075433_10011221
428 Ga0075433_10391637
429 Ga0075433_10999529
430 Ga0075434_100003159
431 Ga0075434_100008156
432 Ga0075434_100432642
433 Ga0075434_100447688
434 Ga0075429_100213924
435 Ga0075436_100013595
436 Ga0075436_100024028
437 Ga0075436_100065357
438 Ga0097620_100008418
439 Ga0097620_100078264
440 Ga0097620_100322075
441 Ga0097620_101038271
442 Ga0075435_100000950
443 Ga0075435_100012767
444 Ga0075435_101310997
445 Ga0105240_11164969
446 Ga0111539_10000509
447 Ga0111539_10000892
448 Ga0111539_10026099
449 Ga0111539_10866716
450 Ga0105247_10616141
451 Ga0114129_10002451
452 Ga0114129_10164287
453 Ga0114129_10581068
454 Ga0114129_11945766
455 Ga0105243_10012023
456 Ga0105242_10380061
457 Ga0105248_10485934
458 Ga0105248_10692224
459 Ga0105248_11002462
460 Ga0105248_12557747
461 Ga0105237_11646662
462 Ga0105238_10153534
463 Ga0105249_10489412
464 Ga0105249_10787220
465 Ga0105246_11209183
466 Ga0157372_10292915
467 Ga0163163_10027154
468 Ga0163163_10035337
469 Ga0157380_10142112
470 Ga0182008_10437879
471 Ga0157377_10015308
472 Ga0157377_10058536
473 Ga0157379_11377364
474 Ga0207697_10203123
475 Ga0207697_10287131
476 Ga0207682_10078803
477 Ga0207682_10250424
478 Ga0207688_10335266
479 Ga0207645_10003113
480 Ga0207645_10361819
481 Ga0207643_10051188
482 Ga0207662_10034114
483 Ga0207662_10218322
484 Ga0207662_10958229
485 Ga0207649_10461175
486 Ga0207646_10421758
487 Ga0207650_10005312
488 Ga0207650_10914459
489 Ga0207659_10000348
490 Ga0207659_10049442
491 Ga0207659_10064006
492 Ga0207659_10297426
493 Ga0207659_11402473
494 Ga0207706_10029567
495 Ga0207706_10125873
496 Ga0207706_10421487
497 Ga0207709_10008404
498 Ga0207670_10354137
499 Ga0207669_11132244
500 Ga0207665_10082210
501 Ga0207691_10264556
502 Ga0207711_11735945
503 Ga0207679_10100047
504 Ga0207679_11571903
505 Ga0207651_10046153
506 Ga0207651_10159560
507 Ga0207668_10077975
508 Ga0207668_10208917
509 Ga0207668_11375733
510 Ga0207640_10069428
511 Ga0207640_10943509
512 Ga0207640_12049894
513 Ga0207703_10100517
514 Ga0207703_10207392
515 Ga0207703_10456257
516 Ga0207708_10009769
517 Ga0207708_10009869
518 Ga0207708_10364431
519 Ga0207641_10267870
520 Ga0207641_11800757
521 Ga0207648_10005095
522 Ga0207676_10007385
523 Ga0207676_10472849
524 Ga0207676_11182245
525 Ga0207674_10196029
526 Ga0207674_10555427
527 Ga0207675_100006747
528 Ga0207675_100245039
529 Ga0209974_10278829
530 Ga0207428_10003437
531 Ga0207428_10008532
532 Ga0207428_10011820
533 Ga0207428_10595025
534 Ga0268265_10040994
535 Ga0268265_10152289
536 Ga0268265_10298757
537 Ga0268265_10818642
538 Ga0268265_11107149
539 Ga0268264_10217413
540 Ga0268264_10244858
541 Ga0268264_10847163
542 Ga0265330_10292172
543 Ga0265316_10546428
544 Ga0307408_100038327
545 Ga0307408_100270188
546 Ga0307408_100485040
547 Ga0307405_10000780
548 Ga0307405_10166438
549 Ga0307405_10203042
550 Ga0307405_11221003
551 Ga0307413_10007701
552 Ga0307413_11544350
553 Ga0307413_11826693
554 Ga0307410_10904038
555 Ga0307407_11097596
556 Ga0307412_10048342
557 Ga0307412_10072159
558 Ga0307409_100014921
559 Ga0307409_100051256
560 Ga0307409_101151790
561 Ga0307416_100028684
562 Ga0307416_100852309
563 Ga0307414_10056542
564 Ga0307411_10020227
565 Ga0307411_10030260
566 Ga0307411_10096420
567 Ga0307411_10176471
568 Ga0307411_10598433
569 Ga0307415_100015320
570 Ga0307415_100111476
571 Ga0373934_0379025
572 Ga0373939_0073266
573 Ga0373943_0127912
574 Ga0373943_0249173
575 Ga0373955_0079117
576 Ga0373935_0984058
577 Ga0373933_0235105
578 Ga0373947_0732606
579 Ga0373937_0179963
580 Ga0373925_0105747
581 Ga0439461_0105729
582 Ga0451802_0441384
583 Ga0495651_0786573
584 Ga0495582_0112917
585 Ga0495643_0003490
586 Ga0495640_0488003
587 Ga0495640_0631730
588 Ga0495598_0141557
589 Ga0495621_0095173
590 Ga0495588_0130976
591 Ga0495658_0542261
592 Ga0495669_0427815
593 Ga0495624_0156108
594 Ga0496112_1308957
595 Ga0501308_069259
596 Ga0501036_1608157
597 Ga0501040_0663936
598 Ga0501068_0842982
599 Ga0501069_0761746
600 Ga0501081_0638817
601 Ga0501267_041981
602 Ga0501044_0590179
603 nmdc:mga05p37_1324018_c1
604 nmdc:mga05p37_170956_c1
605 nmdc:mga05p37_33054_c1
606 nmdc:mga09592_1055968_c1
607 nmdc:mga06r32_456439_c1
608 nmdc:mga08y16_16606_c1
609 nmdc:mga08y16_319080_c1
610 nmdc:mga08y16_3391_c1
611 nmdc:mga08y16_4635_c1
612 nmdc:mga0n895_104718_c1
613 nmdc:mga0n895_1465377_c1
614 nmdc:mga0n895_9736_c1
615 nmdc:mga0rr50_183036_c1
616 nmdc:mga0rr50_298332_c1
617 nmdc:mga08x19_19582_c1
618 nmdc:mga08x19_196485_c1
619 nmdc:mga08x19_4176_c1
620 nmdc:mga0a205_1451756_c1
621 nmdc:mga0a205_197077_c1
622 nmdc:mga0a205_619018_c1
623 Ga0495601_0176164
624 Ga0495595_0061796
625 Ga0495619_0206247
626 Ga0495619_0247243
627 Ga0590071_000220
628 Ga0590071_000269
629 Ga0590074_001134
630 Ga0590074_005876
631 Ga0590075_000497
632 Ga0590075_000677
633 Ga0590077_000591
634 Ga0590077_001411
635 Ga0590077_090759
636 Ga0501082_0704354
637 Ga0501082_1616404
638 Ga0530510_1136365

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06094

GGACT

Gamma-glutamyl cyclotransferase, AIG2-like

5

118

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
8cvm-assembly1.cif.gz_t cutibacterium acnes 50s ribosomal subunit with p-site trna and sarecycline bound in the local refined map 0.8251 89 109
8cll-assembly1.cif.gz_F structural insights into human tfiiic promoter recognition 0.635 64 112
3cry-assembly1.cif.gz_B gamma-glutamyl cyclotransferase 0.6114 4 111
2rbh-assembly1.cif.gz_B gamma-glutamyl cyclotransferase 0.6061 1 111
2q53-assembly1.cif.gz_A ensemble refinement of the crystal structure of uncharacterized protein loc79017 from homo sapiens 0.606 4 111
ID Description Score Start End Superfamily
af_Q84T74_16_169_3.10.490.10 Alpha Beta;Roll;Hypothetical upf0131 protein ytfp;Gamma-glutamyl cyclotransferase-like 0.6895 3 113 3.10.490.10
2xsjE03 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.6869 88 111 3.30.70.20
2qikA02 Alpha Beta;Roll;Hypothetical upf0131 protein ytfp;Gamma-glutamyl cyclotransferase-like 0.6806 4 111 3.10.490.10
af_Q57876_117_222_3.10.490.10 Alpha Beta;Roll;Hypothetical upf0131 protein ytfp;Gamma-glutamyl cyclotransferase-like 0.679 1 111 3.10.490.10
af_A8MRP2_2_115_3.10.490.10 Alpha Beta;Roll;Hypothetical upf0131 protein ytfp;Gamma-glutamyl cyclotransferase-like 0.6698 1 111 3.10.490.10
ID Description Score Start End GO Terms
AF-A0A7W7UU74-F1-model_v4 deleted 0.8557 55 113
AF-A0A7C4C407-F1-model_v4 Gamma-glutamylcyclotransferase 0.8179 1 114 GO:0016740
AF-A0A662NQ92-F1-model_v4 Gamma-glutamylcyclotransferase AIG2-like domain-containing protein 0.8119 1 112
AF-A0A1V3NTT7-F1-model_v4 Gamma-glutamylcyclotransferase AIG2-like domain-containing protein 0.8087 1 115
AF-A0A3R9Q863-F1-model_v4 Gamma-glutamylcyclotransferase (GGCT)/AIG2-like uncharacterized protein YtfP 0.8038 1 113 GO:0016740

Map