F404730

General Info

Members Datasets Scaffolds Average Seq Length
318 191 636 204

Family's Representative Sequence

Representative Sequence 3300044656|Ga0466969_0142146|Ga0466969_0142146_254_895
Length 213
Sequence MAAADRLVWIDCEMTGLDLEVDELVEVAAVVTDFELNVLDPGFDIVIKPNDSALAQMGPVVRDMHTSSGLLEAMQHGVSLGEAEAKVLEYLQRFTAPGQAPIAGNTIGTDRSFLVRQMPRVDAHLHYRSIDVSSIKELVKRWFPRVYYNAPAKHGGHRALADILESIRELAYYRRTAFVAQPGPASDQAQAAAAEVVEAFTHSAVPKAGPALR

Samples

Sample ID Description Type Environment
1 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
2 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
13 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
14 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
15 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
16 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
17 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
18 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
19 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
20 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
21 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
22 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
23 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
24 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
25 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
26 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
27 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
28 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
29 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
30 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
31 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
32 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
33 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
34 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
35 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
36 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
37 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
38 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
39 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
52 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
53 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
54 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
55 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
56 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
57 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
58 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
59 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
60 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
61 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
62 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
63 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
64 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
65 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
66 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
67 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
68 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
69 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
70 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
71 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
72 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
73 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
74 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
75 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
76 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
77 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
78 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
79 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
80 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
81 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
82 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
83 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
84 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
85 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
86 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
87 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
88 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
89 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
90 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
91 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
92 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
93 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
94 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
95 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
96 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
97 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
98 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
99 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
100 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
101 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
102 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
103 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
108 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
109 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
113 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
114 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
115 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
116 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
117 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
118 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
119 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
120 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
121 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
122 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
123 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
124 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
125 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
126 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
127 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
128 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
129 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
130 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
131 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
132 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
133 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
134 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
135 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
136 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
137 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
138 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
139 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
140 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
141 2643221549 Agromyces sp. Root1464 Isolate Unclassified
142 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
143 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
144 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
145 2643221647 Streptomyces sp. Root369 Isolate Unclassified
146 2643221649 Leifsonia sp. Root4 Isolate Unclassified
147 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
148 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
149 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
150 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
151 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
152 2808606448 Streptomyces sp. 193411 Isolate Unclassified
153 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
154 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
155 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
156 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
157 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
158 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
159 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
160 2857737099 Lysinimonas sp. R-73066 Isolate Unclassified
161 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
162 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
163 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
164 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
165 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
166 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
167 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
168 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
169 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
170 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
171 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
172 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
173 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
174 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
175 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
176 2946033335 Microbacterium sp. W4I4 Isolate Rhizosphere
177 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
178 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
179 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
180 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
181 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
182 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
183 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
184 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
185 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
186 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
187 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
188 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
189 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
190 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere
191 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 82.39
Metatranscriptomes 0.94
Isolates 16.67

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.75
Nodule 0.63
Rhizoplane 2.52
Rhizosphere 72.33
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466969_0142146 3300044656 Bacteria 1109
2 JGI25164J39214_1000526 3300002772 Bacteria 18052
3 JGI25165J46597_1000002 3300003214 Bacteria 765387
4 rootH1_10028941 3300003316 Bacteria 3082
5 rootL2_10007353 3300003322 Bacteria 5395
6 rootH1_10001567 3300003323 Bacteria 8915
7 Ga0065714_10201961 3300005288 Bacteria 892
8 Ga0070658_10013790 3300005327 Bacteria 6484
9 Ga0070658_10075565 3300005327 Bacteria 2763
10 Ga0070703_10087703 3300005406 Bacteria 1073
11 Ga0070710_10037434 3300005437 Bacteria 2659
12 Ga0070700_100497399 3300005441 Bacteria 937
13 Ga0070663_100416909 3300005455 Bacteria 1101
14 Ga0068857_100403684 3300005577 Bacteria 1272
15 Ga0070702_100768051 3300005615 Bacteria 742
16 Ga0068861_100270220 3300005719 Bacteria 1460
17 Ga0068862_100052700 3300005844 Bacteria 3482
18 Ga0068862_101208845 3300005844 Bacteria 755
19 Ga0075365_10024866 3300006038 Bacteria 3785
20 Ga0075365_10241607 3300006038 Bacteria 1268
21 Ga0075369_10010014 3300006186 Bacteria 3702
22 Ga0105244_10219632 3300009036 Bacteria 892
23 Ga0111539_10975838 3300009094 Bacteria 985
24 Ga0105245_10098166 3300009098 Bacteria 2706
25 Ga0105243_10237477 3300009148 Bacteria 1620
26 Ga0105249_10250105 3300009553 Bacteria 1757
27 Ga0105239_10090532 3300010375 Bacteria 3375
28 Ga0157369_10000618 3300013105 Bacteria 46223
29 Ga0157369_10039094 3300013105 Bacteria 5186
30 Ga0157369_10265481 3300013105 Bacteria 1790
31 Ga0157374_10286691 3300013296 Bacteria 1627
32 Ga0163162_11013163 3300013306 Bacteria 939
33 Ga0157372_10023828 3300013307 Bacteria 6641
34 Ga0157372_10400994 3300013307 Bacteria 1598
35 Ga0157372_10849493 3300013307 Bacteria 1060
36 Ga0163163_11229862 3300014325 Bacteria 811
37 Ga0157380_10003895 3300014326 Bacteria 10292
38 Ga0163161_10270160 3300017792 Bacteria 1330
39 Ga0206354_10724876 3300020081 Bacteria 3014
40 Ga0206353_10147215 3300020082 Bacteria 3209
41 Ga0206353_10155678 3300020082 Bacteria 1478
42 Ga0213875_10000983 3300021388 Bacteria 20379
43 Ga0207427_100089 3300025231 Bacteria 135504
44 Ga0209437_100592 3300025233 Bacteria 22827
45 Ga0209677_103457 3300025253 Bacteria 5118
46 Ga0209233_1000001 3300025261 Bacteria 2992747
47 Ga0207692_10150633 3300025898 Bacteria 1332
48 Ga0207647_10029529 3300025904 Bacteria 3547
49 Ga0207643_10050686 3300025908 Bacteria 2354
50 Ga0207705_10172122 3300025909 Bacteria 1631
51 Ga0207659_10126343 3300025926 Bacteria 1967
52 Ga0207700_10540512 3300025928 Bacteria 1033
53 Ga0207709_10036857 3300025935 Bacteria 2901
54 Ga0207679_10976522 3300025945 Bacteria 776
55 Ga0207712_10507207 3300025961 Bacteria 1032
56 Ga0207678_10538818 3300026067 Bacteria 1020
57 Ga0207683_10083811 3300026121 Bacteria 2833
58 Ga0207683_10196284 3300026121 Bacteria 1834
59 Ga0268265_10115197 3300028380 Bacteria 2203
60 Ga0307515_10074795 3300028794 Bacteria 4524
61 Ga0307513_10275490 3300031456 Bacteria 1463
62 Ga0307514_10007631 3300031649 Bacteria 9316
63 Ga0307413_10341233 3300031824 Bacteria 1152
64 Ga0307518_10298123 3300031838 Bacteria 982
65 Ga0307410_10479037 3300031852 Bacteria 1020
66 Ga0307410_10608284 3300031852 Bacteria 912
67 Ga0307406_10627027 3300031901 Bacteria 890
68 Ga0307407_10518006 3300031903 Bacteria 877
69 Ga0307412_10560393 3300031911 Bacteria 961
70 Ga0307412_10604703 3300031911 Bacteria 929
71 Ga0307416_100156514 3300032002 Bacteria 2099
72 Ga0307414_11162723 3300032004 Bacteria 714
73 Ga0307415_100530652 3300032126 Bacteria 1035
74 Ga0307415_100765507 3300032126 Bacteria 878
75 Ga0307415_101018550 3300032126 Bacteria 771
76 Ga0395899_0025867 3300037312 Bacteria 4430
77 Ga0395900_0087007 3300037418 Bacteria 3212
78 Ga0395900_0171141 3300037418 Bacteria 2211
79 Ga0436364_1394025 3300037853 Bacteria 7623
80 Ga0395901_0350133 3300038443 Bacteria 1524
81 Ga0395901_0616966 3300038443 Bacteria 1092
82 Ga0451791_0446943 3300041451 Bacteria 1130
83 Ga0451807_1635923 3300041486 Bacteria 1080
84 Ga0451835_1217232 3300041492 Bacteria 756
85 Ga0439449_0025433 3300042007 Bacteria 2213
86 Ga0466969_0081586 3300044656 Bacteria 1543
87 Ga0466972_0070303 3300044658 Bacteria 1670
88 Ga0466965_0000011 3300044683 Bacteria 107319
89 Ga0466965_0065287 3300044683 Bacteria 1823
90 Ga0466965_0079894 3300044683 Bacteria 1652
91 Ga0466966_0227799 3300044684 Bacteria 1125
92 Ga0466966_0237641 3300044684 Bacteria 1099
93 Ga0466966_0237719 3300044684 Bacteria 1098
94 Ga0466966_0381218 3300044684 Bacteria 847
95 Ga0466961_0166478 3300044693 Bacteria 1372
96 Ga0466961_0292695 3300044693 Bacteria 995
97 Ga0466961_0414690 3300044693 Bacteria 816
98 Ga0466961_0467782 3300044693 Bacteria 762
99 Ga0466963_0429551 3300044694 Bacteria 932
100 Ga0466970_0002053 3300044765 Bacteria 9741
101 Ga0466970_0041198 3300044765 Bacteria 2453
102 Ga0466970_0304816 3300044765 Bacteria 899
103 Ga0466957_0086324 3300044842 Bacteria 1961
104 Ga0466960_0026620 3300044901 Bacteria 2629
105 Ga0466960_0051579 3300044901 Bacteria 1988
106 Ga0466960_0123727 3300044901 Bacteria 1357
107 Ga0466960_0326060 3300044901 Bacteria 871
108 Ga0466959_0074243 3300045049 Bacteria 2459
109 Ga0466959_0257140 3300045049 Bacteria 1203
110 Ga0466958_0089402 3300045836 Bacteria 1904
111 Ga0466958_0389562 3300045836 Bacteria 899
112 Ga0466958_0416675 3300045836 Bacteria 868
113 Ga0466967_0082971 3300045976 Bacteria 2898
114 Ga0495590_0000570 3300046457 Bacteria 17483
115 Ga0495625_0103390 3300046660 Bacteria 1954
116 Ga0495672_0004033 3300047320 Bacteria 12274
117 Ga0495672_0055250 3300047320 Bacteria 2318
118 Ga0495686_0350841 3300047472 Bacteria 802
119 Ga0496100_0319728 3300048903 Bacteria 1165
120 Ga0496102_0104472 3300048905 Bacteria 2635
121 Ga0496103_0151843 3300048906 Bacteria 1484
122 Ga0496104_0122097 3300048907 Bacteria 2501
123 Ga0496105_0453823 3300048908 Bacteria 1011
124 Ga0496107_0119543 3300048910 Bacteria 1941
125 Ga0496117_0000346 3300048920 Bacteria 81937
126 Ga0496117_0104450 3300048920 Bacteria 1783
127 Ga0496118_0019085 3300048921 Bacteria 6144
128 Ga0496118_0095254 3300048921 Bacteria 2033
129 Ga0496119_0053642 3300048922 Bacteria 2461
130 Ga0496119_0060765 3300048922 Bacteria 2260
131 Ga0496119_0067937 3300048922 Bacteria 2100
132 Ga0496120_0161588 3300048923 Bacteria 1116
133 Ga0496121_0042756 3300048924 Bacteria 3936
134 Ga0496122_0011750 3300048925 Bacteria 8822
135 Ga0496126_0003250 3300048929 Bacteria 20771
136 Ga0496126_0161324 3300048929 Bacteria 1915
137 Ga0496126_0782192 3300048929 Bacteria 734
138 Ga0501031_0002184 3300049568 Bacteria 12353
139 Ga0501031_0205968 3300049568 Bacteria 1283
140 Ga0501031_0465375 3300049568 Bacteria 816
141 Ga0501032_0007533 3300049569 Bacteria 7953
142 Ga0501032_0009167 3300049569 Bacteria 7177
143 Ga0501032_0029459 3300049569 Bacteria 3766
144 Ga0501032_0056560 3300049569 Bacteria 2637
145 Ga0501032_0317550 3300049569 Bacteria 1006
146 Ga0501033_0001609 3300049570 Bacteria 19839
147 Ga0501033_0003085 3300049570 Bacteria 13845
148 Ga0501033_0017688 3300049570 Bacteria 5384
149 Ga0501033_0029517 3300049570 Bacteria 4121
150 Ga0501033_0030987 3300049570 Bacteria 4019
151 Ga0501033_0046565 3300049570 Bacteria 3224
152 Ga0501033_0295298 3300049570 Bacteria 1142
153 Ga0501033_0310613 3300049570 Bacteria 1108
154 Ga0501033_0605573 3300049570 Bacteria 751
155 Ga0501034_0003046 3300049571 Bacteria 19382
156 Ga0501034_0004861 3300049571 Bacteria 14823
157 Ga0501034_0033037 3300049571 Bacteria 5253
158 Ga0501034_0063947 3300049571 Bacteria 3693
159 Ga0501034_0089484 3300049571 Bacteria 3076
160 Ga0501034_0336066 3300049571 Bacteria 1441
161 Ga0501034_0352339 3300049571 Bacteria 1400
162 Ga0501034_0409776 3300049571 Bacteria 1277
163 Ga0501034_0842519 3300049571 Bacteria 807
164 Ga0501034_0848922 3300049571 Bacteria 803
165 Ga0501034_1083379 3300049571 Bacteria 683
166 Ga0501036_0016832 3300049572 Bacteria 6107
167 Ga0501036_0060688 3300049572 Bacteria 3203
168 Ga0501036_0099321 3300049572 Bacteria 2461
169 Ga0501036_0132095 3300049572 Bacteria 2107
170 Ga0501036_0303794 3300049572 Bacteria 1334
171 Ga0501036_0504619 3300049572 Bacteria 1006
172 Ga0501037_0001224 3300049573 Bacteria 18952
173 Ga0501037_0037867 3300049573 Bacteria 3555
174 Ga0501037_0113729 3300049573 Bacteria 1948
175 Ga0501037_0196567 3300049573 Bacteria 1426
176 Ga0501037_0563633 3300049573 Bacteria 768
177 Ga0501038_0001166 3300049574 Bacteria 23863
178 Ga0501038_0017804 3300049574 Bacteria 6419
179 Ga0501038_0057456 3300049574 Bacteria 3341
180 Ga0501038_0137446 3300049574 Bacteria 2001
181 Ga0501038_0327804 3300049574 Bacteria 1196
182 Ga0501039_0000287 3300049575 Bacteria 35995
183 Ga0501039_0019997 3300049575 Bacteria 5132
184 Ga0501039_0402891 3300049575 Bacteria 1074
185 Ga0501042_0002237 3300049578 Bacteria 11809
186 Ga0501043_0001056 3300049579 Bacteria 24194
187 Ga0501043_0013280 3300049579 Bacteria 6439
188 Ga0501043_0050338 3300049579 Bacteria 3274
189 Ga0501043_0089860 3300049579 Bacteria 2414
190 Ga0501043_0230609 3300049579 Bacteria 1430
191 Ga0501043_0493546 3300049579 Bacteria 915
192 Ga0501046_0001394 3300049580 Bacteria 23269
193 Ga0501046_0006857 3300049580 Bacteria 10049
194 Ga0501046_0037843 3300049580 Bacteria 3875
195 Ga0501047_0024097 3300049581 Bacteria 5845
196 Ga0501047_0067844 3300049581 Bacteria 3436
197 Ga0501047_0116099 3300049581 Bacteria 2558
198 Ga0501047_0188289 3300049581 Bacteria 1928
199 Ga0501047_0193799 3300049581 Bacteria 1895
200 Ga0501047_0222719 3300049581 Bacteria 1742
201 Ga0501048_0005083 3300049582 Bacteria 10016
202 Ga0501048_0028020 3300049582 Bacteria 4091
203 Ga0501068_0072190 3300049584 Bacteria 2108
204 Ga0501068_0566687 3300049584 Bacteria 739
205 Ga0501069_0027131 3300049585 Bacteria 3138
206 Ga0501070_0000100 3300049586 Bacteria 75001
207 Ga0501070_0004119 3300049586 Bacteria 12505
208 Ga0501070_0013695 3300049586 Bacteria 6831
209 Ga0501070_0041915 3300049586 Bacteria 3812
210 Ga0501070_0042669 3300049586 Bacteria 3778
211 Ga0501070_0063573 3300049586 Bacteria 3057
212 Ga0501070_0452639 3300049586 Bacteria 1035
213 Ga0501070_0703619 3300049586 Bacteria 799
214 Ga0501071_0004915 3300049587 Bacteria 8527
215 Ga0501072_0697287 3300049588 Bacteria 798
216 Ga0501073_0000087 3300049589 Bacteria 58557
217 Ga0501073_0063773 3300049589 Bacteria 2569
218 Ga0501073_0064604 3300049589 Bacteria 2553
219 Ga0501073_0506889 3300049589 Bacteria 834
220 Ga0501074_0024343 3300049590 Bacteria 4400
221 Ga0501080_0000099 3300049742 Bacteria 59060
222 Ga0501080_0092715 3300049742 Bacteria 2805
223 Ga0501080_0219192 3300049742 Bacteria 1741
224 Ga0501080_0535183 3300049742 Bacteria 1044
225 Ga0501083_0000031 3300049744 Bacteria 104819
226 Ga0501083_0034216 3300049744 Bacteria 3475
227 Ga0501035_0004284 3300049822 Bacteria 13546
228 Ga0501035_0010479 3300049822 Bacteria 8590
229 Ga0501035_0020624 3300049822 Bacteria 6053
230 Ga0501035_0516622 3300049822 Bacteria 981
231 Ga0501035_0608069 3300049822 Bacteria 890
232 Ga0501044_0011666 3300049823 Bacteria 9523
233 Ga0501044_0037026 3300049823 Bacteria 5102
234 Ga0501044_0037274 3300049823 Bacteria 5083
235 Ga0501044_0153301 3300049823 Bacteria 2285
236 Ga0501044_0255875 3300049823 Bacteria 1690
237 Ga0501044_0345978 3300049823 Bacteria 1407
238 Ga0501044_0483443 3300049823 Bacteria 1141
239 Ga0501044_0641918 3300049823 Bacteria 951
240 Ga0501044_0844989 3300049823 Bacteria 792
241 Ga0501045_0249386 3300049824 Bacteria 1322
242 nmdc:mga00v17_17040_c1 3300050491 Bacteria 4103
243 nmdc:mga00v17_23031_c1 3300050491 Bacteria 3600
244 nmdc:mga0yw44_214213_c1 3300050492 Bacteria 1275
245 nmdc:mga07m45_257439_c1 3300050496 Bacteria 1015
246 Ga0500635_0000010 3300053080 Bacteria 147500
247 Ga0500643_001841 3300053087 Bacteria 11595
248 Ga0500650_0009704 3300053098 Bacteria 3876
249 Ga0500556_0000001 3300053104 Bacteria 1135060
250 Ga0500556_0085215 3300053104 Bacteria 1200
251 Ga0500559_0000182 3300053136 Bacteria 49814
252 Ga0500559_0000443 3300053136 Bacteria 29438
253 Ga0500559_0026256 3300053136 Bacteria 2480
254 Ga0500568_0000698 3300053139 Bacteria 24073
255 Ga0500568_0001028 3300053139 Bacteria 19099
256 Ga0500573_0000091 3300053140 Bacteria 41183
257 Ga0500573_0006190 3300053140 Bacteria 6454
258 Ga0500573_0021895 3300053140 Bacteria 3667
259 Ga0500573_0338949 3300053140 Bacteria 735
260 Ga0500577_0007027 3300053142 Bacteria 3137
261 Ga0500616_0000078 3300053153 Bacteria 202009
262 Ga0500616_0002208 3300053153 Bacteria 16677
263 Ga0500634_0231523 3300053161 Bacteria 784
264 Ga0501084_0054097 3300054114 Bacteria 3357
265 Ga0466962_0057486 3300061719 Bacteria 1857
266 2585299937 2582581312 Bacteria 7308206
267 2616697629 2616644814 Bacteria 11555299
268 2643767928 2643221549 Bacteria 4042819
269 2643944514 2643221587 Bacteria 7586415
270 2644179418 2643221631 Bacteria 8168043
271 2644198842 2643221635 Bacteria 2632343
272 2644263284 2643221647 Bacteria 10741251
273 2644280655 2643221649 Bacteria 3867359
274 2644431412 2643221677 Bacteria 7584031
275 2784588045 2784132148 Bacteria 8627943
276 2785344031 2784746763 Bacteria 9783172
277 2785368816 2784746768 Bacteria 10036182
278 2808920047 2808606375 Bacteria 9466072
279 2809231645 2808606448 Bacteria 8656184
280 2811848433 2808606982 Bacteria 7791042
281 2812481062 2811994917 Bacteria 7761064
282 2819693492 2818991463 Bacteria 7948711
283 2819742763 2818991472 Bacteria 10089953
284 2844854801 2844852863 Bacteria 3849151
285 2852645846 2852643534 Bacteria 3013378
286 2857730096 2857729791 Bacteria 4040535
287 2857740312 2857737099 Bacteria 3104305
288 2862287895 2862281513 Bacteria 9621493
289 2862295696 2862290372 Bacteria 7471434
290 2862391317 2862382967 Bacteria 10317375
291 2862511525 2862507626 Bacteria 9425308
292 2862710165 2862705112 Bacteria 6563286
293 2863405301 2863404153 Bacteria 9672205
294 2877681697 2877676314 Bacteria 9512378
295 2897564476 2897561785 Bacteria 3256946
296 2912720660 2912715099 Bacteria 9460473
297 2912724822 2912723979 Bacteria 8557534
298 2918503995 2918501144 Bacteria 8668083
299 2919446439 2919443155 Bacteria 4072969
300 2928123321 2928121344 Bacteria 3972376
301 2939658514 2939657138 Bacteria 3740283
302 2939662648 2939660829 Bacteria 3784848
303 2946033918 2946033335 Bacteria 3835514
304 2947230127 2947224130 Bacteria 9938529
305 2954386844 2954380949 Bacteria 10050426
306 2954697663 2954691527 Bacteria 10720516
307 2954704553 2954701450 Bacteria 10834262
308 2966603107 2966598605 Bacteria 7676064
309 2990065575 2990059506 Bacteria 9321252
310 3006496344 3006493962 Bacteria 8825450
311 8008559776 8008558824 Bacteria 10610750
312 8008579369 8008574985 Bacteria 7815457
313 8023631051 8023623736 Bacteria 8593882
314 8033691434 8033684223 Bacteria 6906479
315 8048413309 8048406513 Bacteria 8936924
316 8056038929 8056037122 Bacteria 3854319
317 8056830254 8056829672 Bacteria 9045328
318 8057347890 8057345674 Bacteria 4160394
319 Ga0466969_0142146
320 JGI25164J39214_1000526
321 JGI25165J46597_1000002
322 rootH1_10028941
323 rootL2_10007353
324 rootH1_10001567
325 Ga0065714_10201961
326 Ga0070658_10013790
327 Ga0070658_10075565
328 Ga0070703_10087703
329 Ga0070710_10037434
330 Ga0070700_100497399
331 Ga0070663_100416909
332 Ga0068857_100403684
333 Ga0070702_100768051
334 Ga0068861_100270220
335 Ga0068862_100052700
336 Ga0068862_101208845
337 Ga0075365_10024866
338 Ga0075365_10241607
339 Ga0075369_10010014
340 Ga0105244_10219632
341 Ga0111539_10975838
342 Ga0105245_10098166
343 Ga0105243_10237477
344 Ga0105249_10250105
345 Ga0105239_10090532
346 Ga0157369_10000618
347 Ga0157369_10039094
348 Ga0157369_10265481
349 Ga0157374_10286691
350 Ga0163162_11013163
351 Ga0157372_10023828
352 Ga0157372_10400994
353 Ga0157372_10849493
354 Ga0163163_11229862
355 Ga0157380_10003895
356 Ga0163161_10270160
357 Ga0206354_10724876
358 Ga0206353_10147215
359 Ga0206353_10155678
360 Ga0213875_10000983
361 Ga0207427_100089
362 Ga0209437_100592
363 Ga0209677_103457
364 Ga0209233_1000001
365 Ga0207692_10150633
366 Ga0207647_10029529
367 Ga0207643_10050686
368 Ga0207705_10172122
369 Ga0207659_10126343
370 Ga0207700_10540512
371 Ga0207709_10036857
372 Ga0207679_10976522
373 Ga0207712_10507207
374 Ga0207678_10538818
375 Ga0207683_10083811
376 Ga0207683_10196284
377 Ga0268265_10115197
378 Ga0307515_10074795
379 Ga0307513_10275490
380 Ga0307514_10007631
381 Ga0307413_10341233
382 Ga0307518_10298123
383 Ga0307410_10479037
384 Ga0307410_10608284
385 Ga0307406_10627027
386 Ga0307407_10518006
387 Ga0307412_10560393
388 Ga0307412_10604703
389 Ga0307416_100156514
390 Ga0307414_11162723
391 Ga0307415_100530652
392 Ga0307415_100765507
393 Ga0307415_101018550
394 Ga0395899_0025867
395 Ga0395900_0087007
396 Ga0395900_0171141
397 Ga0436364_1394025
398 Ga0395901_0350133
399 Ga0395901_0616966
400 Ga0451791_0446943
401 Ga0451807_1635923
402 Ga0451835_1217232
403 Ga0439449_0025433
404 Ga0466969_0081586
405 Ga0466972_0070303
406 Ga0466965_0000011
407 Ga0466965_0065287
408 Ga0466965_0079894
409 Ga0466966_0227799
410 Ga0466966_0237641
411 Ga0466966_0237719
412 Ga0466966_0381218
413 Ga0466961_0166478
414 Ga0466961_0292695
415 Ga0466961_0414690
416 Ga0466961_0467782
417 Ga0466963_0429551
418 Ga0466970_0002053
419 Ga0466970_0041198
420 Ga0466970_0304816
421 Ga0466957_0086324
422 Ga0466960_0026620
423 Ga0466960_0051579
424 Ga0466960_0123727
425 Ga0466960_0326060
426 Ga0466959_0074243
427 Ga0466959_0257140
428 Ga0466958_0089402
429 Ga0466958_0389562
430 Ga0466958_0416675
431 Ga0466967_0082971
432 Ga0495590_0000570
433 Ga0495625_0103390
434 Ga0495672_0004033
435 Ga0495672_0055250
436 Ga0495686_0350841
437 Ga0496100_0319728
438 Ga0496102_0104472
439 Ga0496103_0151843
440 Ga0496104_0122097
441 Ga0496105_0453823
442 Ga0496107_0119543
443 Ga0496117_0000346
444 Ga0496117_0104450
445 Ga0496118_0019085
446 Ga0496118_0095254
447 Ga0496119_0053642
448 Ga0496119_0060765
449 Ga0496119_0067937
450 Ga0496120_0161588
451 Ga0496121_0042756
452 Ga0496122_0011750
453 Ga0496126_0003250
454 Ga0496126_0161324
455 Ga0496126_0782192
456 Ga0501031_0002184
457 Ga0501031_0205968
458 Ga0501031_0465375
459 Ga0501032_0007533
460 Ga0501032_0009167
461 Ga0501032_0029459
462 Ga0501032_0056560
463 Ga0501032_0317550
464 Ga0501033_0001609
465 Ga0501033_0003085
466 Ga0501033_0017688
467 Ga0501033_0029517
468 Ga0501033_0030987
469 Ga0501033_0046565
470 Ga0501033_0295298
471 Ga0501033_0310613
472 Ga0501033_0605573
473 Ga0501034_0003046
474 Ga0501034_0004861
475 Ga0501034_0033037
476 Ga0501034_0063947
477 Ga0501034_0089484
478 Ga0501034_0336066
479 Ga0501034_0352339
480 Ga0501034_0409776
481 Ga0501034_0842519
482 Ga0501034_0848922
483 Ga0501034_1083379
484 Ga0501036_0016832
485 Ga0501036_0060688
486 Ga0501036_0099321
487 Ga0501036_0132095
488 Ga0501036_0303794
489 Ga0501036_0504619
490 Ga0501037_0001224
491 Ga0501037_0037867
492 Ga0501037_0113729
493 Ga0501037_0196567
494 Ga0501037_0563633
495 Ga0501038_0001166
496 Ga0501038_0017804
497 Ga0501038_0057456
498 Ga0501038_0137446
499 Ga0501038_0327804
500 Ga0501039_0000287
501 Ga0501039_0019997
502 Ga0501039_0402891
503 Ga0501042_0002237
504 Ga0501043_0001056
505 Ga0501043_0013280
506 Ga0501043_0050338
507 Ga0501043_0089860
508 Ga0501043_0230609
509 Ga0501043_0493546
510 Ga0501046_0001394
511 Ga0501046_0006857
512 Ga0501046_0037843
513 Ga0501047_0024097
514 Ga0501047_0067844
515 Ga0501047_0116099
516 Ga0501047_0188289
517 Ga0501047_0193799
518 Ga0501047_0222719
519 Ga0501048_0005083
520 Ga0501048_0028020
521 Ga0501068_0072190
522 Ga0501068_0566687
523 Ga0501069_0027131
524 Ga0501070_0000100
525 Ga0501070_0004119
526 Ga0501070_0013695
527 Ga0501070_0041915
528 Ga0501070_0042669
529 Ga0501070_0063573
530 Ga0501070_0452639
531 Ga0501070_0703619
532 Ga0501071_0004915
533 Ga0501072_0697287
534 Ga0501073_0000087
535 Ga0501073_0063773
536 Ga0501073_0064604
537 Ga0501073_0506889
538 Ga0501074_0024343
539 Ga0501080_0000099
540 Ga0501080_0092715
541 Ga0501080_0219192
542 Ga0501080_0535183
543 Ga0501083_0000031
544 Ga0501083_0034216
545 Ga0501035_0004284
546 Ga0501035_0010479
547 Ga0501035_0020624
548 Ga0501035_0516622
549 Ga0501035_0608069
550 Ga0501044_0011666
551 Ga0501044_0037026
552 Ga0501044_0037274
553 Ga0501044_0153301
554 Ga0501044_0255875
555 Ga0501044_0345978
556 Ga0501044_0483443
557 Ga0501044_0641918
558 Ga0501044_0844989
559 Ga0501045_0249386
560 nmdc:mga00v17_17040_c1
561 nmdc:mga00v17_23031_c1
562 nmdc:mga0yw44_214213_c1
563 nmdc:mga07m45_257439_c1
564 Ga0500635_0000010
565 Ga0500643_001841
566 Ga0500650_0009704
567 Ga0500556_0000001
568 Ga0500556_0085215
569 Ga0500559_0000182
570 Ga0500559_0000443
571 Ga0500559_0026256
572 Ga0500568_0000698
573 Ga0500568_0001028
574 Ga0500573_0000091
575 Ga0500573_0006190
576 Ga0500573_0021895
577 Ga0500573_0338949
578 Ga0500577_0007027
579 Ga0500616_0000078
580 Ga0500616_0002208
581 Ga0500634_0231523
582 Ga0501084_0054097
583 Ga0466962_0057486
584 2585299937
585 2616697629
586 2643767928
587 2643944514
588 2644179418
589 2644198842
590 2644263284
591 2644280655
592 2644431412
593 2784588045
594 2785344031
595 2785368816
596 2808920047
597 2809231645
598 2811848433
599 2812481062
600 2819693492
601 2819742763
602 2844854801
603 2852645846
604 2857730096
605 2857740312
606 2862287895
607 2862295696
608 2862391317
609 2862511525
610 2862710165
611 2863405301
612 2877681697
613 2897564476
614 2912720660
615 2912724822
616 2918503995
617 2919446439
618 2928123321
619 2939658514
620 2939662648
621 2946033918
622 2947230127
623 2954386844
624 2954697663
625 2954704553
626 2966603107
627 2990065575
628 3006496344
629 8008559776
630 8008579369
631 8023631051
632 8033691434
633 8048413309
634 8056038929
635 8056830254
636 8057347890

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00929

RNase_T

Exonuclease

8

170

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6rcn-assembly1.cif.gz_A crystal structure of rexo2-d199a-dada 0.9675 4 181
6n6i-assembly2.cif.gz_B human rexo2 bound to pgg 0.964 4 183
6j7y-assembly1.cif.gz_B human mitochondrial oligoribonuclease in complex with dna 0.9624 6 183
6n6h-assembly1.cif.gz_A vibrio cholerae oligoribonuclease bound to pcpu 0.9606 1 180
6j80-assembly1.cif.gz_B human mitochondrial oligoribonuclease in complex with poly-dt dna 0.9596 1 181
ID Description Score Start End Superfamily
af_P9WIU1_1_181_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9805 5 183 3.30.420.10
af_Q556Y2_11_190_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9743 4 181 3.30.420.10
af_P9WIU1_1_181_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9645 5 183 3.30.420.10
af_A0A1D8PGG3_17_213_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9511 6 183 3.30.420.10
af_Q6K4V8_62_244_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.949 6 183 3.30.420.10
ID Description Score Start End GO Terms
AF-A0A074TLR7-F1-model_v4 deleted 0.9998 3 125
AF-A0A0R2QF95-F1-model_v4 Oligoribonuclease 0.9992 6 167 GO:0000175
GO:0003676
GO:0006259
AF-A0A6I3GJJ9-F1-model_v4 Oligoribonuclease (EC 3.1.-.-) 0.9986 6 146 GO:0000175
GO:0003676
GO:0006259
AF-A0A6B3FAP1-F1-model_v4 Oligoribonuclease (EC 3.1.-.-) 0.9983 9 139 GO:0000175
GO:0003676
GO:0006259
AF-A0A0K2RSA8-F1-model_v4 Oligoribonuclease 0.9963 6 104 GO:0003676
GO:0004527
GO:0006259

Map