F404730
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 318 | 191 | 636 | 204 |
Family's Representative Sequence
| Representative Sequence | 3300044656|Ga0466969_0142146|Ga0466969_0142146_254_895 |
| Length | 213 |
| Sequence | MAAADRLVWIDCEMTGLDLEVDELVEVAAVVTDFELNVLDPGFDIVIKPNDSALAQMGPVVRDMHTSSGLLEAMQHGVSLGEAEAKVLEYLQRFTAPGQAPIAGNTIGTDRSFLVRQMPRVDAHLHYRSIDVSSIKELVKRWFPRVYYNAPAKHGGHRALADILESIRELAYYRRTAFVAQPGPASDQAQAAAAEVVEAFTHSAVPKAGPALR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 2 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 3 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 4 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 11 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 14 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 16 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 17 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 18 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 19 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 20 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 21 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 22 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 23 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 24 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 25 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 26 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 27 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 28 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 29 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 30 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 31 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 32 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 33 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 34 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 35 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 36 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 37 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 38 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 39 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 40 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 41 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 52 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 53 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 54 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 55 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 56 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 57 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 58 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 59 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 60 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 61 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 62 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 63 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 64 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 65 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 66 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 67 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 68 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 69 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 70 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 71 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 72 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 73 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 74 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 75 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 76 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 77 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 78 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 79 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 80 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 81 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 82 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 83 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 84 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 85 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 86 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 87 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 88 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 89 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 90 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 91 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 92 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 93 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 94 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 95 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 96 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 97 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 98 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 99 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 100 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 101 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 102 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 103 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 104 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 105 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 106 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 107 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 108 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 109 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 110 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 111 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 112 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 113 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 114 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 115 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 116 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 117 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 118 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 119 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 120 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 121 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 122 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 123 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 124 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 125 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 126 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 127 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 128 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 129 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 130 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 131 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 132 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 133 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 134 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 135 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 136 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 137 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 138 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 139 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 140 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 141 | 2643221549 | Agromyces sp. Root1464 | Isolate | Unclassified |
| 142 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 143 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 144 | 2643221635 | Yonghaparkia sp. Root332 | Isolate | Unclassified |
| 145 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 146 | 2643221649 | Leifsonia sp. Root4 | Isolate | Unclassified |
| 147 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 148 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 149 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 150 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 151 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 152 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 153 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 154 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 155 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 156 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 157 | 2844852863 | Herbiconiux flava DSM 26474 | Isolate | Rhizosphere |
| 158 | 2852643534 | Leifsonia sp. AK011 | Isolate | Rhizosphere |
| 159 | 2857729791 | Plantibacter sp. R-72288 | Isolate | Unclassified |
| 160 | 2857737099 | Lysinimonas sp. R-73066 | Isolate | Unclassified |
| 161 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 162 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 163 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 164 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 165 | 2862705112 | Streptomyces triticirhizae NEAU-YY642 | Isolate | Rhizosphere |
| 166 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 167 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 168 | 2897561785 | Pseudoclavibacter endophyticus EGI 60007 | Isolate | Unclassified |
| 169 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 170 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 171 | 2918501144 | Streptomyces sp. PvR006 | Isolate | Rhizosphere |
| 172 | 2919443155 | Agromyces sp. 3263 | Isolate | Rhizosphere |
| 173 | 2928121344 | Plantibacter flavus 1756 | Isolate | Rhizosphere |
| 174 | 2939657138 | Conyzicola nivalis 2857 | Isolate | Rhizosphere |
| 175 | 2939660829 | Mycetocola sp. 2940 | Isolate | Rhizosphere |
| 176 | 2946033335 | Microbacterium sp. W4I4 | Isolate | Rhizosphere |
| 177 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 178 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 179 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 180 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 181 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 182 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 183 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 184 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 185 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 186 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 187 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
| 188 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 189 | 8056037122 | Herbiconiux gentiana CPCC 205716 | Isolate | Rhizosphere |
| 190 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
| 191 | 8057345674 | Herbiconiux aconitum CPCC 205763 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 82.39 |
| Metatranscriptomes | 0.94 |
| Isolates | 16.67 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.75 |
| Nodule | 0.63 |
| Rhizoplane | 2.52 |
| Rhizosphere | 72.33 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466969_0142146 | 3300044656 | Bacteria | 1109 |
| 2 | JGI25164J39214_1000526 | 3300002772 | Bacteria | 18052 |
| 3 | JGI25165J46597_1000002 | 3300003214 | Bacteria | 765387 |
| 4 | rootH1_10028941 | 3300003316 | Bacteria | 3082 |
| 5 | rootL2_10007353 | 3300003322 | Bacteria | 5395 |
| 6 | rootH1_10001567 | 3300003323 | Bacteria | 8915 |
| 7 | Ga0065714_10201961 | 3300005288 | Bacteria | 892 |
| 8 | Ga0070658_10013790 | 3300005327 | Bacteria | 6484 |
| 9 | Ga0070658_10075565 | 3300005327 | Bacteria | 2763 |
| 10 | Ga0070703_10087703 | 3300005406 | Bacteria | 1073 |
| 11 | Ga0070710_10037434 | 3300005437 | Bacteria | 2659 |
| 12 | Ga0070700_100497399 | 3300005441 | Bacteria | 937 |
| 13 | Ga0070663_100416909 | 3300005455 | Bacteria | 1101 |
| 14 | Ga0068857_100403684 | 3300005577 | Bacteria | 1272 |
| 15 | Ga0070702_100768051 | 3300005615 | Bacteria | 742 |
| 16 | Ga0068861_100270220 | 3300005719 | Bacteria | 1460 |
| 17 | Ga0068862_100052700 | 3300005844 | Bacteria | 3482 |
| 18 | Ga0068862_101208845 | 3300005844 | Bacteria | 755 |
| 19 | Ga0075365_10024866 | 3300006038 | Bacteria | 3785 |
| 20 | Ga0075365_10241607 | 3300006038 | Bacteria | 1268 |
| 21 | Ga0075369_10010014 | 3300006186 | Bacteria | 3702 |
| 22 | Ga0105244_10219632 | 3300009036 | Bacteria | 892 |
| 23 | Ga0111539_10975838 | 3300009094 | Bacteria | 985 |
| 24 | Ga0105245_10098166 | 3300009098 | Bacteria | 2706 |
| 25 | Ga0105243_10237477 | 3300009148 | Bacteria | 1620 |
| 26 | Ga0105249_10250105 | 3300009553 | Bacteria | 1757 |
| 27 | Ga0105239_10090532 | 3300010375 | Bacteria | 3375 |
| 28 | Ga0157369_10000618 | 3300013105 | Bacteria | 46223 |
| 29 | Ga0157369_10039094 | 3300013105 | Bacteria | 5186 |
| 30 | Ga0157369_10265481 | 3300013105 | Bacteria | 1790 |
| 31 | Ga0157374_10286691 | 3300013296 | Bacteria | 1627 |
| 32 | Ga0163162_11013163 | 3300013306 | Bacteria | 939 |
| 33 | Ga0157372_10023828 | 3300013307 | Bacteria | 6641 |
| 34 | Ga0157372_10400994 | 3300013307 | Bacteria | 1598 |
| 35 | Ga0157372_10849493 | 3300013307 | Bacteria | 1060 |
| 36 | Ga0163163_11229862 | 3300014325 | Bacteria | 811 |
| 37 | Ga0157380_10003895 | 3300014326 | Bacteria | 10292 |
| 38 | Ga0163161_10270160 | 3300017792 | Bacteria | 1330 |
| 39 | Ga0206354_10724876 | 3300020081 | Bacteria | 3014 |
| 40 | Ga0206353_10147215 | 3300020082 | Bacteria | 3209 |
| 41 | Ga0206353_10155678 | 3300020082 | Bacteria | 1478 |
| 42 | Ga0213875_10000983 | 3300021388 | Bacteria | 20379 |
| 43 | Ga0207427_100089 | 3300025231 | Bacteria | 135504 |
| 44 | Ga0209437_100592 | 3300025233 | Bacteria | 22827 |
| 45 | Ga0209677_103457 | 3300025253 | Bacteria | 5118 |
| 46 | Ga0209233_1000001 | 3300025261 | Bacteria | 2992747 |
| 47 | Ga0207692_10150633 | 3300025898 | Bacteria | 1332 |
| 48 | Ga0207647_10029529 | 3300025904 | Bacteria | 3547 |
| 49 | Ga0207643_10050686 | 3300025908 | Bacteria | 2354 |
| 50 | Ga0207705_10172122 | 3300025909 | Bacteria | 1631 |
| 51 | Ga0207659_10126343 | 3300025926 | Bacteria | 1967 |
| 52 | Ga0207700_10540512 | 3300025928 | Bacteria | 1033 |
| 53 | Ga0207709_10036857 | 3300025935 | Bacteria | 2901 |
| 54 | Ga0207679_10976522 | 3300025945 | Bacteria | 776 |
| 55 | Ga0207712_10507207 | 3300025961 | Bacteria | 1032 |
| 56 | Ga0207678_10538818 | 3300026067 | Bacteria | 1020 |
| 57 | Ga0207683_10083811 | 3300026121 | Bacteria | 2833 |
| 58 | Ga0207683_10196284 | 3300026121 | Bacteria | 1834 |
| 59 | Ga0268265_10115197 | 3300028380 | Bacteria | 2203 |
| 60 | Ga0307515_10074795 | 3300028794 | Bacteria | 4524 |
| 61 | Ga0307513_10275490 | 3300031456 | Bacteria | 1463 |
| 62 | Ga0307514_10007631 | 3300031649 | Bacteria | 9316 |
| 63 | Ga0307413_10341233 | 3300031824 | Bacteria | 1152 |
| 64 | Ga0307518_10298123 | 3300031838 | Bacteria | 982 |
| 65 | Ga0307410_10479037 | 3300031852 | Bacteria | 1020 |
| 66 | Ga0307410_10608284 | 3300031852 | Bacteria | 912 |
| 67 | Ga0307406_10627027 | 3300031901 | Bacteria | 890 |
| 68 | Ga0307407_10518006 | 3300031903 | Bacteria | 877 |
| 69 | Ga0307412_10560393 | 3300031911 | Bacteria | 961 |
| 70 | Ga0307412_10604703 | 3300031911 | Bacteria | 929 |
| 71 | Ga0307416_100156514 | 3300032002 | Bacteria | 2099 |
| 72 | Ga0307414_11162723 | 3300032004 | Bacteria | 714 |
| 73 | Ga0307415_100530652 | 3300032126 | Bacteria | 1035 |
| 74 | Ga0307415_100765507 | 3300032126 | Bacteria | 878 |
| 75 | Ga0307415_101018550 | 3300032126 | Bacteria | 771 |
| 76 | Ga0395899_0025867 | 3300037312 | Bacteria | 4430 |
| 77 | Ga0395900_0087007 | 3300037418 | Bacteria | 3212 |
| 78 | Ga0395900_0171141 | 3300037418 | Bacteria | 2211 |
| 79 | Ga0436364_1394025 | 3300037853 | Bacteria | 7623 |
| 80 | Ga0395901_0350133 | 3300038443 | Bacteria | 1524 |
| 81 | Ga0395901_0616966 | 3300038443 | Bacteria | 1092 |
| 82 | Ga0451791_0446943 | 3300041451 | Bacteria | 1130 |
| 83 | Ga0451807_1635923 | 3300041486 | Bacteria | 1080 |
| 84 | Ga0451835_1217232 | 3300041492 | Bacteria | 756 |
| 85 | Ga0439449_0025433 | 3300042007 | Bacteria | 2213 |
| 86 | Ga0466969_0081586 | 3300044656 | Bacteria | 1543 |
| 87 | Ga0466972_0070303 | 3300044658 | Bacteria | 1670 |
| 88 | Ga0466965_0000011 | 3300044683 | Bacteria | 107319 |
| 89 | Ga0466965_0065287 | 3300044683 | Bacteria | 1823 |
| 90 | Ga0466965_0079894 | 3300044683 | Bacteria | 1652 |
| 91 | Ga0466966_0227799 | 3300044684 | Bacteria | 1125 |
| 92 | Ga0466966_0237641 | 3300044684 | Bacteria | 1099 |
| 93 | Ga0466966_0237719 | 3300044684 | Bacteria | 1098 |
| 94 | Ga0466966_0381218 | 3300044684 | Bacteria | 847 |
| 95 | Ga0466961_0166478 | 3300044693 | Bacteria | 1372 |
| 96 | Ga0466961_0292695 | 3300044693 | Bacteria | 995 |
| 97 | Ga0466961_0414690 | 3300044693 | Bacteria | 816 |
| 98 | Ga0466961_0467782 | 3300044693 | Bacteria | 762 |
| 99 | Ga0466963_0429551 | 3300044694 | Bacteria | 932 |
| 100 | Ga0466970_0002053 | 3300044765 | Bacteria | 9741 |
| 101 | Ga0466970_0041198 | 3300044765 | Bacteria | 2453 |
| 102 | Ga0466970_0304816 | 3300044765 | Bacteria | 899 |
| 103 | Ga0466957_0086324 | 3300044842 | Bacteria | 1961 |
| 104 | Ga0466960_0026620 | 3300044901 | Bacteria | 2629 |
| 105 | Ga0466960_0051579 | 3300044901 | Bacteria | 1988 |
| 106 | Ga0466960_0123727 | 3300044901 | Bacteria | 1357 |
| 107 | Ga0466960_0326060 | 3300044901 | Bacteria | 871 |
| 108 | Ga0466959_0074243 | 3300045049 | Bacteria | 2459 |
| 109 | Ga0466959_0257140 | 3300045049 | Bacteria | 1203 |
| 110 | Ga0466958_0089402 | 3300045836 | Bacteria | 1904 |
| 111 | Ga0466958_0389562 | 3300045836 | Bacteria | 899 |
| 112 | Ga0466958_0416675 | 3300045836 | Bacteria | 868 |
| 113 | Ga0466967_0082971 | 3300045976 | Bacteria | 2898 |
| 114 | Ga0495590_0000570 | 3300046457 | Bacteria | 17483 |
| 115 | Ga0495625_0103390 | 3300046660 | Bacteria | 1954 |
| 116 | Ga0495672_0004033 | 3300047320 | Bacteria | 12274 |
| 117 | Ga0495672_0055250 | 3300047320 | Bacteria | 2318 |
| 118 | Ga0495686_0350841 | 3300047472 | Bacteria | 802 |
| 119 | Ga0496100_0319728 | 3300048903 | Bacteria | 1165 |
| 120 | Ga0496102_0104472 | 3300048905 | Bacteria | 2635 |
| 121 | Ga0496103_0151843 | 3300048906 | Bacteria | 1484 |
| 122 | Ga0496104_0122097 | 3300048907 | Bacteria | 2501 |
| 123 | Ga0496105_0453823 | 3300048908 | Bacteria | 1011 |
| 124 | Ga0496107_0119543 | 3300048910 | Bacteria | 1941 |
| 125 | Ga0496117_0000346 | 3300048920 | Bacteria | 81937 |
| 126 | Ga0496117_0104450 | 3300048920 | Bacteria | 1783 |
| 127 | Ga0496118_0019085 | 3300048921 | Bacteria | 6144 |
| 128 | Ga0496118_0095254 | 3300048921 | Bacteria | 2033 |
| 129 | Ga0496119_0053642 | 3300048922 | Bacteria | 2461 |
| 130 | Ga0496119_0060765 | 3300048922 | Bacteria | 2260 |
| 131 | Ga0496119_0067937 | 3300048922 | Bacteria | 2100 |
| 132 | Ga0496120_0161588 | 3300048923 | Bacteria | 1116 |
| 133 | Ga0496121_0042756 | 3300048924 | Bacteria | 3936 |
| 134 | Ga0496122_0011750 | 3300048925 | Bacteria | 8822 |
| 135 | Ga0496126_0003250 | 3300048929 | Bacteria | 20771 |
| 136 | Ga0496126_0161324 | 3300048929 | Bacteria | 1915 |
| 137 | Ga0496126_0782192 | 3300048929 | Bacteria | 734 |
| 138 | Ga0501031_0002184 | 3300049568 | Bacteria | 12353 |
| 139 | Ga0501031_0205968 | 3300049568 | Bacteria | 1283 |
| 140 | Ga0501031_0465375 | 3300049568 | Bacteria | 816 |
| 141 | Ga0501032_0007533 | 3300049569 | Bacteria | 7953 |
| 142 | Ga0501032_0009167 | 3300049569 | Bacteria | 7177 |
| 143 | Ga0501032_0029459 | 3300049569 | Bacteria | 3766 |
| 144 | Ga0501032_0056560 | 3300049569 | Bacteria | 2637 |
| 145 | Ga0501032_0317550 | 3300049569 | Bacteria | 1006 |
| 146 | Ga0501033_0001609 | 3300049570 | Bacteria | 19839 |
| 147 | Ga0501033_0003085 | 3300049570 | Bacteria | 13845 |
| 148 | Ga0501033_0017688 | 3300049570 | Bacteria | 5384 |
| 149 | Ga0501033_0029517 | 3300049570 | Bacteria | 4121 |
| 150 | Ga0501033_0030987 | 3300049570 | Bacteria | 4019 |
| 151 | Ga0501033_0046565 | 3300049570 | Bacteria | 3224 |
| 152 | Ga0501033_0295298 | 3300049570 | Bacteria | 1142 |
| 153 | Ga0501033_0310613 | 3300049570 | Bacteria | 1108 |
| 154 | Ga0501033_0605573 | 3300049570 | Bacteria | 751 |
| 155 | Ga0501034_0003046 | 3300049571 | Bacteria | 19382 |
| 156 | Ga0501034_0004861 | 3300049571 | Bacteria | 14823 |
| 157 | Ga0501034_0033037 | 3300049571 | Bacteria | 5253 |
| 158 | Ga0501034_0063947 | 3300049571 | Bacteria | 3693 |
| 159 | Ga0501034_0089484 | 3300049571 | Bacteria | 3076 |
| 160 | Ga0501034_0336066 | 3300049571 | Bacteria | 1441 |
| 161 | Ga0501034_0352339 | 3300049571 | Bacteria | 1400 |
| 162 | Ga0501034_0409776 | 3300049571 | Bacteria | 1277 |
| 163 | Ga0501034_0842519 | 3300049571 | Bacteria | 807 |
| 164 | Ga0501034_0848922 | 3300049571 | Bacteria | 803 |
| 165 | Ga0501034_1083379 | 3300049571 | Bacteria | 683 |
| 166 | Ga0501036_0016832 | 3300049572 | Bacteria | 6107 |
| 167 | Ga0501036_0060688 | 3300049572 | Bacteria | 3203 |
| 168 | Ga0501036_0099321 | 3300049572 | Bacteria | 2461 |
| 169 | Ga0501036_0132095 | 3300049572 | Bacteria | 2107 |
| 170 | Ga0501036_0303794 | 3300049572 | Bacteria | 1334 |
| 171 | Ga0501036_0504619 | 3300049572 | Bacteria | 1006 |
| 172 | Ga0501037_0001224 | 3300049573 | Bacteria | 18952 |
| 173 | Ga0501037_0037867 | 3300049573 | Bacteria | 3555 |
| 174 | Ga0501037_0113729 | 3300049573 | Bacteria | 1948 |
| 175 | Ga0501037_0196567 | 3300049573 | Bacteria | 1426 |
| 176 | Ga0501037_0563633 | 3300049573 | Bacteria | 768 |
| 177 | Ga0501038_0001166 | 3300049574 | Bacteria | 23863 |
| 178 | Ga0501038_0017804 | 3300049574 | Bacteria | 6419 |
| 179 | Ga0501038_0057456 | 3300049574 | Bacteria | 3341 |
| 180 | Ga0501038_0137446 | 3300049574 | Bacteria | 2001 |
| 181 | Ga0501038_0327804 | 3300049574 | Bacteria | 1196 |
| 182 | Ga0501039_0000287 | 3300049575 | Bacteria | 35995 |
| 183 | Ga0501039_0019997 | 3300049575 | Bacteria | 5132 |
| 184 | Ga0501039_0402891 | 3300049575 | Bacteria | 1074 |
| 185 | Ga0501042_0002237 | 3300049578 | Bacteria | 11809 |
| 186 | Ga0501043_0001056 | 3300049579 | Bacteria | 24194 |
| 187 | Ga0501043_0013280 | 3300049579 | Bacteria | 6439 |
| 188 | Ga0501043_0050338 | 3300049579 | Bacteria | 3274 |
| 189 | Ga0501043_0089860 | 3300049579 | Bacteria | 2414 |
| 190 | Ga0501043_0230609 | 3300049579 | Bacteria | 1430 |
| 191 | Ga0501043_0493546 | 3300049579 | Bacteria | 915 |
| 192 | Ga0501046_0001394 | 3300049580 | Bacteria | 23269 |
| 193 | Ga0501046_0006857 | 3300049580 | Bacteria | 10049 |
| 194 | Ga0501046_0037843 | 3300049580 | Bacteria | 3875 |
| 195 | Ga0501047_0024097 | 3300049581 | Bacteria | 5845 |
| 196 | Ga0501047_0067844 | 3300049581 | Bacteria | 3436 |
| 197 | Ga0501047_0116099 | 3300049581 | Bacteria | 2558 |
| 198 | Ga0501047_0188289 | 3300049581 | Bacteria | 1928 |
| 199 | Ga0501047_0193799 | 3300049581 | Bacteria | 1895 |
| 200 | Ga0501047_0222719 | 3300049581 | Bacteria | 1742 |
| 201 | Ga0501048_0005083 | 3300049582 | Bacteria | 10016 |
| 202 | Ga0501048_0028020 | 3300049582 | Bacteria | 4091 |
| 203 | Ga0501068_0072190 | 3300049584 | Bacteria | 2108 |
| 204 | Ga0501068_0566687 | 3300049584 | Bacteria | 739 |
| 205 | Ga0501069_0027131 | 3300049585 | Bacteria | 3138 |
| 206 | Ga0501070_0000100 | 3300049586 | Bacteria | 75001 |
| 207 | Ga0501070_0004119 | 3300049586 | Bacteria | 12505 |
| 208 | Ga0501070_0013695 | 3300049586 | Bacteria | 6831 |
| 209 | Ga0501070_0041915 | 3300049586 | Bacteria | 3812 |
| 210 | Ga0501070_0042669 | 3300049586 | Bacteria | 3778 |
| 211 | Ga0501070_0063573 | 3300049586 | Bacteria | 3057 |
| 212 | Ga0501070_0452639 | 3300049586 | Bacteria | 1035 |
| 213 | Ga0501070_0703619 | 3300049586 | Bacteria | 799 |
| 214 | Ga0501071_0004915 | 3300049587 | Bacteria | 8527 |
| 215 | Ga0501072_0697287 | 3300049588 | Bacteria | 798 |
| 216 | Ga0501073_0000087 | 3300049589 | Bacteria | 58557 |
| 217 | Ga0501073_0063773 | 3300049589 | Bacteria | 2569 |
| 218 | Ga0501073_0064604 | 3300049589 | Bacteria | 2553 |
| 219 | Ga0501073_0506889 | 3300049589 | Bacteria | 834 |
| 220 | Ga0501074_0024343 | 3300049590 | Bacteria | 4400 |
| 221 | Ga0501080_0000099 | 3300049742 | Bacteria | 59060 |
| 222 | Ga0501080_0092715 | 3300049742 | Bacteria | 2805 |
| 223 | Ga0501080_0219192 | 3300049742 | Bacteria | 1741 |
| 224 | Ga0501080_0535183 | 3300049742 | Bacteria | 1044 |
| 225 | Ga0501083_0000031 | 3300049744 | Bacteria | 104819 |
| 226 | Ga0501083_0034216 | 3300049744 | Bacteria | 3475 |
| 227 | Ga0501035_0004284 | 3300049822 | Bacteria | 13546 |
| 228 | Ga0501035_0010479 | 3300049822 | Bacteria | 8590 |
| 229 | Ga0501035_0020624 | 3300049822 | Bacteria | 6053 |
| 230 | Ga0501035_0516622 | 3300049822 | Bacteria | 981 |
| 231 | Ga0501035_0608069 | 3300049822 | Bacteria | 890 |
| 232 | Ga0501044_0011666 | 3300049823 | Bacteria | 9523 |
| 233 | Ga0501044_0037026 | 3300049823 | Bacteria | 5102 |
| 234 | Ga0501044_0037274 | 3300049823 | Bacteria | 5083 |
| 235 | Ga0501044_0153301 | 3300049823 | Bacteria | 2285 |
| 236 | Ga0501044_0255875 | 3300049823 | Bacteria | 1690 |
| 237 | Ga0501044_0345978 | 3300049823 | Bacteria | 1407 |
| 238 | Ga0501044_0483443 | 3300049823 | Bacteria | 1141 |
| 239 | Ga0501044_0641918 | 3300049823 | Bacteria | 951 |
| 240 | Ga0501044_0844989 | 3300049823 | Bacteria | 792 |
| 241 | Ga0501045_0249386 | 3300049824 | Bacteria | 1322 |
| 242 | nmdc:mga00v17_17040_c1 | 3300050491 | Bacteria | 4103 |
| 243 | nmdc:mga00v17_23031_c1 | 3300050491 | Bacteria | 3600 |
| 244 | nmdc:mga0yw44_214213_c1 | 3300050492 | Bacteria | 1275 |
| 245 | nmdc:mga07m45_257439_c1 | 3300050496 | Bacteria | 1015 |
| 246 | Ga0500635_0000010 | 3300053080 | Bacteria | 147500 |
| 247 | Ga0500643_001841 | 3300053087 | Bacteria | 11595 |
| 248 | Ga0500650_0009704 | 3300053098 | Bacteria | 3876 |
| 249 | Ga0500556_0000001 | 3300053104 | Bacteria | 1135060 |
| 250 | Ga0500556_0085215 | 3300053104 | Bacteria | 1200 |
| 251 | Ga0500559_0000182 | 3300053136 | Bacteria | 49814 |
| 252 | Ga0500559_0000443 | 3300053136 | Bacteria | 29438 |
| 253 | Ga0500559_0026256 | 3300053136 | Bacteria | 2480 |
| 254 | Ga0500568_0000698 | 3300053139 | Bacteria | 24073 |
| 255 | Ga0500568_0001028 | 3300053139 | Bacteria | 19099 |
| 256 | Ga0500573_0000091 | 3300053140 | Bacteria | 41183 |
| 257 | Ga0500573_0006190 | 3300053140 | Bacteria | 6454 |
| 258 | Ga0500573_0021895 | 3300053140 | Bacteria | 3667 |
| 259 | Ga0500573_0338949 | 3300053140 | Bacteria | 735 |
| 260 | Ga0500577_0007027 | 3300053142 | Bacteria | 3137 |
| 261 | Ga0500616_0000078 | 3300053153 | Bacteria | 202009 |
| 262 | Ga0500616_0002208 | 3300053153 | Bacteria | 16677 |
| 263 | Ga0500634_0231523 | 3300053161 | Bacteria | 784 |
| 264 | Ga0501084_0054097 | 3300054114 | Bacteria | 3357 |
| 265 | Ga0466962_0057486 | 3300061719 | Bacteria | 1857 |
| 266 | 2585299937 | 2582581312 | Bacteria | 7308206 |
| 267 | 2616697629 | 2616644814 | Bacteria | 11555299 |
| 268 | 2643767928 | 2643221549 | Bacteria | 4042819 |
| 269 | 2643944514 | 2643221587 | Bacteria | 7586415 |
| 270 | 2644179418 | 2643221631 | Bacteria | 8168043 |
| 271 | 2644198842 | 2643221635 | Bacteria | 2632343 |
| 272 | 2644263284 | 2643221647 | Bacteria | 10741251 |
| 273 | 2644280655 | 2643221649 | Bacteria | 3867359 |
| 274 | 2644431412 | 2643221677 | Bacteria | 7584031 |
| 275 | 2784588045 | 2784132148 | Bacteria | 8627943 |
| 276 | 2785344031 | 2784746763 | Bacteria | 9783172 |
| 277 | 2785368816 | 2784746768 | Bacteria | 10036182 |
| 278 | 2808920047 | 2808606375 | Bacteria | 9466072 |
| 279 | 2809231645 | 2808606448 | Bacteria | 8656184 |
| 280 | 2811848433 | 2808606982 | Bacteria | 7791042 |
| 281 | 2812481062 | 2811994917 | Bacteria | 7761064 |
| 282 | 2819693492 | 2818991463 | Bacteria | 7948711 |
| 283 | 2819742763 | 2818991472 | Bacteria | 10089953 |
| 284 | 2844854801 | 2844852863 | Bacteria | 3849151 |
| 285 | 2852645846 | 2852643534 | Bacteria | 3013378 |
| 286 | 2857730096 | 2857729791 | Bacteria | 4040535 |
| 287 | 2857740312 | 2857737099 | Bacteria | 3104305 |
| 288 | 2862287895 | 2862281513 | Bacteria | 9621493 |
| 289 | 2862295696 | 2862290372 | Bacteria | 7471434 |
| 290 | 2862391317 | 2862382967 | Bacteria | 10317375 |
| 291 | 2862511525 | 2862507626 | Bacteria | 9425308 |
| 292 | 2862710165 | 2862705112 | Bacteria | 6563286 |
| 293 | 2863405301 | 2863404153 | Bacteria | 9672205 |
| 294 | 2877681697 | 2877676314 | Bacteria | 9512378 |
| 295 | 2897564476 | 2897561785 | Bacteria | 3256946 |
| 296 | 2912720660 | 2912715099 | Bacteria | 9460473 |
| 297 | 2912724822 | 2912723979 | Bacteria | 8557534 |
| 298 | 2918503995 | 2918501144 | Bacteria | 8668083 |
| 299 | 2919446439 | 2919443155 | Bacteria | 4072969 |
| 300 | 2928123321 | 2928121344 | Bacteria | 3972376 |
| 301 | 2939658514 | 2939657138 | Bacteria | 3740283 |
| 302 | 2939662648 | 2939660829 | Bacteria | 3784848 |
| 303 | 2946033918 | 2946033335 | Bacteria | 3835514 |
| 304 | 2947230127 | 2947224130 | Bacteria | 9938529 |
| 305 | 2954386844 | 2954380949 | Bacteria | 10050426 |
| 306 | 2954697663 | 2954691527 | Bacteria | 10720516 |
| 307 | 2954704553 | 2954701450 | Bacteria | 10834262 |
| 308 | 2966603107 | 2966598605 | Bacteria | 7676064 |
| 309 | 2990065575 | 2990059506 | Bacteria | 9321252 |
| 310 | 3006496344 | 3006493962 | Bacteria | 8825450 |
| 311 | 8008559776 | 8008558824 | Bacteria | 10610750 |
| 312 | 8008579369 | 8008574985 | Bacteria | 7815457 |
| 313 | 8023631051 | 8023623736 | Bacteria | 8593882 |
| 314 | 8033691434 | 8033684223 | Bacteria | 6906479 |
| 315 | 8048413309 | 8048406513 | Bacteria | 8936924 |
| 316 | 8056038929 | 8056037122 | Bacteria | 3854319 |
| 317 | 8056830254 | 8056829672 | Bacteria | 9045328 |
| 318 | 8057347890 | 8057345674 | Bacteria | 4160394 |
| 319 | Ga0466969_0142146 | |||
| 320 | JGI25164J39214_1000526 | |||
| 321 | JGI25165J46597_1000002 | |||
| 322 | rootH1_10028941 | |||
| 323 | rootL2_10007353 | |||
| 324 | rootH1_10001567 | |||
| 325 | Ga0065714_10201961 | |||
| 326 | Ga0070658_10013790 | |||
| 327 | Ga0070658_10075565 | |||
| 328 | Ga0070703_10087703 | |||
| 329 | Ga0070710_10037434 | |||
| 330 | Ga0070700_100497399 | |||
| 331 | Ga0070663_100416909 | |||
| 332 | Ga0068857_100403684 | |||
| 333 | Ga0070702_100768051 | |||
| 334 | Ga0068861_100270220 | |||
| 335 | Ga0068862_100052700 | |||
| 336 | Ga0068862_101208845 | |||
| 337 | Ga0075365_10024866 | |||
| 338 | Ga0075365_10241607 | |||
| 339 | Ga0075369_10010014 | |||
| 340 | Ga0105244_10219632 | |||
| 341 | Ga0111539_10975838 | |||
| 342 | Ga0105245_10098166 | |||
| 343 | Ga0105243_10237477 | |||
| 344 | Ga0105249_10250105 | |||
| 345 | Ga0105239_10090532 | |||
| 346 | Ga0157369_10000618 | |||
| 347 | Ga0157369_10039094 | |||
| 348 | Ga0157369_10265481 | |||
| 349 | Ga0157374_10286691 | |||
| 350 | Ga0163162_11013163 | |||
| 351 | Ga0157372_10023828 | |||
| 352 | Ga0157372_10400994 | |||
| 353 | Ga0157372_10849493 | |||
| 354 | Ga0163163_11229862 | |||
| 355 | Ga0157380_10003895 | |||
| 356 | Ga0163161_10270160 | |||
| 357 | Ga0206354_10724876 | |||
| 358 | Ga0206353_10147215 | |||
| 359 | Ga0206353_10155678 | |||
| 360 | Ga0213875_10000983 | |||
| 361 | Ga0207427_100089 | |||
| 362 | Ga0209437_100592 | |||
| 363 | Ga0209677_103457 | |||
| 364 | Ga0209233_1000001 | |||
| 365 | Ga0207692_10150633 | |||
| 366 | Ga0207647_10029529 | |||
| 367 | Ga0207643_10050686 | |||
| 368 | Ga0207705_10172122 | |||
| 369 | Ga0207659_10126343 | |||
| 370 | Ga0207700_10540512 | |||
| 371 | Ga0207709_10036857 | |||
| 372 | Ga0207679_10976522 | |||
| 373 | Ga0207712_10507207 | |||
| 374 | Ga0207678_10538818 | |||
| 375 | Ga0207683_10083811 | |||
| 376 | Ga0207683_10196284 | |||
| 377 | Ga0268265_10115197 | |||
| 378 | Ga0307515_10074795 | |||
| 379 | Ga0307513_10275490 | |||
| 380 | Ga0307514_10007631 | |||
| 381 | Ga0307413_10341233 | |||
| 382 | Ga0307518_10298123 | |||
| 383 | Ga0307410_10479037 | |||
| 384 | Ga0307410_10608284 | |||
| 385 | Ga0307406_10627027 | |||
| 386 | Ga0307407_10518006 | |||
| 387 | Ga0307412_10560393 | |||
| 388 | Ga0307412_10604703 | |||
| 389 | Ga0307416_100156514 | |||
| 390 | Ga0307414_11162723 | |||
| 391 | Ga0307415_100530652 | |||
| 392 | Ga0307415_100765507 | |||
| 393 | Ga0307415_101018550 | |||
| 394 | Ga0395899_0025867 | |||
| 395 | Ga0395900_0087007 | |||
| 396 | Ga0395900_0171141 | |||
| 397 | Ga0436364_1394025 | |||
| 398 | Ga0395901_0350133 | |||
| 399 | Ga0395901_0616966 | |||
| 400 | Ga0451791_0446943 | |||
| 401 | Ga0451807_1635923 | |||
| 402 | Ga0451835_1217232 | |||
| 403 | Ga0439449_0025433 | |||
| 404 | Ga0466969_0081586 | |||
| 405 | Ga0466972_0070303 | |||
| 406 | Ga0466965_0000011 | |||
| 407 | Ga0466965_0065287 | |||
| 408 | Ga0466965_0079894 | |||
| 409 | Ga0466966_0227799 | |||
| 410 | Ga0466966_0237641 | |||
| 411 | Ga0466966_0237719 | |||
| 412 | Ga0466966_0381218 | |||
| 413 | Ga0466961_0166478 | |||
| 414 | Ga0466961_0292695 | |||
| 415 | Ga0466961_0414690 | |||
| 416 | Ga0466961_0467782 | |||
| 417 | Ga0466963_0429551 | |||
| 418 | Ga0466970_0002053 | |||
| 419 | Ga0466970_0041198 | |||
| 420 | Ga0466970_0304816 | |||
| 421 | Ga0466957_0086324 | |||
| 422 | Ga0466960_0026620 | |||
| 423 | Ga0466960_0051579 | |||
| 424 | Ga0466960_0123727 | |||
| 425 | Ga0466960_0326060 | |||
| 426 | Ga0466959_0074243 | |||
| 427 | Ga0466959_0257140 | |||
| 428 | Ga0466958_0089402 | |||
| 429 | Ga0466958_0389562 | |||
| 430 | Ga0466958_0416675 | |||
| 431 | Ga0466967_0082971 | |||
| 432 | Ga0495590_0000570 | |||
| 433 | Ga0495625_0103390 | |||
| 434 | Ga0495672_0004033 | |||
| 435 | Ga0495672_0055250 | |||
| 436 | Ga0495686_0350841 | |||
| 437 | Ga0496100_0319728 | |||
| 438 | Ga0496102_0104472 | |||
| 439 | Ga0496103_0151843 | |||
| 440 | Ga0496104_0122097 | |||
| 441 | Ga0496105_0453823 | |||
| 442 | Ga0496107_0119543 | |||
| 443 | Ga0496117_0000346 | |||
| 444 | Ga0496117_0104450 | |||
| 445 | Ga0496118_0019085 | |||
| 446 | Ga0496118_0095254 | |||
| 447 | Ga0496119_0053642 | |||
| 448 | Ga0496119_0060765 | |||
| 449 | Ga0496119_0067937 | |||
| 450 | Ga0496120_0161588 | |||
| 451 | Ga0496121_0042756 | |||
| 452 | Ga0496122_0011750 | |||
| 453 | Ga0496126_0003250 | |||
| 454 | Ga0496126_0161324 | |||
| 455 | Ga0496126_0782192 | |||
| 456 | Ga0501031_0002184 | |||
| 457 | Ga0501031_0205968 | |||
| 458 | Ga0501031_0465375 | |||
| 459 | Ga0501032_0007533 | |||
| 460 | Ga0501032_0009167 | |||
| 461 | Ga0501032_0029459 | |||
| 462 | Ga0501032_0056560 | |||
| 463 | Ga0501032_0317550 | |||
| 464 | Ga0501033_0001609 | |||
| 465 | Ga0501033_0003085 | |||
| 466 | Ga0501033_0017688 | |||
| 467 | Ga0501033_0029517 | |||
| 468 | Ga0501033_0030987 | |||
| 469 | Ga0501033_0046565 | |||
| 470 | Ga0501033_0295298 | |||
| 471 | Ga0501033_0310613 | |||
| 472 | Ga0501033_0605573 | |||
| 473 | Ga0501034_0003046 | |||
| 474 | Ga0501034_0004861 | |||
| 475 | Ga0501034_0033037 | |||
| 476 | Ga0501034_0063947 | |||
| 477 | Ga0501034_0089484 | |||
| 478 | Ga0501034_0336066 | |||
| 479 | Ga0501034_0352339 | |||
| 480 | Ga0501034_0409776 | |||
| 481 | Ga0501034_0842519 | |||
| 482 | Ga0501034_0848922 | |||
| 483 | Ga0501034_1083379 | |||
| 484 | Ga0501036_0016832 | |||
| 485 | Ga0501036_0060688 | |||
| 486 | Ga0501036_0099321 | |||
| 487 | Ga0501036_0132095 | |||
| 488 | Ga0501036_0303794 | |||
| 489 | Ga0501036_0504619 | |||
| 490 | Ga0501037_0001224 | |||
| 491 | Ga0501037_0037867 | |||
| 492 | Ga0501037_0113729 | |||
| 493 | Ga0501037_0196567 | |||
| 494 | Ga0501037_0563633 | |||
| 495 | Ga0501038_0001166 | |||
| 496 | Ga0501038_0017804 | |||
| 497 | Ga0501038_0057456 | |||
| 498 | Ga0501038_0137446 | |||
| 499 | Ga0501038_0327804 | |||
| 500 | Ga0501039_0000287 | |||
| 501 | Ga0501039_0019997 | |||
| 502 | Ga0501039_0402891 | |||
| 503 | Ga0501042_0002237 | |||
| 504 | Ga0501043_0001056 | |||
| 505 | Ga0501043_0013280 | |||
| 506 | Ga0501043_0050338 | |||
| 507 | Ga0501043_0089860 | |||
| 508 | Ga0501043_0230609 | |||
| 509 | Ga0501043_0493546 | |||
| 510 | Ga0501046_0001394 | |||
| 511 | Ga0501046_0006857 | |||
| 512 | Ga0501046_0037843 | |||
| 513 | Ga0501047_0024097 | |||
| 514 | Ga0501047_0067844 | |||
| 515 | Ga0501047_0116099 | |||
| 516 | Ga0501047_0188289 | |||
| 517 | Ga0501047_0193799 | |||
| 518 | Ga0501047_0222719 | |||
| 519 | Ga0501048_0005083 | |||
| 520 | Ga0501048_0028020 | |||
| 521 | Ga0501068_0072190 | |||
| 522 | Ga0501068_0566687 | |||
| 523 | Ga0501069_0027131 | |||
| 524 | Ga0501070_0000100 | |||
| 525 | Ga0501070_0004119 | |||
| 526 | Ga0501070_0013695 | |||
| 527 | Ga0501070_0041915 | |||
| 528 | Ga0501070_0042669 | |||
| 529 | Ga0501070_0063573 | |||
| 530 | Ga0501070_0452639 | |||
| 531 | Ga0501070_0703619 | |||
| 532 | Ga0501071_0004915 | |||
| 533 | Ga0501072_0697287 | |||
| 534 | Ga0501073_0000087 | |||
| 535 | Ga0501073_0063773 | |||
| 536 | Ga0501073_0064604 | |||
| 537 | Ga0501073_0506889 | |||
| 538 | Ga0501074_0024343 | |||
| 539 | Ga0501080_0000099 | |||
| 540 | Ga0501080_0092715 | |||
| 541 | Ga0501080_0219192 | |||
| 542 | Ga0501080_0535183 | |||
| 543 | Ga0501083_0000031 | |||
| 544 | Ga0501083_0034216 | |||
| 545 | Ga0501035_0004284 | |||
| 546 | Ga0501035_0010479 | |||
| 547 | Ga0501035_0020624 | |||
| 548 | Ga0501035_0516622 | |||
| 549 | Ga0501035_0608069 | |||
| 550 | Ga0501044_0011666 | |||
| 551 | Ga0501044_0037026 | |||
| 552 | Ga0501044_0037274 | |||
| 553 | Ga0501044_0153301 | |||
| 554 | Ga0501044_0255875 | |||
| 555 | Ga0501044_0345978 | |||
| 556 | Ga0501044_0483443 | |||
| 557 | Ga0501044_0641918 | |||
| 558 | Ga0501044_0844989 | |||
| 559 | Ga0501045_0249386 | |||
| 560 | nmdc:mga00v17_17040_c1 | |||
| 561 | nmdc:mga00v17_23031_c1 | |||
| 562 | nmdc:mga0yw44_214213_c1 | |||
| 563 | nmdc:mga07m45_257439_c1 | |||
| 564 | Ga0500635_0000010 | |||
| 565 | Ga0500643_001841 | |||
| 566 | Ga0500650_0009704 | |||
| 567 | Ga0500556_0000001 | |||
| 568 | Ga0500556_0085215 | |||
| 569 | Ga0500559_0000182 | |||
| 570 | Ga0500559_0000443 | |||
| 571 | Ga0500559_0026256 | |||
| 572 | Ga0500568_0000698 | |||
| 573 | Ga0500568_0001028 | |||
| 574 | Ga0500573_0000091 | |||
| 575 | Ga0500573_0006190 | |||
| 576 | Ga0500573_0021895 | |||
| 577 | Ga0500573_0338949 | |||
| 578 | Ga0500577_0007027 | |||
| 579 | Ga0500616_0000078 | |||
| 580 | Ga0500616_0002208 | |||
| 581 | Ga0500634_0231523 | |||
| 582 | Ga0501084_0054097 | |||
| 583 | Ga0466962_0057486 | |||
| 584 | 2585299937 | |||
| 585 | 2616697629 | |||
| 586 | 2643767928 | |||
| 587 | 2643944514 | |||
| 588 | 2644179418 | |||
| 589 | 2644198842 | |||
| 590 | 2644263284 | |||
| 591 | 2644280655 | |||
| 592 | 2644431412 | |||
| 593 | 2784588045 | |||
| 594 | 2785344031 | |||
| 595 | 2785368816 | |||
| 596 | 2808920047 | |||
| 597 | 2809231645 | |||
| 598 | 2811848433 | |||
| 599 | 2812481062 | |||
| 600 | 2819693492 | |||
| 601 | 2819742763 | |||
| 602 | 2844854801 | |||
| 603 | 2852645846 | |||
| 604 | 2857730096 | |||
| 605 | 2857740312 | |||
| 606 | 2862287895 | |||
| 607 | 2862295696 | |||
| 608 | 2862391317 | |||
| 609 | 2862511525 | |||
| 610 | 2862710165 | |||
| 611 | 2863405301 | |||
| 612 | 2877681697 | |||
| 613 | 2897564476 | |||
| 614 | 2912720660 | |||
| 615 | 2912724822 | |||
| 616 | 2918503995 | |||
| 617 | 2919446439 | |||
| 618 | 2928123321 | |||
| 619 | 2939658514 | |||
| 620 | 2939662648 | |||
| 621 | 2946033918 | |||
| 622 | 2947230127 | |||
| 623 | 2954386844 | |||
| 624 | 2954697663 | |||
| 625 | 2954704553 | |||
| 626 | 2966603107 | |||
| 627 | 2990065575 | |||
| 628 | 3006496344 | |||
| 629 | 8008559776 | |||
| 630 | 8008579369 | |||
| 631 | 8023631051 | |||
| 632 | 8033691434 | |||
| 633 | 8048413309 | |||
| 634 | 8056038929 | |||
| 635 | 8056830254 | |||
| 636 | 8057347890 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6rcn-assembly1.cif.gz_A | crystal structure of rexo2-d199a-dada | 0.9675 | 4 | 181 |
| 6n6i-assembly2.cif.gz_B | human rexo2 bound to pgg | 0.964 | 4 | 183 |
| 6j7y-assembly1.cif.gz_B | human mitochondrial oligoribonuclease in complex with dna | 0.9624 | 6 | 183 |
| 6n6h-assembly1.cif.gz_A | vibrio cholerae oligoribonuclease bound to pcpu | 0.9606 | 1 | 180 |
| 6j80-assembly1.cif.gz_B | human mitochondrial oligoribonuclease in complex with poly-dt dna | 0.9596 | 1 | 181 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WIU1_1_181_3.30.420.10 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.9805 | 5 | 183 | 3.30.420.10 |
| af_Q556Y2_11_190_3.30.420.10 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.9743 | 4 | 181 | 3.30.420.10 |
| af_P9WIU1_1_181_3.30.420.10 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.9645 | 5 | 183 | 3.30.420.10 |
| af_A0A1D8PGG3_17_213_3.30.420.10 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.9511 | 6 | 183 | 3.30.420.10 |
| af_Q6K4V8_62_244_3.30.420.10 | Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H | 0.949 | 6 | 183 | 3.30.420.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A074TLR7-F1-model_v4 | deleted | 0.9998 | 3 | 125 |
|
| AF-A0A0R2QF95-F1-model_v4 | Oligoribonuclease | 0.9992 | 6 | 167 |
GO:0000175
GO:0003676 GO:0006259 |
| AF-A0A6I3GJJ9-F1-model_v4 | Oligoribonuclease (EC 3.1.-.-) | 0.9986 | 6 | 146 |
GO:0000175
GO:0003676 GO:0006259 |
| AF-A0A6B3FAP1-F1-model_v4 | Oligoribonuclease (EC 3.1.-.-) | 0.9983 | 9 | 139 |
GO:0000175
GO:0003676 GO:0006259 |
| AF-A0A0K2RSA8-F1-model_v4 | Oligoribonuclease | 0.9963 | 6 | 104 |
GO:0003676
GO:0004527 GO:0006259 |