F404679

General Info

Members Datasets Scaffolds Average Seq Length
318 199 636 158

Family's Representative Sequence

Representative Sequence 3300031691|Ga0316579_10065954|Ga0316579_100659542
Length 186
Sequence MKRSTFSAMTSLCLAVAAAATAADGGADMGFRIESSAFVDDGAIPTIYTCDGKDRSPPLAWSDPPEGARSLALIVDDPDAPDPAAPQMTWSHWVLYDLPPTAGGLPEAVASAALPLGAAEGLNDWKRTGYGGPCPPIGRHRYFFKLYALDTRLEGLGNPTKKQLEAAMEGHVLERTELIGTYRRGR

Samples

Sample ID Description Type Environment
1 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
70 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
109 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
110 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
111 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
112 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
113 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
114 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
115 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
116 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
117 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
118 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
119 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
120 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
121 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
122 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
123 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
124 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
125 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
126 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
127 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
128 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
129 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
132 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
133 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
134 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
135 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
136 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
138 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
139 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
140 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
141 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
142 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
143 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
144 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
145 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
146 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
147 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
148 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
149 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
150 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
151 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
152 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
153 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
154 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
155 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
156 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
157 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
158 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
159 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
160 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
161 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
162 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
163 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
164 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
165 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
166 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
167 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
168 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
169 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
170 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
171 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
172 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
173 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
174 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
175 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
176 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
180 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
181 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
182 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
183 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
184 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
185 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
186 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
187 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
189 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
190 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
191 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
192 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
193 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
194 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
195 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
196 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
197 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
198 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
199 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.43
Metatranscriptomes 0.63
Isolates 0.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0.31
Rhizoplane 0.94
Rhizosphere 94.65
Stem 0
Stem Tuber 0
Unclassified 2.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0316579_10065954 3300031691 Bacteria 1709
2 rootH2_10340282 3300003320 Bacteria 1155
3 rootH1_10345911 3300003323 Bacteria 1162
4 Ga0070658_10004832 3300005327 Bacteria 10977
5 Ga0070676_10001060 3300005328 Bacteria 13699
6 Ga0070683_100059467 3300005329 Bacteria 3550
7 Ga0070683_100370272 3300005329 Bacteria 1365
8 Ga0070690_100000794 3300005330 Bacteria 16023
9 Ga0070670_100001784 3300005331 Bacteria 17512
10 Ga0070677_10026899 3300005333 Bacteria 2161
11 Ga0070677_10030369 3300005333 Bacteria 2057
12 Ga0068869_100231467 3300005334 Bacteria 1468
13 Ga0070666_10142650 3300005335 Bacteria 1669
14 Ga0070666_10890089 3300005335 Bacteria 658
15 Ga0070680_100000441 3300005336 Bacteria 28278
16 Ga0070680_100101128 3300005336 Bacteria 2393
17 Ga0070682_100955226 3300005337 Bacteria 708
18 Ga0068868_100201958 3300005338 Bacteria 1657
19 Ga0070691_10231762 3300005341 Bacteria 983
20 Ga0070687_100199849 3300005343 Bacteria 1210
21 Ga0070661_100002141 3300005344 Bacteria 13611
22 Ga0070661_100002659 3300005344 Bacteria 12230
23 Ga0070692_10262419 3300005345 Bacteria 1039
24 Ga0070668_100021241 3300005347 Bacteria 4907
25 Ga0070669_100050725 3300005353 Bacteria 3031
26 Ga0070669_100743451 3300005353 Bacteria 831
27 Ga0070675_100651504 3300005354 Bacteria 957
28 Ga0070673_100013191 3300005364 Bacteria 5705
29 Ga0070667_100006842 3300005367 Bacteria 9471
30 Ga0070711_100738482 3300005439 Bacteria 831
31 Ga0070705_100057071 3300005440 Bacteria 2302
32 Ga0070694_100460063 3300005444 Bacteria 1006
33 Ga0070694_100810767 3300005444 Bacteria 768
34 Ga0070708_100052193 3300005445 Bacteria 3625
35 Ga0070708_100075182 3300005445 Bacteria 3048
36 Ga0070708_100351414 3300005445 Bacteria 1389
37 Ga0070678_100004022 3300005456 Bacteria 8274
38 Ga0070678_100340189 3300005456 Bacteria 1287
39 Ga0070662_101047450 3300005457 Bacteria 699
40 Ga0070681_10278223 3300005458 Bacteria 1584
41 Ga0070681_10531337 3300005458 Bacteria 1090
42 Ga0068867_100346430 3300005459 Bacteria 1238
43 Ga0070685_10073519 3300005466 Bacteria 2032
44 Ga0070707_100055338 3300005468 Bacteria 3804
45 Ga0070707_100077510 3300005468 Bacteria 3207
46 Ga0070707_100198007 3300005468 Viruses 1958
47 Ga0070699_100101345 3300005518 Bacteria 2524
48 Ga0070679_100024280 3300005530 Bacteria 5940
49 Ga0070679_100238769 3300005530 Bacteria 1775
50 Ga0070679_100400985 3300005530 Bacteria 1317
51 Ga0070679_100542162 3300005530 Bacteria 1107
52 Ga0070679_100671052 3300005530 Bacteria 979
53 Ga0070684_100027302 3300005535 Bacteria 4815
54 Ga0070684_101669860 3300005535 Bacteria 601
55 Ga0070697_100502340 3300005536 Bacteria 1060
56 Ga0068853_100024282 3300005539 Bacteria 5081
57 Ga0070696_100004184 3300005546 Bacteria 9609
58 Ga0070665_100162996 3300005548 Bacteria 2232
59 Ga0070665_100189237 3300005548 Bacteria 2059
60 Ga0070704_100116526 3300005549 Bacteria 2043
61 Ga0070704_101089802 3300005549 Bacteria 725
62 Ga0068855_100448567 3300005563 Bacteria 1408
63 Ga0070664_100000682 3300005564 Bacteria 25899
64 Ga0070664_100287892 3300005564 Bacteria 1483
65 Ga0068857_100027493 3300005577 Bacteria 5018
66 Ga0068857_100069552 3300005577 Bacteria 3135
67 Ga0070702_100661618 3300005615 Bacteria 791
68 Ga0068852_100462327 3300005616 Unclassified 1258
69 Ga0068852_101477029 3300005616 Bacteria 702
70 Ga0068859_100388455 3300005617 Bacteria 1491
71 Ga0068859_101331475 3300005617 Bacteria 792
72 Ga0068864_100395962 3300005618 Bacteria 1312
73 Ga0068861_100342202 3300005719 Unclassified 1309
74 Ga0068861_101057864 3300005719 Bacteria 778
75 Ga0068863_100142057 3300005841 Bacteria 2295
76 Ga0068858_100323783 3300005842 Bacteria 1473
77 Ga0081455_10258283 3300005937 Bacteria 1270
78 Ga0070717_10689082 3300006028 Bacteria 928
79 Ga0075430_100038416 3300006846 Bacteria 4054
80 Ga0075431_100070240 3300006847 Bacteria 3613
81 Ga0075429_100074724 3300006880 Bacteria 2952
82 Ga0075429_100283737 3300006880 Bacteria 1450
83 Ga0097620_100388445 3300006931 Bacteria 1491
84 Ga0097620_101331455 3300006931 Bacteria 792
85 Ga0075435_100258733 3300007076 Bacteria 1483
86 Ga0075435_100263558 3300007076 Bacteria 1469
87 Ga0099794_10028367 3300007265 Bacteria 2604
88 Ga0105243_10598430 3300009148 Bacteria 1061
89 Ga0105248_10488086 3300009177 Bacteria 1388
90 Ga0105248_10728354 3300009177 Bacteria 1119
91 Ga0105238_10789634 3300009551 Bacteria 965
92 Ga0105246_10000858 3300011119 Bacteria 17377
93 Ga0157378_10000016 3300013297 Bacteria 142649
94 Ga0157378_11162704 3300013297 Bacteria 810
95 Ga0157372_10018882 3300013307 Bacteria 7419
96 Ga0157372_11094505 3300013307 Bacteria 922
97 Ga0157372_11796806 3300013307 Bacteria 705
98 Ga0157375_10060517 3300013308 Bacteria 3756
99 Ga0157380_10012859 3300014326 Bacteria 6083
100 Ga0157380_10485869 3300014326 Bacteria 1195
101 Ga0157380_10843422 3300014326 Bacteria 937
102 Ga0157376_10589173 3300014969 Bacteria 1105
103 Ga0213872_10049760 3300021361 Bacteria 1903
104 Ga0207697_10027836 3300025315 Bacteria 2311
105 Ga0207688_10086018 3300025901 Bacteria 1801
106 Ga0207680_10010195 3300025903 Bacteria 4692
107 Ga0207645_10000012 3300025907 Bacteria 131374
108 Ga0207645_10175402 3300025907 Bacteria 1406
109 Ga0207645_10372101 3300025907 Unclassified 958
110 Ga0207705_10026682 3300025909 Bacteria 4117
111 Ga0207707_10174929 3300025912 Bacteria 1875
112 Ga0207707_10185496 3300025912 Bacteria 1815
113 Ga0207660_10042495 3300025917 Bacteria 3191
114 Ga0207660_10047686 3300025917 Bacteria 3030
115 Ga0207662_10076297 3300025918 Bacteria 2037
116 Ga0207662_10597091 3300025918 Bacteria 768
117 Ga0207657_10000268 3300025919 Bacteria 55307
118 Ga0207649_10059832 3300025920 Bacteria 2392
119 Ga0207649_10726684 3300025920 Bacteria 771
120 Ga0207652_10225896 3300025921 Bacteria 1687
121 Ga0207652_10238680 3300025921 Bacteria 1638
122 Ga0207652_10375671 3300025921 Bacteria 1283
123 Ga0207652_10442308 3300025921 Bacteria 1172
124 Ga0207652_10552507 3300025921 Bacteria 1035
125 Ga0207646_10039746 3300025922 Bacteria 4232
126 Ga0207646_10195446 3300025922 Bacteria 1827
127 Ga0207681_10025450 3300025923 Bacteria 3807
128 Ga0207681_10077150 3300025923 Bacteria 2341
129 Ga0207681_10872834 3300025923 Bacteria 753
130 Ga0207690_10044145 3300025932 Bacteria 2937
131 Ga0207706_10214898 3300025933 Bacteria 1685
132 Ga0207670_10032358 3300025936 Bacteria 3362
133 Ga0207669_10307537 3300025937 Bacteria 1207
134 Ga0207711_10385689 3300025941 Bacteria 1300
135 Ga0207661_10070609 3300025944 Bacteria 2852
136 Ga0207661_10157192 3300025944 Bacteria 1970
137 Ga0207661_10484970 3300025944 Bacteria 1129
138 Ga0207679_10002576 3300025945 Bacteria 11175
139 Ga0207679_10007005 3300025945 Bacteria 7145
140 Ga0207679_10396291 3300025945 Bacteria 1213
141 Ga0207667_10598298 3300025949 Bacteria 1112
142 Ga0207651_10002993 3300025960 Bacteria 8183
143 Ga0207677_10229408 3300026023 Bacteria 1494
144 Ga0207677_10754504 3300026023 Bacteria 868
145 Ga0207639_10277492 3300026041 Bacteria 1473
146 Ga0207641_10280947 3300026088 Bacteria 1566
147 Ga0207676_10573018 3300026095 Bacteria 1081
148 Ga0207674_10039578 3300026116 Bacteria 4886
149 Ga0207674_10059782 3300026116 Bacteria 3856
150 Ga0207683_10000028 3300026121 Bacteria 109908
151 Ga0209969_1000198 3300027360 Bacteria 8049
152 Ga0209967_1000257 3300027364 Bacteria 7296
153 Ga0209995_1000009 3300027471 Bacteria 32653
154 Ga0209968_1000024 3300027526 Bacteria 28731
155 Ga0210002_1000051 3300027617 Bacteria 17640
156 Ga0209971_1018666 3300027682 Bacteria 1646
157 Ga0209966_1000248 3300027695 Bacteria 19851
158 Ga0209966_1006351 3300027695 Bacteria 2051
159 Ga0209974_10000246 3300027876 Bacteria 17475
160 Ga0268266_10150101 3300028379 Bacteria 2100
161 Ga0268265_10237182 3300028380 Bacteria 1607
162 Ga0265322_10007999 3300028654 Bacteria 3084
163 Ga0265338_10041546 3300028800 Bacteria 4299
164 Ga0265330_10002665 3300031235 Bacteria 9645
165 Ga0265332_10009749 3300031238 Bacteria 4286
166 Ga0265329_10000100 3300031242 Bacteria 40653
167 Ga0265340_10041013 3300031247 Bacteria 2278
168 Ga0265339_10012194 3300031249 Bacteria 5257
169 Ga0265316_10000682 3300031344 Bacteria 37788
170 Ga0307408_100040346 3300031548 Bacteria 3305
171 Ga0307408_100097945 3300031548 Bacteria 2228
172 Ga0307408_100540853 3300031548 Bacteria 1026
173 Ga0316575_10041587 3300031665 Bacteria 1819
174 Ga0316579_10090550 3300031691 Bacteria 1461
175 Ga0265314_10002735 3300031711 Bacteria 17624
176 Ga0265342_10000304 3300031712 Bacteria 55993
177 Ga0316576_10092581 3300031727 Bacteria 2252
178 Ga0316576_10119819 3300031727 Bacteria 1975
179 Ga0316576_10297256 3300031727 Bacteria 1207
180 Ga0316578_10218666 3300031728 Bacteria 1145
181 Ga0316578_10340482 3300031728 Bacteria 893
182 Ga0307405_10001630 3300031731 Bacteria 9544
183 Ga0307405_10079090 3300031731 Bacteria 2142
184 Ga0316577_10002389 3300031733 Bacteria 9286
185 Ga0316577_10419182 3300031733 Bacteria 761
186 Ga0307413_10002246 3300031824 Bacteria 7789
187 Ga0307413_10040481 3300031824 Bacteria 2719
188 Ga0307413_10043895 3300031824 Bacteria 2638
189 Ga0307413_10866119 3300031824 Bacteria 765
190 Ga0307410_10011453 3300031852 Bacteria 5073
191 Ga0307410_10018294 3300031852 Bacteria 4232
192 Ga0307410_10020858 3300031852 Bacteria 4018
193 Ga0307406_10071337 3300031901 Bacteria 2276
194 Ga0307406_10121266 3300031901 Bacteria 1818
195 Ga0307407_10007169 3300031903 Bacteria 5028
196 Ga0307407_10019581 3300031903 Bacteria 3449
197 Ga0307407_10039911 3300031903 Bacteria 2613
198 Ga0307407_10246028 3300031903 Bacteria 1223
199 Ga0307412_10005255 3300031911 Bacteria 7262
200 Ga0307412_10081962 3300031911 Bacteria 2232
201 Ga0307412_10818730 3300031911 Bacteria 810
202 Ga0307409_100030345 3300031995 Bacteria 3882
203 Ga0307409_100047788 3300031995 Bacteria 3251
204 Ga0307409_100221621 3300031995 Bacteria 1708
205 Ga0307409_100282624 3300031995 Bacteria 1534
206 Ga0307416_100000515 3300032002 Bacteria 19795
207 Ga0307416_100010828 3300032002 Bacteria 6044
208 Ga0307416_100271047 3300032002 Bacteria 1666
209 Ga0307416_100271302 3300032002 Bacteria 1666
210 Ga0307414_10030868 3300032004 Bacteria 3506
211 Ga0307414_10181932 3300032004 Bacteria 1691
212 Ga0307414_12065246 3300032004 Bacteria 532
213 Ga0307411_10015860 3300032005 Bacteria 4246
214 Ga0307411_10029315 3300032005 Bacteria 3358
215 Ga0307411_11831433 3300032005 Bacteria 564
216 Ga0307415_100000827 3300032126 Bacteria 14161
217 Ga0307415_100025446 3300032126 Bacteria 3714
218 Ga0307415_100284823 3300032126 Bacteria 1361
219 Ga0316583_10000435 3300032133 Bacteria 12231
220 Ga0316583_10036647 3300032133 Bacteria 1739
221 Ga0316585_10030637 3300032137 Bacteria 1689
222 Ga0316587_1022486 3300033529 Bacteria 1081
223 Ga0316596_1102125 3300033541 Unclassified 776
224 Ga0373941_0226089 3300035115 Bacteria 721
225 Ga0373945_0236285 3300035116 Bacteria 768
226 Ga0316574_0100990 3300035398 Bacteria 1846
227 Ga0316574_0184644 3300035398 Bacteria 1341
228 Ga0316574_0350624 3300035398 Bacteria 934
229 Ga0316574_0535566 3300035398 Bacteria 728
230 Ga0373935_0001469 3300035692 Bacteria 13074
231 Ga0316582_0006850 3300036647 Bacteria 6022
232 Ga0316582_0292417 3300036647 Bacteria 1119
233 Ga0316582_0653527 3300036647 Bacteria 723
234 Ga0316582_0762151 3300036647 Unclassified 664
235 Ga0316582_0818561 3300036647 Bacteria 638
236 Ga0316584_0000544 3300036712 Bacteria 20221
237 Ga0316584_0028848 3300036712 Bacteria 4096
238 Ga0316584_0062890 3300036712 Bacteria 2779
239 Ga0316584_0073234 3300036712 Bacteria 2567
240 Ga0395900_1590744 3300037418 Bacteria 565
241 Ga0395905_0011014 3300037471 Bacteria 8751
242 Ga0395905_0324113 3300037471 Bacteria 1430
243 Ga0400490_17482 3300038726 Bacteria 20383
244 Ga0400491_23120 3300038727 Bacteria 6712
245 Ga0436361_0231867 3300039447 Bacteria 2005
246 Ga0451577_0001632 3300042876 Bacteria 29116
247 Ga0451577_0038504 3300042876 Bacteria 4301
248 Ga0453683_0121047 3300044673 Bacteria 1648
249 Ga0453683_0189565 3300044673 Bacteria 1304
250 Ga0453683_0949061 3300044673 Bacteria 570
251 Ga0453684_0001307 3300044712 Bacteria 73699
252 Ga0453684_0021501 3300044712 Bacteria 9634
253 Ga0453684_0037809 3300044712 Bacteria 6618
254 Ga0453684_0178204 3300044712 Bacteria 2497
255 Ga0453684_0195899 3300044712 Bacteria 2360
256 Ga0453684_0202672 3300044712 Bacteria 2312
257 Ga0466960_0225010 3300044901 Bacteria 1034
258 Ga0451576_0038355 3300045051 Bacteria 5070
259 Ga0451576_0057186 3300045051 Bacteria 4077
260 Ga0451576_0058412 3300045051 Bacteria 4031
261 Ga0451576_0164985 3300045051 Bacteria 2311
262 Ga0451576_0444909 3300045051 Bacteria 1360
263 Ga0495592_0346054 3300046454 Bacteria 954
264 Ga0495651_0117239 3300046462 Bacteria 1960
265 Ga0495608_0150944 3300046511 Bacteria 1481
266 Ga0495628_0793783 3300046516 Bacteria 663
267 Ga0495643_0084043 3300046522 Bacteria 1652
268 Ga0495643_0157103 3300046522 Bacteria 1122
269 Ga0495597_0002141 3300046542 Bacteria 13072
270 Ga0495661_0456868 3300046665 Bacteria 614
271 Ga0495599_0051432 3300046678 Bacteria 2581
272 Ga0495604_0096451 3300047317 Bacteria 2182
273 Ga0495687_000761 3300047443 Bacteria 34838
274 Ga0495675_0291594 3300047444 Bacteria 971
275 Ga0495602_0659919 3300048088 Bacteria 713
276 Ga0496102_0048646 3300048905 Bacteria 3856
277 Ga0496114_0000028 3300048917 Bacteria 177603
278 Ga0496114_0302569 3300048917 Bacteria 1412
279 Ga0496117_0000117 3300048920 Bacteria 177596
280 Ga0496118_0000025 3300048921 Bacteria 379363
281 Ga0496119_0025038 3300048922 Bacteria 4178
282 Ga0496120_0026794 3300048923 Bacteria 3555
283 Ga0496121_0007176 3300048924 Bacteria 13500
284 Ga0496124_0273857 3300048927 Unclassified 1234
285 Ga0496125_0019406 3300048928 Bacteria 6414
286 Ga0496126_0431493 3300048929 Unclassified 1063
287 Ga0501039_0055348 3300049575 Bacteria 3072
288 Ga0501040_0107263 3300049576 Bacteria 1952
289 Ga0501041_0225222 3300049577 Bacteria 1177
290 Ga0501071_0275245 3300049587 Bacteria 1273
291 Ga0501071_0472465 3300049587 Bacteria 961
292 Ga0501073_0042433 3300049589 Bacteria 3210
293 Ga0501074_0008822 3300049590 Bacteria 7311
294 Ga0501074_0080642 3300049590 Bacteria 2334
295 Ga0501076_0134729 3300049592 Bacteria 2005
296 Ga0501077_0144442 3300049593 Bacteria 1509
297 Ga0501080_0010311 3300049742 Bacteria 8543
298 Ga0501080_0024303 3300049742 Bacteria 5618
299 Ga0501080_0783798 3300049742 Bacteria 837
300 Ga0501081_0290414 3300049743 Bacteria 1198
301 Ga0501083_0116863 3300049744 Bacteria 1751
302 Ga0501035_0959840 3300049822 Bacteria 674
303 Ga0501045_0016575 3300049824 Bacteria 5236
304 nmdc:mga09592_140712_c1 3300050508 Bacteria 2080
305 nmdc:mga09592_275965_c1 3300050508 Bacteria 1458
306 nmdc:mga09592_604799_c1 3300050508 Bacteria 939
307 nmdc:mga0qj67_7997_c1 3300050509 Bacteria 7820
308 nmdc:mga06r32_6044_c1 3300050510 Bacteria 10883
309 nmdc:mga08y16_315475_c1 3300050511 Bacteria 1610
310 nmdc:mga0rr50_411833_c1 3300050513 Bacteria 1143
311 Ga0501084_0097288 3300054114 Bacteria 2471
312 Ga0501084_0236372 3300054114 Bacteria 1542
313 Ga0590071_153510 3300059421 Bacteria 597
314 Ga0501082_0177435 3300060353 Bacteria 1852
315 Ga0501082_0181440 3300060353 Bacteria 1831
316 2792833476 2791355137 Bacteria 9654227
317 2891634926 2891633521 Bacteria 4602265
318 2921653133 2921643360 Bacteria 11448031
319 Ga0316579_10065954
320 rootH2_10340282
321 rootH1_10345911
322 Ga0070658_10004832
323 Ga0070676_10001060
324 Ga0070683_100059467
325 Ga0070683_100370272
326 Ga0070690_100000794
327 Ga0070670_100001784
328 Ga0070677_10026899
329 Ga0070677_10030369
330 Ga0068869_100231467
331 Ga0070666_10142650
332 Ga0070666_10890089
333 Ga0070680_100000441
334 Ga0070680_100101128
335 Ga0070682_100955226
336 Ga0068868_100201958
337 Ga0070691_10231762
338 Ga0070687_100199849
339 Ga0070661_100002141
340 Ga0070661_100002659
341 Ga0070692_10262419
342 Ga0070668_100021241
343 Ga0070669_100050725
344 Ga0070669_100743451
345 Ga0070675_100651504
346 Ga0070673_100013191
347 Ga0070667_100006842
348 Ga0070711_100738482
349 Ga0070705_100057071
350 Ga0070694_100460063
351 Ga0070694_100810767
352 Ga0070708_100052193
353 Ga0070708_100075182
354 Ga0070708_100351414
355 Ga0070678_100004022
356 Ga0070678_100340189
357 Ga0070662_101047450
358 Ga0070681_10278223
359 Ga0070681_10531337
360 Ga0068867_100346430
361 Ga0070685_10073519
362 Ga0070707_100055338
363 Ga0070707_100077510
364 Ga0070707_100198007
365 Ga0070699_100101345
366 Ga0070679_100024280
367 Ga0070679_100238769
368 Ga0070679_100400985
369 Ga0070679_100542162
370 Ga0070679_100671052
371 Ga0070684_100027302
372 Ga0070684_101669860
373 Ga0070697_100502340
374 Ga0068853_100024282
375 Ga0070696_100004184
376 Ga0070665_100162996
377 Ga0070665_100189237
378 Ga0070704_100116526
379 Ga0070704_101089802
380 Ga0068855_100448567
381 Ga0070664_100000682
382 Ga0070664_100287892
383 Ga0068857_100027493
384 Ga0068857_100069552
385 Ga0070702_100661618
386 Ga0068852_100462327
387 Ga0068852_101477029
388 Ga0068859_100388455
389 Ga0068859_101331475
390 Ga0068864_100395962
391 Ga0068861_100342202
392 Ga0068861_101057864
393 Ga0068863_100142057
394 Ga0068858_100323783
395 Ga0081455_10258283
396 Ga0070717_10689082
397 Ga0075430_100038416
398 Ga0075431_100070240
399 Ga0075429_100074724
400 Ga0075429_100283737
401 Ga0097620_100388445
402 Ga0097620_101331455
403 Ga0075435_100258733
404 Ga0075435_100263558
405 Ga0099794_10028367
406 Ga0105243_10598430
407 Ga0105248_10488086
408 Ga0105248_10728354
409 Ga0105238_10789634
410 Ga0105246_10000858
411 Ga0157378_10000016
412 Ga0157378_11162704
413 Ga0157372_10018882
414 Ga0157372_11094505
415 Ga0157372_11796806
416 Ga0157375_10060517
417 Ga0157380_10012859
418 Ga0157380_10485869
419 Ga0157380_10843422
420 Ga0157376_10589173
421 Ga0213872_10049760
422 Ga0207697_10027836
423 Ga0207688_10086018
424 Ga0207680_10010195
425 Ga0207645_10000012
426 Ga0207645_10175402
427 Ga0207645_10372101
428 Ga0207705_10026682
429 Ga0207707_10174929
430 Ga0207707_10185496
431 Ga0207660_10042495
432 Ga0207660_10047686
433 Ga0207662_10076297
434 Ga0207662_10597091
435 Ga0207657_10000268
436 Ga0207649_10059832
437 Ga0207649_10726684
438 Ga0207652_10225896
439 Ga0207652_10238680
440 Ga0207652_10375671
441 Ga0207652_10442308
442 Ga0207652_10552507
443 Ga0207646_10039746
444 Ga0207646_10195446
445 Ga0207681_10025450
446 Ga0207681_10077150
447 Ga0207681_10872834
448 Ga0207690_10044145
449 Ga0207706_10214898
450 Ga0207670_10032358
451 Ga0207669_10307537
452 Ga0207711_10385689
453 Ga0207661_10070609
454 Ga0207661_10157192
455 Ga0207661_10484970
456 Ga0207679_10002576
457 Ga0207679_10007005
458 Ga0207679_10396291
459 Ga0207667_10598298
460 Ga0207651_10002993
461 Ga0207677_10229408
462 Ga0207677_10754504
463 Ga0207639_10277492
464 Ga0207641_10280947
465 Ga0207676_10573018
466 Ga0207674_10039578
467 Ga0207674_10059782
468 Ga0207683_10000028
469 Ga0209969_1000198
470 Ga0209967_1000257
471 Ga0209995_1000009
472 Ga0209968_1000024
473 Ga0210002_1000051
474 Ga0209971_1018666
475 Ga0209966_1000248
476 Ga0209966_1006351
477 Ga0209974_10000246
478 Ga0268266_10150101
479 Ga0268265_10237182
480 Ga0265322_10007999
481 Ga0265338_10041546
482 Ga0265330_10002665
483 Ga0265332_10009749
484 Ga0265329_10000100
485 Ga0265340_10041013
486 Ga0265339_10012194
487 Ga0265316_10000682
488 Ga0307408_100040346
489 Ga0307408_100097945
490 Ga0307408_100540853
491 Ga0316575_10041587
492 Ga0316579_10090550
493 Ga0265314_10002735
494 Ga0265342_10000304
495 Ga0316576_10092581
496 Ga0316576_10119819
497 Ga0316576_10297256
498 Ga0316578_10218666
499 Ga0316578_10340482
500 Ga0307405_10001630
501 Ga0307405_10079090
502 Ga0316577_10002389
503 Ga0316577_10419182
504 Ga0307413_10002246
505 Ga0307413_10040481
506 Ga0307413_10043895
507 Ga0307413_10866119
508 Ga0307410_10011453
509 Ga0307410_10018294
510 Ga0307410_10020858
511 Ga0307406_10071337
512 Ga0307406_10121266
513 Ga0307407_10007169
514 Ga0307407_10019581
515 Ga0307407_10039911
516 Ga0307407_10246028
517 Ga0307412_10005255
518 Ga0307412_10081962
519 Ga0307412_10818730
520 Ga0307409_100030345
521 Ga0307409_100047788
522 Ga0307409_100221621
523 Ga0307409_100282624
524 Ga0307416_100000515
525 Ga0307416_100010828
526 Ga0307416_100271047
527 Ga0307416_100271302
528 Ga0307414_10030868
529 Ga0307414_10181932
530 Ga0307414_12065246
531 Ga0307411_10015860
532 Ga0307411_10029315
533 Ga0307411_11831433
534 Ga0307415_100000827
535 Ga0307415_100025446
536 Ga0307415_100284823
537 Ga0316583_10000435
538 Ga0316583_10036647
539 Ga0316585_10030637
540 Ga0316587_1022486
541 Ga0316596_1102125
542 Ga0373941_0226089
543 Ga0373945_0236285
544 Ga0316574_0100990
545 Ga0316574_0184644
546 Ga0316574_0350624
547 Ga0316574_0535566
548 Ga0373935_0001469
549 Ga0316582_0006850
550 Ga0316582_0292417
551 Ga0316582_0653527
552 Ga0316582_0762151
553 Ga0316582_0818561
554 Ga0316584_0000544
555 Ga0316584_0028848
556 Ga0316584_0062890
557 Ga0316584_0073234
558 Ga0395900_1590744
559 Ga0395905_0011014
560 Ga0395905_0324113
561 Ga0400490_17482
562 Ga0400491_23120
563 Ga0436361_0231867
564 Ga0451577_0001632
565 Ga0451577_0038504
566 Ga0453683_0121047
567 Ga0453683_0189565
568 Ga0453683_0949061
569 Ga0453684_0001307
570 Ga0453684_0021501
571 Ga0453684_0037809
572 Ga0453684_0178204
573 Ga0453684_0195899
574 Ga0453684_0202672
575 Ga0466960_0225010
576 Ga0451576_0038355
577 Ga0451576_0057186
578 Ga0451576_0058412
579 Ga0451576_0164985
580 Ga0451576_0444909
581 Ga0495592_0346054
582 Ga0495651_0117239
583 Ga0495608_0150944
584 Ga0495628_0793783
585 Ga0495643_0084043
586 Ga0495643_0157103
587 Ga0495597_0002141
588 Ga0495661_0456868
589 Ga0495599_0051432
590 Ga0495604_0096451
591 Ga0495687_000761
592 Ga0495675_0291594
593 Ga0495602_0659919
594 Ga0496102_0048646
595 Ga0496114_0000028
596 Ga0496114_0302569
597 Ga0496117_0000117
598 Ga0496118_0000025
599 Ga0496119_0025038
600 Ga0496120_0026794
601 Ga0496121_0007176
602 Ga0496124_0273857
603 Ga0496125_0019406
604 Ga0496126_0431493
605 Ga0501039_0055348
606 Ga0501040_0107263
607 Ga0501041_0225222
608 Ga0501071_0275245
609 Ga0501071_0472465
610 Ga0501073_0042433
611 Ga0501074_0008822
612 Ga0501074_0080642
613 Ga0501076_0134729
614 Ga0501077_0144442
615 Ga0501080_0010311
616 Ga0501080_0024303
617 Ga0501080_0783798
618 Ga0501081_0290414
619 Ga0501083_0116863
620 Ga0501035_0959840
621 Ga0501045_0016575
622 nmdc:mga09592_140712_c1
623 nmdc:mga09592_275965_c1
624 nmdc:mga09592_604799_c1
625 nmdc:mga0qj67_7997_c1
626 nmdc:mga06r32_6044_c1
627 nmdc:mga08y16_315475_c1
628 nmdc:mga0rr50_411833_c1
629 Ga0501084_0097288
630 Ga0501084_0236372
631 Ga0590071_153510
632 Ga0501082_0177435
633 Ga0501082_0181440
634 2792833476
635 2891634926
636 2921653133

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01161

PBP

Phosphatidylethanolamine-binding protein

43

182

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3n08-assembly1.cif.gz_B crystal structure of a putative phosphatidylethanolamine-binding protein (pebp) homolog ct736 from chlamydia trachomatis d/uw-3/cx 0.9429 3 157
3n08-assembly1.cif.gz_B crystal structure of a putative phosphatidylethanolamine-binding protein (pebp) homolog ct736 from chlamydia trachomatis d/uw-3/cx 0.931 3 157
1fux-assembly1.cif.gz_B crystal structure of e.coli ybcl, a new member of the mammalian pebp family 0.8834 3 157
1vi3-assembly1.cif.gz_A crystal structure of an hypothetical protein 0.8705 4 156
1fjj-assembly1.cif.gz_A-2 crystal structure of e.coli ybhb protein, a new member of the mammalian pebp family 0.8701 5 155
ID Description Score Start End Superfamily
3n08A00 Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like 0.9419 4 156 3.90.280.10
3n08A00 Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like 0.9297 4 156 3.90.280.10
af_Q9M042_1_161_3.90.280.10 Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like 0.918 2 155 3.90.280.10
af_Q9M042_1_161_3.90.280.10 Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like 0.8902 2 155 3.90.280.10
4begB00 Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like 0.888 1 156 3.90.280.10
ID Description Score Start End GO Terms
AF-A0A4Q4XE18-F1-model_v4 YbhB/YbcL family Raf kinase inhibitor-like protein 0.9851 4 158 GO:0016020
AF-A0A2V7VSW0-F1-model_v4 YbhB/YbcL family Raf kinase inhibitor-like protein 0.9779 3 158 GO:0006508
GO:0070573
AF-A0A2V7UX72-F1-model_v4 Membrane dipeptidase 0.9773 1 158 GO:0006508
GO:0070573
AF-A0A1Y6CHG6-F1-model_v4 Phospholipid-binding protein, PBP family 0.9768 2 156
AF-A0A7V0J161-F1-model_v4 YbhB/YbcL family Raf kinase inhibitor-like protein 0.9753 7 156

Map