F404659

General Info

Members Datasets Scaffolds Average Seq Length
318 210 636 234

Family's Representative Sequence

Representative Sequence 3300026089|Ga0207648_10207503|Ga0207648_102075032
Length 263
Sequence MSESLLRVEKLSAGYGAMTVLSEITFEITSGEIVALVGSNGAGKTTTLRALSRVISSQGRIFFNGRDLARLTSDQVFSLGLVQVPEGRQLFDQMTVEDNLLMGAYCRKQREEIAADLQQVYQFFPILKERRLQIAGSLSGGEQQMCAIARGLMARPQLLMIDEMSLGLAPIVVDLLIDKLAEVRKNGVTVLLVEQDIFSAFHVADRGYVLETGRIVRTGSASSGAQSRQNRNGSRWKNVKCRLWRRRARPCSIRTRFAGRYRG

Samples

Sample ID Description Type Environment
1 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
5 3300005276 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Mutant cpr5 v1 Metagenome Rhizosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
87 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
88 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
89 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
117 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
118 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
122 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
123 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
124 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
125 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
126 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
127 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
130 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
131 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
132 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
133 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
134 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
135 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
136 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
137 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
138 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
139 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
140 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
141 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
142 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
143 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
144 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
145 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
146 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
147 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
148 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
152 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
153 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
156 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
157 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
158 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
159 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
160 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
161 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
162 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
163 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
164 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
165 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
166 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
167 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
168 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
169 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
170 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
171 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
172 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
173 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
174 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
175 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
178 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
179 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
180 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
185 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
186 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
187 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
191 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
192 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
193 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
194 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
195 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
196 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
197 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
198 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
199 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
200 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
201 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
202 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
203 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
204 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
205 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
206 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
207 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
208 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
209 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
210 2828305725 Xanthobacter tagetidis DSM 11105 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.37
Metatranscriptomes 0
Isolates 0.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.46
Nodule 0.31
Rhizoplane 5.03
Rhizosphere 86.48
Stem 0
Stem Tuber 0
Unclassified 2.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207648_10207503 3300026089 Bacteria 1739
2 ARcpr5oldR_c004384 3300000041 Bacteria 1229
3 JGI25151J46595_10056509 3300003187 Bacteria 1286
4 JGI25407J50210_10018555 3300003373 Bacteria 1808
5 JGI25407J50210_10030796 3300003373 Bacteria 1389
6 Ga0065717_1004435 3300005276 Bacteria 1039
7 Ga0065704_10021446 3300005289 Bacteria 1545
8 Ga0065712_10008621 3300005290 Bacteria 4566
9 Ga0065715_10015729 3300005293 Bacteria 2360
10 Ga0065715_10161268 3300005293 Bacteria 1623
11 Ga0065707_10008154 3300005295 Bacteria 2500
12 Ga0065707_10432258 3300005295 Bacteria 819
13 Ga0070676_10016320 3300005328 Bacteria 4104
14 Ga0070690_100132026 3300005330 Unclassified 1688
15 Ga0070670_100001233 3300005331 Bacteria 20349
16 Ga0068869_100504561 3300005334 Bacteria 1010
17 Ga0070666_10015762 3300005335 Bacteria 4827
18 Ga0070666_10126406 3300005335 Bacteria 1775
19 Ga0070680_100015677 3300005336 Bacteria 5948
20 Ga0070682_100246370 3300005337 Bacteria 1286
21 Ga0068868_100111662 3300005338 Bacteria 2222
22 Ga0070660_100022097 3300005339 Bacteria 4700
23 Ga0070660_100384336 3300005339 Bacteria 1159
24 Ga0070689_100058497 3300005340 Unclassified 2994
25 Ga0070691_10204363 3300005341 Bacteria 1039
26 Ga0070691_10220853 3300005341 Bacteria 1004
27 Ga0070661_100261399 3300005344 Bacteria 1338
28 Ga0070692_10069090 3300005345 Bacteria 1878
29 Ga0070668_100033584 3300005347 Bacteria 3908
30 Ga0070668_100120541 3300005347 Bacteria 2096
31 Ga0070669_100018879 3300005353 Bacteria 4928
32 Ga0070669_100403295 3300005353 Bacteria 1119
33 Ga0070675_100047444 3300005354 Bacteria 3519
34 Ga0070675_100392108 3300005354 Bacteria 1237
35 Ga0070671_100216056 3300005355 Bacteria 1627
36 Ga0070674_100417405 3300005356 Bacteria 1100
37 Ga0070673_100008123 3300005364 Bacteria 6963
38 Ga0070673_100212672 3300005364 Bacteria 1671
39 Ga0070659_100041380 3300005366 Bacteria 3602
40 Ga0070705_100135874 3300005440 Unclassified 1611
41 Ga0070705_100299480 3300005440 Bacteria 1152
42 Ga0070700_100133839 3300005441 Bacteria 1676
43 Ga0070663_100092240 3300005455 Bacteria 2246
44 Ga0070678_100021032 3300005456 Bacteria 4293
45 Ga0070678_100092314 3300005456 Bacteria 2325
46 Ga0070681_10003478 3300005458 Bacteria 14754
47 Ga0070681_10017923 3300005458 Bacteria 7078
48 Ga0070706_100162261 3300005467 Bacteria 2087
49 Ga0070699_100000512 3300005518 Bacteria 36772
50 Ga0070679_100243189 3300005530 Bacteria 1757
51 Ga0070684_100768742 3300005535 Bacteria 900
52 Ga0070697_100599409 3300005536 Bacteria 968
53 Ga0070672_100011815 3300005543 Bacteria 6101
54 Ga0070686_100162903 3300005544 Bacteria 1572
55 Ga0070686_100309153 3300005544 Bacteria 1175
56 Ga0070695_100011240 3300005545 Bacteria 5354
57 Ga0070695_100232720 3300005545 Bacteria 1333
58 Ga0070693_100071388 3300005547 Bacteria 2046
59 Ga0070693_100266487 3300005547 Bacteria 1142
60 Ga0070665_100180443 3300005548 Bacteria 2112
61 Ga0070665_100540090 3300005548 Bacteria 1178
62 Ga0070704_100107426 3300005549 Bacteria 2117
63 Ga0070704_100134383 3300005549 Bacteria 1922
64 Ga0068855_100043861 3300005563 Bacteria 5295
65 Ga0070664_100322741 3300005564 Bacteria 1399
66 Ga0068857_100036141 3300005577 Bacteria 4377
67 Ga0068854_100165423 3300005578 Bacteria 1717
68 Ga0068856_100031245 3300005614 Bacteria 5210
69 Ga0070702_100391978 3300005615 Bacteria 991
70 Ga0068858_100590528 3300005842 Bacteria 1077
71 Ga0068860_100359463 3300005843 Bacteria 1434
72 Ga0068860_100672297 3300005843 Bacteria 1044
73 Ga0068862_100296909 3300005844 Bacteria 1485
74 Ga0081538_10001467 3300005981 Bacteria 24195
75 Ga0081538_10003466 3300005981 Bacteria 14899
76 Ga0081539_10057126 3300005985 Bacteria 2162
77 Ga0075368_10006319 3300006042 Bacteria 4134
78 Ga0075363_100021718 3300006048 Bacteria 3238
79 Ga0075364_10288774 3300006051 Bacteria 1116
80 Ga0075367_10147505 3300006178 Bacteria 1459
81 Ga0075367_10346692 3300006178 Bacteria 937
82 Ga0097621_100419981 3300006237 Bacteria 1200
83 Ga0075428_100000498 3300006844 Bacteria 39836
84 Ga0075430_100119249 3300006846 Bacteria 2199
85 Ga0075431_100170206 3300006847 Bacteria 2238
86 Ga0075433_10006491 3300006852 Bacteria 9249
87 Ga0075433_10012968 3300006852 Bacteria 6757
88 Ga0075433_10013035 3300006852 Bacteria 6742
89 Ga0075433_10062693 3300006852 Bacteria 3256
90 Ga0075433_10070929 3300006852 Bacteria 3063
91 Ga0075433_10091165 3300006852 Bacteria 2694
92 Ga0075434_100002299 3300006871 Bacteria 16720
93 Ga0075434_100005263 3300006871 Bacteria 11759
94 Ga0075434_100108403 3300006871 Bacteria 2787
95 Ga0075434_100262732 3300006871 Bacteria 1745
96 Ga0075429_100068250 3300006880 Bacteria 3094
97 Ga0075429_100179383 3300006880 Bacteria 1856
98 Ga0075429_100181835 3300006880 Bacteria 1842
99 Ga0068865_100032432 3300006881 Bacteria 3489
100 Ga0075436_100004808 3300006914 Bacteria 9279
101 Ga0075436_100050851 3300006914 Bacteria 2860
102 Ga0075435_100010407 3300007076 Bacteria 6804
103 Ga0075435_100021316 3300007076 Bacteria 4982
104 Ga0075435_100043182 3300007076 Bacteria 3608
105 Ga0075435_100098532 3300007076 Bacteria 2420
106 Ga0075435_100104784 3300007076 Unclassified 2347
107 Ga0111539_10066735 3300009094 Bacteria 4250
108 Ga0111539_10223348 3300009094 Unclassified 2194
109 Ga0111539_10532550 3300009094 Bacteria 1368
110 Ga0114129_10001993 3300009147 Bacteria 27939
111 Ga0114129_10009036 3300009147 Bacteria 14201
112 Ga0114129_10040825 3300009147 Bacteria 6541
113 Ga0114129_10813261 3300009147 Bacteria 1191
114 Ga0105241_10061782 3300009174 Bacteria 2886
115 Ga0105237_10066329 3300009545 Bacteria 3604
116 Ga0105239_10155207 3300010375 Bacteria 2556
117 Ga0105246_10350775 3300011119 Bacteria 1209
118 Ga0157373_10166923 3300013100 Bacteria 1549
119 Ga0157374_10224796 3300013296 Bacteria 1843
120 Ga0157378_10032985 3300013297 Bacteria 4577
121 Ga0157378_10125968 3300013297 Bacteria 2366
122 Ga0157378_10370248 3300013297 Bacteria 1404
123 Ga0163162_10062510 3300013306 Bacteria 3764
124 Ga0157372_10323512 3300013307 Bacteria 1795
125 Ga0157375_10217451 3300013308 Bacteria 2069
126 Ga0163163_10114388 3300014325 Bacteria 2729
127 Ga0157380_10016045 3300014326 Bacteria 5516
128 Ga0157376_10063838 3300014969 Bacteria 3104
129 Ga0157376_10237472 3300014969 Bacteria 1696
130 Ga0213874_10001049 3300021377 Bacteria 5665
131 Ga0213876_10003427 3300021384 Bacteria 9076
132 Ga0213876_10023454 3300021384 Bacteria 3260
133 Ga0213875_10006703 3300021388 Bacteria 6016
134 Ga0213875_10119294 3300021388 Bacteria 1233
135 Ga0207697_10004842 3300025315 Bacteria 6354
136 Ga0207680_10023191 3300025903 Bacteria 3385
137 Ga0207680_10151042 3300025903 Bacteria 1549
138 Ga0207645_10004447 3300025907 Bacteria 10378
139 Ga0207684_10190906 3300025910 Bacteria 1767
140 Ga0207654_10269043 3300025911 Bacteria 1149
141 Ga0207707_10020467 3300025912 Bacteria 5777
142 Ga0207671_10048639 3300025914 Bacteria 3138
143 Ga0207657_10001822 3300025919 Bacteria 22989
144 Ga0207657_10316062 3300025919 Bacteria 1235
145 Ga0207649_10058400 3300025920 Bacteria 2416
146 Ga0207652_10230558 3300025921 Bacteria 1669
147 Ga0207681_10285713 3300025923 Bacteria 1300
148 Ga0207650_10002518 3300025925 Bacteria 12718
149 Ga0207659_10072201 3300025926 Bacteria 2522
150 Ga0207644_10057410 3300025931 Bacteria 2810
151 Ga0207644_10074518 3300025931 Bacteria 2491
152 Ga0207690_10016009 3300025932 Bacteria 4557
153 Ga0207706_10014809 3300025933 Bacteria 7060
154 Ga0207706_10069055 3300025933 Bacteria 3108
155 Ga0207670_10168967 3300025936 Bacteria 1638
156 Ga0207691_10050110 3300025940 Bacteria 3824
157 Ga0207679_10019538 3300025945 Bacteria 4553
158 Ga0207667_10031897 3300025949 Bacteria 5682
159 Ga0207651_10093978 3300025960 Bacteria 2203
160 Ga0207668_10146798 3300025972 Bacteria 1821
161 Ga0207640_10079755 3300025981 Bacteria 2232
162 Ga0207703_10502049 3300026035 Bacteria 1139
163 Ga0207678_10019937 3300026067 Bacteria 5894
164 Ga0207641_10105782 3300026088 Bacteria 2486
165 Ga0207683_10009619 3300026121 Bacteria 8237
166 Ga0207683_10023348 3300026121 Bacteria 5320
167 Ga0209813_10001094 3300027866 Bacteria 6069
168 Ga0207428_10114948 3300027907 Unclassified 2067
169 Ga0268266_10589872 3300028379 Bacteria 1067
170 Ga0268265_10181886 3300028380 Bacteria 1807
171 Ga0268264_10260046 3300028381 Bacteria 1616
172 Ga0268264_10542633 3300028381 Bacteria 1139
173 Ga0307515_10096463 3300028794 Bacteria 3626
174 Ga0307408_100048749 3300031548 Bacteria 3039
175 Ga0316575_10045499 3300031665 Bacteria 1743
176 Ga0316575_10106770 3300031665 Bacteria 1141
177 Ga0316579_10029109 3300031691 Bacteria 2519
178 Ga0316578_10032069 3300031728 Bacteria 2998
179 Ga0316578_10132211 3300031728 Bacteria 1502
180 Ga0307405_10001841 3300031731 Bacteria 9104
181 Ga0307413_10021951 3300031824 Bacteria 3429
182 Ga0307410_10043908 3300031852 Bacteria 2965
183 Ga0307406_10005159 3300031901 Bacteria 7125
184 Ga0307407_10001003 3300031903 Bacteria 9693
185 Ga0307409_100001685 3300031995 Bacteria 11133
186 Ga0307416_100000267 3300032002 Bacteria 27603
187 Ga0307414_10022183 3300032004 Bacteria 4000
188 Ga0307415_100003256 3300032126 Bacteria 8245
189 Ga0373926_0013017 3300035083 Bacteria 2817
190 Ga0373951_0043198 3300035091 Bacteria 1092
191 Ga0373939_0103632 3300035114 Bacteria 980
192 Ga0373941_0076907 3300035115 Bacteria 1120
193 Ga0373960_0053467 3300035121 Bacteria 1205
194 Ga0373942_0120514 3300035207 Bacteria 819
195 Ga0316574_0053743 3300035398 Bacteria 2515
196 Ga0373931_0342701 3300035691 Bacteria 934
197 Ga0373935_0034517 3300035692 Bacteria 3153
198 Ga0373933_0017896 3300035724 Bacteria 3979
199 Ga0373937_0128118 3300036401 Bacteria 2369
200 Ga0316582_0004729 3300036647 Bacteria 6930
201 Ga0316584_0117670 3300036712 Bacteria 1987
202 Ga0316584_0292257 3300036712 Bacteria 1182
203 Ga0316584_0379215 3300036712 Bacteria 1011
204 Ga0316584_0437467 3300036712 Bacteria 927
205 Ga0373925_0019790 3300037068 Bacteria 4899
206 Ga0395899_0012968 3300037312 Bacteria 6375
207 Ga0395899_0015891 3300037312 Bacteria 5739
208 Ga0395900_0005889 3300037418 Bacteria 12802
209 Ga0395900_0010329 3300037418 Bacteria 9552
210 Ga0395900_0101403 3300037418 Bacteria 2957
211 Ga0395900_0657713 3300037418 Bacteria 984
212 Ga0395898_0010467 3300037466 Bacteria 9695
213 Ga0395898_0012628 3300037466 Bacteria 8731
214 Ga0395898_0034418 3300037466 Bacteria 5049
215 Ga0395905_0000043 3300037471 Bacteria 247469
216 Ga0395905_0003654 3300037471 Bacteria 16316
217 Ga0395905_0005492 3300037471 Bacteria 12930
218 Ga0395905_0005793 3300037471 Bacteria 12552
219 Ga0395905_0027008 3300037471 Bacteria 5413
220 Ga0395905_0059565 3300037471 Bacteria 3569
221 Ga0395905_0457759 3300037471 Bacteria 1174
222 Ga0436364_0502225 3300037853 Bacteria 6656
223 Ga0436364_1361345 3300037853 Bacteria 1871
224 Ga0395901_0039215 3300038443 Bacteria 4901
225 Ga0395901_0175607 3300038443 Bacteria 2247
226 Ga0395901_0500806 3300038443 Bacteria 1237
227 Ga0400489_88230 3300039093 Bacteria 1643
228 Ga0436365_0174563 3300039437 Bacteria 17649
229 Ga0436365_0920278 3300039437 Bacteria 78160
230 Ga0436363_0582237 3300039450 Bacteria 12110
231 Ga0436363_1194870 3300039450 Bacteria 12394
232 Ga0436363_1286656 3300039450 Bacteria 1096
233 Ga0436362_1147084 3300039453 Bacteria 2291
234 Ga0439453_0036615 3300041408 Bacteria 948
235 Ga0439441_003070 3300042001 Bacteria 2420
236 Ga0450891_008145 3300042129 Bacteria 962
237 Ga0439435_0001446 3300042436 Bacteria 4391
238 Ga0439444_0002669 3300042437 Bacteria 2460
239 Ga0450893_0002052 3300042532 Bacteria 3137
240 Ga0451577_0031796 3300042876 Bacteria 4760
241 Ga0451577_0054925 3300042876 Bacteria 3555
242 Ga0451577_0222198 3300042876 Bacteria 1707
243 Ga0451577_0459055 3300042876 Bacteria 1157
244 Ga0453683_0000024 3300044673 Bacteria 263554
245 Ga0453683_0034851 3300044673 Bacteria 3173
246 Ga0466965_0062370 3300044683 Bacteria 1865
247 Ga0466963_0040162 3300044694 Bacteria 3067
248 Ga0466963_0226577 3300044694 Bacteria 1309
249 Ga0453684_0003702 3300044712 Bacteria 33878
250 Ga0453684_0018131 3300044712 Bacteria 10835
251 Ga0453684_0021476 3300044712 Bacteria 9644
252 Ga0453684_0029954 3300044712 Bacteria 7705
253 Ga0451576_0001079 3300045051 Bacteria 49994
254 Ga0495580_0013886 3300046472 Bacteria 6132
255 Ga0495580_0054729 3300046472 Bacteria 2813
256 Ga0495594_0145813 3300046499 Bacteria 1343
257 Ga0495640_0080340 3300046533 Bacteria 2169
258 Ga0495586_0069059 3300046535 Bacteria 1928
259 Ga0495670_0141021 3300046691 Bacteria 1260
260 Ga0496102_0095242 3300048905 Bacteria 2759
261 Ga0496102_0932679 3300048905 Bacteria 789
262 Ga0496103_0343213 3300048906 Bacteria 960
263 Ga0496104_0001182 3300048907 Bacteria 22456
264 Ga0496104_0208951 3300048907 Bacteria 1864
265 Ga0496105_0004293 3300048908 Bacteria 10730
266 Ga0496107_0307518 3300048910 Bacteria 1180
267 Ga0496108_0001166 3300048911 Bacteria 20501
268 Ga0496109_0006361 3300048912 Bacteria 9947
269 Ga0496109_0083823 3300048912 Bacteria 2940
270 Ga0496110_0000322 3300048913 Bacteria 31856
271 Ga0496111_0028919 3300048914 Bacteria 3931
272 Ga0496112_0017419 3300048915 Bacteria 6749
273 Ga0496112_0040762 3300048915 Bacteria 4541
274 Ga0496112_0555031 3300048915 Bacteria 1082
275 Ga0496113_0008484 3300048916 Bacteria 6698
276 Ga0501034_0000268 3300049571 Bacteria 94149
277 Ga0501036_0357503 3300049572 Bacteria 1219
278 Ga0501042_0061432 3300049578 Bacteria 2685
279 Ga0501071_0437516 3300049587 Bacteria 1000
280 Ga0501072_0008314 3300049588 Bacteria 7882
281 Ga0501076_0127974 3300049592 Bacteria 2059
282 Ga0501080_0535711 3300049742 Bacteria 1044
283 Ga0501083_0268194 3300049744 Bacteria 1110
284 nmdc:mga03n38_13759_c1 3300050490 Bacteria 3083
285 nmdc:mga00v17_293213_c1 3300050491 Bacteria 1056
286 nmdc:mga06z11_298_c1 3300050494 Bacteria 19073
287 nmdc:mga04h51_816_c1 3300050495 Bacteria 7225
288 nmdc:mga05p37_291674_c1 3300050507 Bacteria 1942
289 nmdc:mga05p37_660_c1 3300050507 Bacteria 38072
290 nmdc:mga05p37_6823_c1 3300050507 Bacteria 11190
291 nmdc:mga05p37_801762_c1 3300050507 Bacteria 1030
292 nmdc:mga09592_199598_c1 3300050508 Bacteria 1732
293 nmdc:mga09592_22332_c1 3300050508 Bacteria 5222
294 nmdc:mga0qj67_162355_c1 3300050509 Bacteria 1814
295 nmdc:mga06r32_1539_c1 3300050510 Bacteria 20765
296 nmdc:mga0n895_217339_c1 3300050512 Bacteria 1941
297 nmdc:mga0n895_4500_c1 3300050512 Bacteria 11464
298 nmdc:mga0n895_498333_c1 3300050512 Bacteria 1227
299 nmdc:mga0n895_8216_c1 3300050512 Bacteria 9024
300 nmdc:mga0n895_9728_c1 3300050512 Bacteria 8432
301 nmdc:mga0rr50_22659_c1 3300050513 Bacteria 4315
302 nmdc:mga0rr50_396120_c1 3300050513 Unclassified 1166
303 nmdc:mga0rr50_55912_c1 3300050513 Bacteria 2946
304 nmdc:mga0rr50_56415_c1 3300050513 Bacteria 2935
305 nmdc:mga0rr50_87059_c1 3300050513 Bacteria 2424
306 nmdc:mga08x19_107652_c1 3300050514 Bacteria 1856
307 nmdc:mga0a205_110864_c1 3300050515 Bacteria 2643
308 nmdc:mga0a205_12057_c1 3300050515 Bacteria 7986
309 nmdc:mga0a205_27855_c1 3300050515 Bacteria 2694
310 nmdc:mga0a205_33819_c1 3300050515 Bacteria 4902
311 nmdc:mga0a205_3969_c2 3300050515 Bacteria 4055
312 nmdc:mga0a205_60745_c1 3300050515 Bacteria 3650
313 Ga0501084_0074638 3300054114 Bacteria 2840
314 Ga0501084_0109591 3300054114 Bacteria 2320
315 Ga0501084_0347479 3300054114 Bacteria 1253
316 Ga0501082_0576588 3300060353 Bacteria 984
317 2509078939 2508501114 Bacteria 7082538
318 2828307119 2828305725 Bacteria 4916900
319 Ga0207648_10207503
320 ARcpr5oldR_c004384
321 JGI25151J46595_10056509
322 JGI25407J50210_10018555
323 JGI25407J50210_10030796
324 Ga0065717_1004435
325 Ga0065704_10021446
326 Ga0065712_10008621
327 Ga0065715_10015729
328 Ga0065715_10161268
329 Ga0065707_10008154
330 Ga0065707_10432258
331 Ga0070676_10016320
332 Ga0070690_100132026
333 Ga0070670_100001233
334 Ga0068869_100504561
335 Ga0070666_10015762
336 Ga0070666_10126406
337 Ga0070680_100015677
338 Ga0070682_100246370
339 Ga0068868_100111662
340 Ga0070660_100022097
341 Ga0070660_100384336
342 Ga0070689_100058497
343 Ga0070691_10204363
344 Ga0070691_10220853
345 Ga0070661_100261399
346 Ga0070692_10069090
347 Ga0070668_100033584
348 Ga0070668_100120541
349 Ga0070669_100018879
350 Ga0070669_100403295
351 Ga0070675_100047444
352 Ga0070675_100392108
353 Ga0070671_100216056
354 Ga0070674_100417405
355 Ga0070673_100008123
356 Ga0070673_100212672
357 Ga0070659_100041380
358 Ga0070705_100135874
359 Ga0070705_100299480
360 Ga0070700_100133839
361 Ga0070663_100092240
362 Ga0070678_100021032
363 Ga0070678_100092314
364 Ga0070681_10003478
365 Ga0070681_10017923
366 Ga0070706_100162261
367 Ga0070699_100000512
368 Ga0070679_100243189
369 Ga0070684_100768742
370 Ga0070697_100599409
371 Ga0070672_100011815
372 Ga0070686_100162903
373 Ga0070686_100309153
374 Ga0070695_100011240
375 Ga0070695_100232720
376 Ga0070693_100071388
377 Ga0070693_100266487
378 Ga0070665_100180443
379 Ga0070665_100540090
380 Ga0070704_100107426
381 Ga0070704_100134383
382 Ga0068855_100043861
383 Ga0070664_100322741
384 Ga0068857_100036141
385 Ga0068854_100165423
386 Ga0068856_100031245
387 Ga0070702_100391978
388 Ga0068858_100590528
389 Ga0068860_100359463
390 Ga0068860_100672297
391 Ga0068862_100296909
392 Ga0081538_10001467
393 Ga0081538_10003466
394 Ga0081539_10057126
395 Ga0075368_10006319
396 Ga0075363_100021718
397 Ga0075364_10288774
398 Ga0075367_10147505
399 Ga0075367_10346692
400 Ga0097621_100419981
401 Ga0075428_100000498
402 Ga0075430_100119249
403 Ga0075431_100170206
404 Ga0075433_10006491
405 Ga0075433_10012968
406 Ga0075433_10013035
407 Ga0075433_10062693
408 Ga0075433_10070929
409 Ga0075433_10091165
410 Ga0075434_100002299
411 Ga0075434_100005263
412 Ga0075434_100108403
413 Ga0075434_100262732
414 Ga0075429_100068250
415 Ga0075429_100179383
416 Ga0075429_100181835
417 Ga0068865_100032432
418 Ga0075436_100004808
419 Ga0075436_100050851
420 Ga0075435_100010407
421 Ga0075435_100021316
422 Ga0075435_100043182
423 Ga0075435_100098532
424 Ga0075435_100104784
425 Ga0111539_10066735
426 Ga0111539_10223348
427 Ga0111539_10532550
428 Ga0114129_10001993
429 Ga0114129_10009036
430 Ga0114129_10040825
431 Ga0114129_10813261
432 Ga0105241_10061782
433 Ga0105237_10066329
434 Ga0105239_10155207
435 Ga0105246_10350775
436 Ga0157373_10166923
437 Ga0157374_10224796
438 Ga0157378_10032985
439 Ga0157378_10125968
440 Ga0157378_10370248
441 Ga0163162_10062510
442 Ga0157372_10323512
443 Ga0157375_10217451
444 Ga0163163_10114388
445 Ga0157380_10016045
446 Ga0157376_10063838
447 Ga0157376_10237472
448 Ga0213874_10001049
449 Ga0213876_10003427
450 Ga0213876_10023454
451 Ga0213875_10006703
452 Ga0213875_10119294
453 Ga0207697_10004842
454 Ga0207680_10023191
455 Ga0207680_10151042
456 Ga0207645_10004447
457 Ga0207684_10190906
458 Ga0207654_10269043
459 Ga0207707_10020467
460 Ga0207671_10048639
461 Ga0207657_10001822
462 Ga0207657_10316062
463 Ga0207649_10058400
464 Ga0207652_10230558
465 Ga0207681_10285713
466 Ga0207650_10002518
467 Ga0207659_10072201
468 Ga0207644_10057410
469 Ga0207644_10074518
470 Ga0207690_10016009
471 Ga0207706_10014809
472 Ga0207706_10069055
473 Ga0207670_10168967
474 Ga0207691_10050110
475 Ga0207679_10019538
476 Ga0207667_10031897
477 Ga0207651_10093978
478 Ga0207668_10146798
479 Ga0207640_10079755
480 Ga0207703_10502049
481 Ga0207678_10019937
482 Ga0207641_10105782
483 Ga0207683_10009619
484 Ga0207683_10023348
485 Ga0209813_10001094
486 Ga0207428_10114948
487 Ga0268266_10589872
488 Ga0268265_10181886
489 Ga0268264_10260046
490 Ga0268264_10542633
491 Ga0307515_10096463
492 Ga0307408_100048749
493 Ga0316575_10045499
494 Ga0316575_10106770
495 Ga0316579_10029109
496 Ga0316578_10032069
497 Ga0316578_10132211
498 Ga0307405_10001841
499 Ga0307413_10021951
500 Ga0307410_10043908
501 Ga0307406_10005159
502 Ga0307407_10001003
503 Ga0307409_100001685
504 Ga0307416_100000267
505 Ga0307414_10022183
506 Ga0307415_100003256
507 Ga0373926_0013017
508 Ga0373951_0043198
509 Ga0373939_0103632
510 Ga0373941_0076907
511 Ga0373960_0053467
512 Ga0373942_0120514
513 Ga0316574_0053743
514 Ga0373931_0342701
515 Ga0373935_0034517
516 Ga0373933_0017896
517 Ga0373937_0128118
518 Ga0316582_0004729
519 Ga0316584_0117670
520 Ga0316584_0292257
521 Ga0316584_0379215
522 Ga0316584_0437467
523 Ga0373925_0019790
524 Ga0395899_0012968
525 Ga0395899_0015891
526 Ga0395900_0005889
527 Ga0395900_0010329
528 Ga0395900_0101403
529 Ga0395900_0657713
530 Ga0395898_0010467
531 Ga0395898_0012628
532 Ga0395898_0034418
533 Ga0395905_0000043
534 Ga0395905_0003654
535 Ga0395905_0005492
536 Ga0395905_0005793
537 Ga0395905_0027008
538 Ga0395905_0059565
539 Ga0395905_0457759
540 Ga0436364_0502225
541 Ga0436364_1361345
542 Ga0395901_0039215
543 Ga0395901_0175607
544 Ga0395901_0500806
545 Ga0400489_88230
546 Ga0436365_0174563
547 Ga0436365_0920278
548 Ga0436363_0582237
549 Ga0436363_1194870
550 Ga0436363_1286656
551 Ga0436362_1147084
552 Ga0439453_0036615
553 Ga0439441_003070
554 Ga0450891_008145
555 Ga0439435_0001446
556 Ga0439444_0002669
557 Ga0450893_0002052
558 Ga0451577_0031796
559 Ga0451577_0054925
560 Ga0451577_0222198
561 Ga0451577_0459055
562 Ga0453683_0000024
563 Ga0453683_0034851
564 Ga0466965_0062370
565 Ga0466963_0040162
566 Ga0466963_0226577
567 Ga0453684_0003702
568 Ga0453684_0018131
569 Ga0453684_0021476
570 Ga0453684_0029954
571 Ga0451576_0001079
572 Ga0495580_0013886
573 Ga0495580_0054729
574 Ga0495594_0145813
575 Ga0495640_0080340
576 Ga0495586_0069059
577 Ga0495670_0141021
578 Ga0496102_0095242
579 Ga0496102_0932679
580 Ga0496103_0343213
581 Ga0496104_0001182
582 Ga0496104_0208951
583 Ga0496105_0004293
584 Ga0496107_0307518
585 Ga0496108_0001166
586 Ga0496109_0006361
587 Ga0496109_0083823
588 Ga0496110_0000322
589 Ga0496111_0028919
590 Ga0496112_0017419
591 Ga0496112_0040762
592 Ga0496112_0555031
593 Ga0496113_0008484
594 Ga0501034_0000268
595 Ga0501036_0357503
596 Ga0501042_0061432
597 Ga0501071_0437516
598 Ga0501072_0008314
599 Ga0501076_0127974
600 Ga0501080_0535711
601 Ga0501083_0268194
602 nmdc:mga03n38_13759_c1
603 nmdc:mga00v17_293213_c1
604 nmdc:mga06z11_298_c1
605 nmdc:mga04h51_816_c1
606 nmdc:mga05p37_291674_c1
607 nmdc:mga05p37_660_c1
608 nmdc:mga05p37_6823_c1
609 nmdc:mga05p37_801762_c1
610 nmdc:mga09592_199598_c1
611 nmdc:mga09592_22332_c1
612 nmdc:mga0qj67_162355_c1
613 nmdc:mga06r32_1539_c1
614 nmdc:mga0n895_217339_c1
615 nmdc:mga0n895_4500_c1
616 nmdc:mga0n895_498333_c1
617 nmdc:mga0n895_8216_c1
618 nmdc:mga0n895_9728_c1
619 nmdc:mga0rr50_22659_c1
620 nmdc:mga0rr50_396120_c1
621 nmdc:mga0rr50_55912_c1
622 nmdc:mga0rr50_56415_c1
623 nmdc:mga0rr50_87059_c1
624 nmdc:mga08x19_107652_c1
625 nmdc:mga0a205_110864_c1
626 nmdc:mga0a205_12057_c1
627 nmdc:mga0a205_27855_c1
628 nmdc:mga0a205_33819_c1
629 nmdc:mga0a205_3969_c2
630 nmdc:mga0a205_60745_c1
631 Ga0501084_0074638
632 Ga0501084_0109591
633 Ga0501084_0347479
634 Ga0501082_0576588
635 2509078939
636 2828307119

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

21

165

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.9578 1 237
1ji0-assembly1.cif.gz_A crystal structure analysis of the abc transporter from thermotoga maritima 0.9539 1 237
6b89-assembly1.cif.gz_A e. coli lptb in complex with adp and novobiocin 0.9301 6 234
4p33-assembly1.cif.gz_A crystal structure of e. coli lptb-e163q in complex with atp-sodium 0.9221 6 236
4tqu-assembly1.cif.gz_T crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate 0.9171 4 224
ID Description Score Start End Superfamily
af_P22731_1_237_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.983 1 237 3.40.50.300
af_Q58664_1_235_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9699 6 236 3.40.50.300
af_Q58664_1_235_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9497 6 236 3.40.50.300
1ji0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9429 1 237 3.40.50.300
1ji0A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9351 1 237 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A7X8Z9E7-F1-model_v4 ABC transporter ATP-binding protein 0.9902 6 237 GO:0005524
GO:0015658
GO:0015807
GO:0016887
AF-A0A521VCI3-F1-model_v4 Aldehyde dehydrogenase family protein 0.9894 4 237 GO:0005524
GO:0005886
GO:0016620
GO:0016887
AF-A0A327KAN9-F1-model_v4 deleted 0.9867 1 237
AF-A0A238D136-F1-model_v4 Leucine/isoleucine/valine transporter subunit ATP-binding component of ABC superfamily 0.9862 5 236 GO:0005524
GO:0005886
GO:0015658
GO:0015807
GO:0016887
AF-A0A854GVC9-F1-model_v4 deleted 0.9855 6 234

Map