F404273

General Info

Members Datasets Scaffolds Average Seq Length
317 205 302 645

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0001207|Ga0451577_0001207_27958_29955
Length 656
Sequence MASTLSLILLYLVAAVAGVVLCRSLKLPPMLGYLVVGVLIGPNALALAKDSTAVRVLAEFGVVFLMFVIGLEFNLPKLRSMRTMVFGLGLSQVALTILGAVAGNVLLALGFAWIGVQWDLDWQGAVVLGSAMAMSSTAIVVKMMAERLELESEHGRRVMGVLLFQDLAVVPLLVLIPALDSSGSDMIRSLGLALVKAIGVLALXXXGGQKLMRWWLTLVARRKSDELFVLNLLLVTLGLAWLTEHAGLSLALGAFVAGMLIAETEYKHQVETDIRPFHDVLLGLFFITIGMKLDWRAVWGEWPLVLLLTLVPVAAKAALVAGLARAFRAAPGVALRTGLYLAQAGEFGFVLLTLGAENKLIHPQWVSPVLASMVLSMLATPLLIEYSNRIVMRLAASDWLMQSVALTAIAKKAIRTERHIIICGFGRSGQNLARLLEQEHMPYMALDLDPDRVRQAAAAGQSVVFGDAARLQSLMAAGLARASAVVISYPDTPSALKILDLVRQHAPQVPVVVRTIDDADLERLREAGAAEVVPEAVEGSLMLASHALALVGVPMRRVIRYRLLRGYFHGADDDTVEELNQARLLSVSLPHTAASIGSTLGELALHALDVNVVSVRRLDGRPATPHDELRLAGGDTLVLAGLPETLALAESKLLTG

Samples

Sample ID Description Type Environment
1 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
2 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
3 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
4 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
5 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
6 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
7 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
8 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
9 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
10 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
11 2643221660 Methylibium sp. Root1272 Isolate Unclassified
12 2738541337 Pelomonas sp. BT06 Isolate Unclassified
13 2831864461 Roseateles noduli HZ7 Isolate Nodule
14 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
15 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
16 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
17 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
18 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
19 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
20 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
21 3300003347 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM Metagenome Rhizosphere
22 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
23 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
24 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
25 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
26 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
27 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
28 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
29 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
30 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
71 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
82 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
90 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
91 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
93 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
96 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
97 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
99 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
136 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
137 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
143 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
144 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
147 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
148 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
149 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
152 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
153 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
154 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
155 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
158 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
159 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
160 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
161 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
162 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
163 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
164 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
165 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
166 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
167 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
168 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
169 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
170 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
171 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
172 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
173 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
174 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
175 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
176 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
177 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
178 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
179 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
180 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
181 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
182 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
183 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
184 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
185 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
186 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
187 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
188 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
189 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
190 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
191 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
192 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
193 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
194 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
195 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
196 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
197 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
198 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
199 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
200 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
201 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
202 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
203 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
204 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
205 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.27
Metatranscriptomes 0
Isolates 4.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 20.82
Nodule 1.58
Rhizoplane 2.84
Rhizosphere 63.41
Stem 0
Stem Tuber 0
Unclassified 11.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1001209 3300002773 Bacteria 11840
2 JGI25153J46596_10004156 3300003215 Bacteria 7862
3 JGI25153J46596_10004893 3300003215 Bacteria 7120
4 rootH1_10010554 3300003316 Bacteria 5937
5 rootH2_10036922 3300003320 Bacteria 6136
6 rootL2_10002498 3300003322 Bacteria 21284
7 JGI26128J50194_1000064 3300003347 Bacteria 3803
8 Ga0055526_1001358 3300003771 Bacteria 17500
9 Ga0055526_1003640 3300003771 Bacteria 9652
10 Ga0055524_1000767 3300003775 Bacteria 21616
11 Ga0055524_1004842 3300003775 Bacteria 6132
12 Ga0055530_10002059 3300003791 Bacteria 13520
13 Ga0055540_1000093 3300003792 Bacteria 98452
14 Ga0055540_1001500 3300003792 Bacteria 13871
15 Ga0055540_1001920 3300003792 Bacteria 11616
16 Ga0055531_10000381 3300003794 Bacteria 42797
17 Ga0055531_10000519 3300003794 Bacteria 34728
18 Ga0055531_10002435 3300003794 Bacteria 12458
19 Ga0055531_10015092 3300003794 Bacteria 3429
20 Ga0065165_1000304 3300005262 Bacteria 81791
21 Ga0065165_1000757 3300005262 Bacteria 43947
22 Ga0065165_1002631 3300005262 Bacteria 14600
23 Ga0070676_10001764 3300005328 Bacteria 11005
24 Ga0070690_100009814 3300005330 Bacteria 5556
25 Ga0070690_100014100 3300005330 Bacteria 4737
26 Ga0070677_10019849 3300005333 Bacteria 2441
27 Ga0068869_100006725 3300005334 Bacteria 7306
28 Ga0068868_100001433 3300005338 Bacteria 16455
29 Ga0068868_100056975 3300005338 Bacteria 3087
30 Ga0070661_100015155 3300005344 Bacteria 5439
31 Ga0070668_100074089 3300005347 Bacteria 2655
32 Ga0070669_100006667 3300005353 Bacteria 8314
33 Ga0070675_100003315 3300005354 Bacteria 12210
34 Ga0070675_100005579 3300005354 Bacteria 9635
35 Ga0070671_100008293 3300005355 Bacteria 8313
36 Ga0070671_100046334 3300005355 Bacteria 3616
37 Ga0070674_100004102 3300005356 Bacteria 8277
38 Ga0070674_100038562 3300005356 Bacteria 3220
39 Ga0070673_100004055 3300005364 Bacteria 9225
40 Ga0070673_100022956 3300005364 Bacteria 4552
41 Ga0070659_100018492 3300005366 Bacteria 5258
42 Ga0070659_100046600 3300005366 Bacteria 3398
43 Ga0070667_100022153 3300005367 Bacteria 5271
44 Ga0070663_100000964 3300005455 Bacteria 15641
45 Ga0070678_100002517 3300005456 Bacteria 10055
46 Ga0070678_100060412 3300005456 Bacteria 2790
47 Ga0070678_100081533 3300005456 Bacteria 2453
48 Ga0070662_100073557 3300005457 Bacteria 2525
49 Ga0068867_100000004 3300005459 Bacteria 180739
50 Ga0068867_100003698 3300005459 Bacteria 10761
51 Ga0068867_100011554 3300005459 Bacteria 6233
52 Ga0070706_100004299 3300005467 Bacteria 13799
53 Ga0070698_100052058 3300005471 Bacteria 4168
54 Ga0070679_100006893 3300005530 Bacteria 10595
55 Ga0070672_100010971 3300005543 Bacteria 6305
56 Ga0070693_100026423 3300005547 Bacteria 3134
57 Ga0068856_100008539 3300005614 Bacteria 9955
58 Ga0068856_100017593 3300005614 Bacteria 6927
59 Ga0070702_100002781 3300005615 Bacteria 7671
60 Ga0068852_100012535 3300005616 Bacteria 6441
61 Ga0068859_100016053 3300005617 Bacteria 7524
62 Ga0068864_100001208 3300005618 Bacteria 21454
63 Ga0068864_100002757 3300005618 Bacteria 14488
64 Ga0068864_100009046 3300005618 Bacteria 8209
65 Ga0068864_100013477 3300005618 Bacteria 6778
66 Ga0068861_100023628 3300005719 Bacteria 4436
67 Ga0068863_100002785 3300005841 Bacteria 17318
68 Ga0068858_100001797 3300005842 Bacteria 21879
69 Ga0068858_100018840 3300005842 Bacteria 6460
70 Ga0068858_100025782 3300005842 Bacteria 5468
71 Ga0068860_100004827 3300005843 Bacteria 13727
72 Ga0068862_100015253 3300005844 Bacteria 6381
73 Ga0068862_100042321 3300005844 Bacteria 3880
74 Ga0075365_10009510 3300006038 Bacteria 5594
75 Ga0075367_10016014 3300006178 Bacteria 4088
76 Ga0075367_10032723 3300006178 Bacteria 2994
77 Ga0075366_10006106 3300006195 Bacteria 6567
78 Ga0075366_10023425 3300006195 Bacteria 3596
79 Ga0097621_100011919 3300006237 Bacteria 6430
80 Ga0075370_10006993 3300006353 Bacteria 5718
81 Ga0068871_100070815 3300006358 Bacteria 2866
82 Ga0075429_100003990 3300006880 Bacteria 12633
83 Ga0068865_100036742 3300006881 Bacteria 3304
84 Ga0097620_100016053 3300006931 Bacteria 7524
85 Ga0099823_1000015 3300006944 Bacteria 88096
86 Ga0079104_1000138 3300006946 Bacteria 103200
87 Ga0105240_10009585 3300009093 Bacteria 13711
88 Ga0105240_10017227 3300009093 Bacteria 9745
89 Ga0105245_10035094 3300009098 Bacteria 4450
90 Ga0105243_10027034 3300009148 Bacteria 4394
91 Ga0105242_10002020 3300009176 Bacteria 15962
92 Ga0105242_10057743 3300009176 Bacteria 3179
93 Ga0105248_10005310 3300009177 Bacteria 14180
94 Ga0105248_10016999 3300009177 Bacteria 8012
95 Ga0105237_10000416 3300009545 Bacteria 60732
96 Ga0105238_10015940 3300009551 Bacteria 7603
97 Ga0105238_10025061 3300009551 Bacteria 6080
98 Ga0105249_10005308 3300009553 Bacteria 11126
99 Ga0105249_10016976 3300009553 Bacteria 6458
100 Ga0105239_10004117 3300010375 Bacteria 17476
101 Ga0157317_1000016 3300012475 Bacteria 3707
102 Ga0157319_1000052 3300012497 Bacteria 13081
103 Ga0157374_10018030 3300013296 Bacteria 6224
104 Ga0157374_10100243 3300013296 Bacteria 2776
105 Ga0157374_10181844 3300013296 Bacteria 2054
106 Ga0163162_10053777 3300013306 Bacteria 4047
107 Ga0157375_10008643 3300013308 Bacteria 8921
108 Ga0157380_10021063 3300014326 Bacteria 4885
109 Ga0157377_10000010 3300014745 Bacteria 380929
110 Ga0157377_10003708 3300014745 Bacteria 6933
111 Ga0157379_10005448 3300014968 Bacteria 10934
112 Ga0183362_10004 3300015683 Bacteria 569303
113 Ga0213872_10000266 3300021361 Bacteria 45265
114 Ga0213872_10000942 3300021361 Bacteria 20402
115 Ga0209258_102381 3300025242 Bacteria 4942
116 Ga0209129_1000038 3300025258 Bacteria 322778
117 Ga0209565_1009008 3300025263 Bacteria 2569
118 Ga0209673_1006481 3300025273 Bacteria 5643
119 Ga0209673_1007269 3300025273 Bacteria 5143
120 Ga0209673_1015514 3300025273 Bacteria 2889
121 Ga0209564_1000030 3300025295 Bacteria 503296
122 Ga0209564_1000129 3300025295 Bacteria 195163
123 Ga0209758_1000197 3300025297 Bacteria 133706
124 Ga0209758_1000213 3300025297 Bacteria 126745
125 Ga0209050_1000665 3300025298 Bacteria 52282
126 Ga0209050_1000720 3300025298 Bacteria 48448
127 Ga0209050_1004254 3300025298 Bacteria 9835
128 Ga0209050_1004534 3300025298 Bacteria 9337
129 Ga0209256_1000627 3300025299 Bacteria 48553
130 Ga0209256_1002480 3300025299 Bacteria 14960
131 Ga0209256_1003003 3300025299 Bacteria 12523
132 Ga0209051_1000004 3300025303 Bacteria 1155596
133 Ga0209051_1000241 3300025303 Bacteria 91816
134 Ga0209051_1006375 3300025303 Bacteria 6669
135 Ga0209051_1012210 3300025303 Bacteria 4167
136 Ga0209051_1015559 3300025303 Bacteria 3492
137 Ga0209257_1000015 3300025304 Bacteria 908141
138 Ga0209257_1000117 3300025304 Bacteria 227328
139 Ga0209257_1002798 3300025304 Bacteria 16425
140 Ga0209257_1003755 3300025304 Bacteria 12548
141 Ga0209257_1007051 3300025304 Bacteria 6950
142 Ga0207642_10004055 3300025899 Bacteria 4690
143 Ga0207680_10001011 3300025903 Bacteria 13260
144 Ga0207680_10011475 3300025903 Bacteria 4479
145 Ga0207645_10015709 3300025907 Bacteria 5022
146 Ga0207684_10026545 3300025910 Bacteria 4938
147 Ga0207671_10010715 3300025914 Bacteria 7538
148 Ga0207662_10004068 3300025918 Bacteria 7635
149 Ga0207649_10003379 3300025920 Bacteria 8727
150 Ga0207652_10013150 3300025921 Bacteria 6700
151 Ga0207646_10076129 3300025922 Bacteria 2998
152 Ga0207681_10011557 3300025923 Bacteria 5424
153 Ga0207681_10057940 3300025923 Bacteria 2650
154 Ga0207694_10051410 3300025924 Bacteria 3194
155 Ga0207650_10018010 3300025925 Bacteria 4951
156 Ga0207659_10004962 3300025926 Bacteria 8066
157 Ga0207659_10013973 3300025926 Bacteria 5165
158 Ga0207659_10057494 3300025926 Bacteria 2789
159 Ga0207644_10000278 3300025931 Bacteria 33992
160 Ga0207706_10005445 3300025933 Bacteria 11860
161 Ga0207706_10097605 3300025933 Bacteria 2584
162 Ga0207709_10041432 3300025935 Bacteria 2763
163 Ga0207704_10006529 3300025938 Bacteria 5447
164 Ga0207691_10013575 3300025940 Bacteria 7789
165 Ga0207691_10028626 3300025940 Bacteria 5216
166 Ga0207711_10010091 3300025941 Bacteria 7848
167 Ga0207711_10010274 3300025941 Bacteria 7774
168 Ga0207711_10019160 3300025941 Bacteria 5696
169 Ga0207689_10003774 3300025942 Bacteria 13801
170 Ga0207689_10019919 3300025942 Bacteria 5651
171 Ga0207679_10000629 3300025945 Bacteria 23458
172 Ga0207667_10012502 3300025949 Bacteria 9772
173 Ga0207651_10000886 3300025960 Bacteria 13121
174 Ga0207712_10005871 3300025961 Bacteria 7737
175 Ga0207640_10014888 3300025981 Bacteria 4488
176 Ga0207658_10000458 3300025986 Bacteria 38200
177 Ga0207658_10001308 3300025986 Bacteria 19644
178 Ga0207658_10009817 3300025986 Bacteria 6498
179 Ga0207677_10006515 3300026023 Bacteria 6413
180 Ga0207677_10054826 3300026023 Bacteria 2723
181 Ga0207703_10002931 3300026035 Bacteria 14518
182 Ga0207703_10006896 3300026035 Bacteria 9042
183 Ga0207678_10001133 3300026067 Bacteria 24407
184 Ga0207641_10016799 3300026088 Bacteria 5992
185 Ga0207641_10028442 3300026088 Bacteria 4619
186 Ga0207648_10000002 3300026089 Bacteria 307909
187 Ga0207648_10008460 3300026089 Bacteria 9961
188 Ga0207676_10000221 3300026095 Bacteria 49106
189 Ga0207676_10013111 3300026095 Bacteria 5950
190 Ga0207676_10046860 3300026095 Bacteria 3347
191 Ga0207675_100001459 3300026118 Bacteria 23702
192 Ga0207675_100028750 3300026118 Bacteria 5179
193 Ga0207675_100054087 3300026118 Bacteria 3745
194 Ga0207675_100068034 3300026118 Bacteria 3329
195 Ga0207683_10099714 3300026121 Bacteria 2592
196 Ga0209281_1000023 3300027111 Bacteria 519955
197 Ga0209389_1000831 3300027296 Bacteria 19759
198 Ga0209968_1001303 3300027526 Bacteria 3807
199 Ga0209966_1000293 3300027695 Bacteria 16920
200 Ga0209974_10003338 3300027876 Bacteria 5799
201 Ga0268265_10012573 3300028380 Bacteria 5739
202 Ga0268264_10000963 3300028381 Bacteria 29539
203 Ga0268264_10030770 3300028381 Bacteria 4399
204 Ga0307515_10000013 3300028794 Bacteria 568456
205 Ga0307515_10000239 3300028794 Bacteria 135971
206 Ga0307515_10000567 3300028794 Bacteria 87086
207 Ga0307515_10007744 3300028794 Bacteria 21142
208 Ga0307515_10017686 3300028794 Bacteria 12965
209 Ga0307515_10019632 3300028794 Bacteria 12138
210 Ga0307515_10024901 3300028794 Bacteria 10389
211 Ga0307515_10030252 3300028794 Bacteria 9104
212 Ga0307515_10036002 3300028794 Bacteria 8025
213 Ga0307513_10005283 3300031456 Bacteria 17092
214 Ga0307513_10051534 3300031456 Bacteria 4439
215 Ga0307509_10000135 3300031507 Bacteria 109066
216 Ga0307509_10024044 3300031507 Bacteria 6830
217 Ga0307509_10079640 3300031507 Bacteria 3390
218 Ga0307408_100013788 3300031548 Bacteria 5366
219 Ga0307508_10000133 3300031616 Bacteria 87867
220 Ga0307508_10000616 3300031616 Bacteria 42729
221 Ga0307508_10002482 3300031616 Bacteria 19455
222 Ga0307514_10001199 3300031649 Bacteria 34587
223 Ga0307516_10000677 3300031730 Bacteria 46191
224 Ga0307516_10004964 3300031730 Bacteria 16154
225 Ga0307516_10006913 3300031730 Bacteria 13176
226 Ga0307409_100001800 3300031995 Bacteria 10843
227 Ga0307411_10023052 3300032005 Bacteria 3679
228 Ga0307510_10004514 3300033180 Bacteria 16378
229 Ga0307510_10016068 3300033180 Bacteria 8840
230 Ga0373931_0016749 3300035691 Bacteria 3613
231 Ga0395899_0043642 3300037312 Bacteria 3344
232 Ga0395900_0046497 3300037418 Bacteria 4469
233 Ga0395900_0060214 3300037418 Bacteria 3908
234 Ga0395905_0001764 3300037471 Bacteria 25149
235 Ga0395905_0012470 3300037471 Bacteria 8183
236 Ga0395901_0033366 3300038443 Bacteria 5314
237 Ga0395901_0038945 3300038443 Bacteria 4917
238 Ga0395901_0051852 3300038443 Bacteria 4265
239 Ga0436361_0147437 3300039447 Bacteria 84337
240 Ga0436361_0518335 3300039447 Bacteria 20591
241 Ga0436361_0916410 3300039447 Bacteria 83869
242 Ga0436361_1131420 3300039447 Bacteria 9171
243 Ga0439462_0002198 3300042015 Bacteria 4500
244 Ga0450919_000069 3300042121 Bacteria 9607
245 Ga0450892_000365 3300042130 Bacteria 5373
246 Ga0439459_0000443 3300042438 Bacteria 5326
247 Ga0450916_000897 3300042530 Bacteria 2834
248 Ga0450918_000772 3300042531 Bacteria 6776
249 Ga0451577_0001207 3300042876 Bacteria 36165
250 Ga0466969_0000023 3300044656 Bacteria 97322
251 Ga0453683_0007442 3300044673 Bacteria 7427
252 Ga0466966_0003120 3300044684 Bacteria 10904
253 Ga0466961_0005290 3300044693 Bacteria 8122
254 Ga0466961_0044527 3300044693 Bacteria 2839
255 Ga0466959_0000270 3300045049 Bacteria 31887
256 Ga0451576_0016862 3300045051 Bacteria 8048
257 Ga0451576_0020010 3300045051 Bacteria 7295
258 Ga0451576_0125957 3300045051 Bacteria 2669
259 Ga0466958_0048434 3300045836 Bacteria 2568
260 Ga0466967_0039904 3300045976 Bacteria 4039
261 Ga0466967_0066206 3300045976 Bacteria 3218
262 Ga0495592_0002137 3300046454 Bacteria 13908
263 Ga0495583_0000022 3300046506 Bacteria 282544
264 Ga0495606_0001282 3300046507 Bacteria 34808
265 Ga0495625_0035346 3300046660 Bacteria 3684
266 Ga0495669_0034036 3300046684 Bacteria 2245
267 Ga0495649_0000099 3300046694 Bacteria 75713
268 Ga0495676_0039312 3300047321 Bacteria 3919
269 Ga0495686_0000992 3300047472 Bacteria 34617
270 Ga0495593_0046830 3300047673 Bacteria 2303
271 Ga0496102_0045029 3300048905 Bacteria 4005
272 Ga0496104_0021304 3300048907 Bacteria 5949
273 Ga0496106_0010243 3300048909 Bacteria 6930
274 Ga0496108_0037893 3300048911 Bacteria 4017
275 Ga0496108_0088089 3300048911 Bacteria 2637
276 Ga0496113_0029266 3300048916 Bacteria 3975
277 Ga0496113_0057403 3300048916 Bacteria 2925
278 Ga0496114_0001249 3300048917 Bacteria 19250
279 Ga0496115_0084686 3300048918 Bacteria 2585
280 Ga0496124_0000089 3300048927 Bacteria 192423
281 Ga0496125_0068898 3300048928 Bacteria 2780
282 Ga0501198_000003 3300049649 Bacteria 175301
283 Ga0501222_000001 3300049662 Bacteria 307689
284 Ga0501222_002412 3300049662 Bacteria 2593
285 nmdc:mga0k408_18090_c1 3300050493 Bacteria 3930
286 nmdc:mga0k408_18507_c1 3300050493 Bacteria 3889
287 nmdc:mga0k408_2194_c1 3300050493 Bacteria 10472
288 nmdc:mga0k408_33948_c1 3300050493 Bacteria 2919
289 nmdc:mga07m45_2131_c1 3300050496 Bacteria 9210
290 nmdc:mga07m45_6432_c2 3300050496 Bacteria 3897
291 nmdc:mga07m45_7479_c1 3300050496 Bacteria 5584
292 nmdc:mga09592_13623_c1 3300050508 Bacteria 6644
293 Ga0500578_0000393 3300053086 Bacteria 53719
294 Ga0500593_001995 3300053117 Bacteria 7399
295 Ga0500652_001236 3300053131 Bacteria 8122
296 Ga0500559_0000388 3300053136 Bacteria 32263
297 Ga0500568_0024399 3300053139 Bacteria 2561
298 Ga0500619_000167 3300053154 Bacteria 16030
299 Ga0500622_0004817 3300053156 Bacteria 8285
300 Ga0500645_009060 3300053730 Bacteria 3360
301 Ga0590071_001162 3300059421 Bacteria 7115
302 Ga0466962_0032184 3300061719 Bacteria 2510

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048911 Ga0496108_0088089 Ga0496108_0088089_59_2095 585
2 3300005356 Ga0070674_100038562 Ga0070674_1000385622 599
3 3300009553 Ga0105249_10005308 Ga0105249_1000530810 599
4 3300005366 Ga0070659_100046600 Ga0070659_1000466003 600
5 3300005616 Ga0068852_100012535 Ga0068852_1000125356 600
6 3300005328 Ga0070676_10001764 Ga0070676_100017648 601
7 3300005330 Ga0070690_100009814 Ga0070690_1000098142 601
8 3300005334 Ga0068869_100006725 Ga0068869_1000067254 601
9 3300005338 Ga0068868_100056975 Ga0068868_1000569752 601
10 3300005347 Ga0070668_100074089 Ga0070668_1000740892 601
11 3300005353 Ga0070669_100006667 Ga0070669_1000066672 601
12 3300005356 Ga0070674_100004102 Ga0070674_1000041026 601
13 3300005367 Ga0070667_100022153 Ga0070667_1000221533 601
14 3300005459 Ga0068867_100011554 Ga0068867_1000115542 601
15 3300005617 Ga0068859_100016053 Ga0068859_1000160535 601
16 3300005841 Ga0068863_100002785 Ga0068863_1000027858 601
17 3300005842 Ga0068858_100018840 Ga0068858_1000188404 601
18 3300005843 Ga0068860_100004827 Ga0068860_1000048276 601
19 3300005844 Ga0068862_100015253 Ga0068862_1000152534 601
20 3300006931 Ga0097620_100016053 Ga0097620_1000160535 601
21 3300009148 Ga0105243_10027034 Ga0105243_100270342 601
22 3300013308 Ga0157375_10008643 Ga0157375_100086438 601
23 3300014326 Ga0157380_10021063 Ga0157380_100210634 601
24 3300025899 Ga0207642_10004055 Ga0207642_100040551 601
25 3300025903 Ga0207680_10011475 Ga0207680_100114752 601
26 3300025907 Ga0207645_10015709 Ga0207645_100157092 601
27 3300025923 Ga0207681_10011557 Ga0207681_100115573 601
28 3300025935 Ga0207709_10041432 Ga0207709_100414322 601
29 3300025938 Ga0207704_10006529 Ga0207704_100065293 601
30 3300025942 Ga0207689_10019919 Ga0207689_100199192 601
31 3300025961 Ga0207712_10005871 Ga0207712_100058713 601
32 3300025986 Ga0207658_10000458 Ga0207658_1000045831 601
33 3300026023 Ga0207677_10054826 Ga0207677_100548262 601
34 3300026035 Ga0207703_10002931 Ga0207703_100029318 601
35 3300026088 Ga0207641_10016799 Ga0207641_100167992 601
36 3300026118 Ga0207675_100054087 Ga0207675_1000540872 601
37 3300028380 Ga0268265_10012573 Ga0268265_100125733 601
38 3300028381 Ga0268264_10000963 Ga0268264_1000096326 601
39 3300025918 Ga0207662_10004068 Ga0207662_100040683 603
40 3300013296 Ga0157374_10181844 Ga0157374_101818442 614
41 3300028794 Ga0307515_10000013 Ga0307515_10000013404 616
42 3300044684 Ga0466966_0003120 Ga0466966_0003120_7999_9999 619
43 3300044693 Ga0466961_0044527 Ga0466961_0044527_220_2220 619
44 3300045049 Ga0466959_0000270 Ga0466959_0000270_14294_16294 619
45 3300045836 Ga0466958_0048434 Ga0466958_0048434_53_2053 619
46 3300045976 Ga0466967_0066206 Ga0466967_0066206_570_2570 619
47 3300059421 Ga0590071_001162 Ga0590071_001162_4736_6739 619
48 3300003775 Ga0055524_1000767 Ga0055524_100076715 625
49 3300025263 Ga0209565_1009008 Ga0209565_10090082 625
50 3300025299 Ga0209256_1000627 Ga0209256_10006276 625
51 3300048917 Ga0496114_0001249 Ga0496114_0001249_3203_5203 625
52 3300003791 Ga0055530_10002059 Ga0055530_1000205911 626
53 3300003792 Ga0055540_1000093 Ga0055540_100009384 626
54 3300003792 Ga0055540_1001500 Ga0055540_10015008 626
55 3300025298 Ga0209050_1000665 Ga0209050_100066536 626
56 3300025303 Ga0209051_1000004 Ga0209051_1000004439 626
57 3300025304 Ga0209257_1007051 Ga0209257_10070512 626
58 3300044656 Ga0466969_0000023 Ga0466969_0000023_269_2263 626
59 3300044693 Ga0466961_0005290 Ga0466961_0005290_5973_7967 626
60 3300025941 Ga0207711_10019160 Ga0207711_100191602 627
61 3300048916 Ga0496113_0029266 Ga0496113_0029266_144_2141 627
62 3300005455 Ga0070663_100000964 Ga0070663_10000096416 628
63 3300021361 Ga0213872_10000942 Ga0213872_100009426 628
64 3300025923 Ga0207681_10057940 Ga0207681_100579402 628
65 3300025940 Ga0207691_10028626 Ga0207691_100286265 628
66 3300026067 Ga0207678_10001133 Ga0207678_100011337 628
67 3300031995 Ga0307409_100001800 Ga0307409_1000018006 628
68 3300038443 Ga0395901_0051852 Ga0395901_0051852_1455_3428 628
69 3300039447 Ga0436361_0518335 Ga0436361_0518335_12952_14976 628
70 3300042015 Ga0439462_0002198 Ga0439462_0002198_834_2819 628
71 3300045051 Ga0451576_0016862 Ga0451576_0016862_91_2091 628
72 3300006946 Ga0079104_1000138 Ga0079104_100013887 629
73 3300027111 Ga0209281_1000023 Ga0209281_1000023471 629
74 3300037471 Ga0395905_0012470 Ga0395905_0012470_5515_7512 629
75 3300042121 Ga0450919_000069 Ga0450919_000069_4565_6565 629
76 3300042531 Ga0450918_000772 Ga0450918_000772_4738_6738 629
77 3300046684 Ga0495669_0034036 Ga0495669_0034036_91_2079 629
78 3300050508 nmdc:mga09592_13623_c1 nmdc:mga09592_13623_c1_1153_3153 629
79 3300006880 Ga0075429_100003990 Ga0075429_1000039906 630
80 3300013296 Ga0157374_10100243 Ga0157374_101002432 630
81 3300028794 Ga0307515_10030252 Ga0307515_100302525 630
82 3300048927 Ga0496124_0000089 Ga0496124_0000089_92580_94577 630
83 3300005618 Ga0068864_100009046 Ga0068864_1000090466 631
84 3300009176 Ga0105242_10057743 Ga0105242_100577432 631
85 3300031456 Ga0307513_10005283 Ga0307513_1000528310 631
86 3300003215 JGI25153J46596_10004156 JGI25153J46596_100041566 632
87 3300006195 Ga0075366_10006106 Ga0075366_100061065 632
88 3300015683 Ga0183362_10004 Ga0183362_10004244 632
89 3300025297 Ga0209758_1000213 Ga0209758_10002136 632
90 3300044673 Ga0453683_0007442 Ga0453683_0007442_2398_4383 632
91 3300048918 Ga0496115_0084686 Ga0496115_0084686_211_2217 632
92 3300050493 nmdc:mga0k408_2194_c1 nmdc:mga0k408_2194_c1_5122_7122 632
93 3300053154 Ga0500619_000167 Ga0500619_000167_11657_13657 632
94 3300003792 Ga0055540_1001920 Ga0055540_10019203 633
95 3300003794 Ga0055531_10000519 Ga0055531_1000051926 633
96 3300025273 Ga0209673_1007269 Ga0209673_10072694 633
97 3300025303 Ga0209051_1000241 Ga0209051_100024185 633
98 3300025304 Ga0209257_1000015 Ga0209257_1000015225 633
99 3300006358 Ga0068871_100070815 Ga0068871_1000708152 634
100 3300009177 Ga0105248_10016999 Ga0105248_100169994 634
101 3300025925 Ga0207650_10018010 Ga0207650_100180104 634
102 3300025931 Ga0207644_10000278 Ga0207644_100002786 634
103 3300032005 Ga0307411_10023052 Ga0307411_100230524 634
104 3300037418 Ga0395900_0060214 Ga0395900_0060214_1103_3088 634
105 3300038443 Ga0395901_0038945 Ga0395901_0038945_1410_3395 634
106 3300047472 Ga0495686_0000992 Ga0495686_0000992_16287_18290 634
107 3300005456 Ga0070678_100060412 Ga0070678_1000604122 635
108 3300005459 Ga0068867_100000004 Ga0068867_10000000421 635
109 3300014745 Ga0157377_10000010 Ga0157377_1000001085 635
110 3300026089 Ga0207648_10000002 Ga0207648_1000000221 635
111 3300003347 JGI26128J50194_1000064 JGI26128J50194_10000643 636
112 3300005333 Ga0070677_10019849 Ga0070677_100198492 636
113 3300005338 Ga0068868_100001433 Ga0068868_10000143318 636
114 3300005344 Ga0070661_100015155 Ga0070661_1000151551 636
115 3300005354 Ga0070675_100005579 Ga0070675_1000055792 636
116 3300005366 Ga0070659_100018492 Ga0070659_1000184921 636
117 3300005547 Ga0070693_100026423 Ga0070693_1000264232 636
118 3300005614 Ga0068856_100017593 Ga0068856_1000175935 636
119 3300005615 Ga0070702_100002781 Ga0070702_1000027816 636
120 3300005618 Ga0068864_100001208 Ga0068864_10000120818 636
121 3300005842 Ga0068858_100025782 Ga0068858_1000257822 636
122 3300009177 Ga0105248_10005310 Ga0105248_1000531015 636
123 3300013306 Ga0163162_10053777 Ga0163162_100537772 636
124 3300014745 Ga0157377_10003708 Ga0157377_100037087 636
125 3300014968 Ga0157379_10005448 Ga0157379_100054485 636
126 3300025920 Ga0207649_10003379 Ga0207649_100033792 636
127 3300025924 Ga0207694_10051410 Ga0207694_100514102 636
128 3300025926 Ga0207659_10057494 Ga0207659_100574942 636
129 3300025933 Ga0207706_10005445 Ga0207706_100054456 636
130 3300025942 Ga0207689_10003774 Ga0207689_1000377415 636
131 3300025945 Ga0207679_10000629 Ga0207679_100006296 636
132 3300025981 Ga0207640_10014888 Ga0207640_100148881 636
133 3300026118 Ga0207675_100001459 Ga0207675_10000145918 636
134 3300027526 Ga0209968_1001303 Ga0209968_10013033 636
135 3300027695 Ga0209966_1000293 Ga0209966_100029313 636
136 3300035691 Ga0373931_0016749 Ga0373931_0016749_359_2359 636
137 3300048905 Ga0496102_0045029 Ga0496102_0045029_418_2418 636
138 3300048907 Ga0496104_0021304 Ga0496104_0021304_3238_5238 636
139 3300048911 Ga0496108_0037893 Ga0496108_0037893_1053_3053 636
140 3300048916 Ga0496113_0057403 Ga0496113_0057403_146_2146 636
141 3300061719 Ga0466962_0032184 Ga0466962_0032184_234_2231 636
142 3300005457 Ga0070662_100073557 Ga0070662_1000735572 637
143 3300005459 Ga0068867_100003698 Ga0068867_1000036988 637
144 3300025933 Ga0207706_10097605 Ga0207706_100976052 637
145 3300026023 Ga0207677_10006515 Ga0207677_100065155 637
146 3300026089 Ga0207648_10008460 Ga0207648_100084606 637
147 3300039447 Ga0436361_1131420 Ga0436361_1131420_4824_6824 637
148 3300006038 Ga0075365_10009510 Ga0075365_100095105 638
149 3300006178 Ga0075367_10032723 Ga0075367_100327231 638
150 3300006195 Ga0075366_10023425 Ga0075366_100234252 638
151 3300021361 Ga0213872_10000266 Ga0213872_100002668 638
152 3300039447 Ga0436361_0147437 Ga0436361_0147437_10972_12975 638
153 3300028794 Ga0307515_10000239 Ga0307515_1000023933 639
154 3300027876 Ga0209974_10003338 Ga0209974_100033385 640
155 3300031456 Ga0307513_10051534 Ga0307513_100515344 640
156 3300005467 Ga0070706_100004299 Ga0070706_1000042992 642
157 3300005471 Ga0070698_100052058 Ga0070698_1000520582 642
158 3300006178 Ga0075367_10016014 Ga0075367_100160144 642
159 3300025910 Ga0207684_10026545 Ga0207684_100265452 642
160 3300025922 Ga0207646_10076129 Ga0207646_100761292 642
161 3300050493 nmdc:mga0k408_18507_c1 nmdc:mga0k408_18507_c1_913_2913 642
162 3300005364 Ga0070673_100022956 Ga0070673_1000229563 643
163 3300005456 Ga0070678_100081533 Ga0070678_1000815332 643
164 3300005543 Ga0070672_100010971 Ga0070672_1000109713 643
165 3300005618 Ga0068864_100013477 Ga0068864_1000134774 643
166 3300006237 Ga0097621_100011919 Ga0097621_1000119195 643
167 3300025926 Ga0207659_10013973 Ga0207659_100139733 643
168 3300025940 Ga0207691_10013575 Ga0207691_100135755 643
169 3300026095 Ga0207676_10046860 Ga0207676_100468602 643
170 3300026121 Ga0207683_10099714 Ga0207683_100997142 643
171 3300031616 Ga0307508_10000133 Ga0307508_1000013362 645
172 3300037312 Ga0395899_0043642 Ga0395899_0043642_1331_3316 645
173 3300037418 Ga0395900_0046497 Ga0395900_0046497_704_2689 645
174 3300038443 Ga0395901_0033366 Ga0395901_0033366_2833_4818 645
175 3300028794 Ga0307515_10007744 Ga0307515_1000774410 646
176 3300028794 Ga0307515_10019632 Ga0307515_1001963211 646
177 3300031649 Ga0307514_10001199 Ga0307514_1000119929 646
178 3300053139 Ga0500568_0024399 Ga0500568_0024399_17_2014 646
179 3300028794 Ga0307515_10036002 Ga0307515_100360027 647
180 3300031730 Ga0307516_10004964 Ga0307516_100049646 647
181 3300025303 Ga0209051_1012210 Ga0209051_10122102 648
182 3300031730 Ga0307516_10006913 Ga0307516_100069136 648
183 3300025949 Ga0207667_10012502 Ga0207667_100125022 649
184 3300028794 Ga0307515_10017686 Ga0307515_100176865 649
185 3300045976 Ga0466967_0039904 Ga0466967_0039904_1644_3671 649
186 3300009093 Ga0105240_10017227 Ga0105240_100172273 652
187 3300009545 Ga0105237_10000416 Ga0105237_100004164 652
188 3300009551 Ga0105238_10015940 Ga0105238_100159409 652
189 3300010375 Ga0105239_10004117 Ga0105239_1000411713 652
190 3300046454 Ga0495592_0002137 Ga0495592_0002137_10189_12210 652
191 3300048928 Ga0496125_0068898 Ga0496125_0068898_54_2054 652
192 3300025303 Ga0209051_1006375 Ga0209051_10063752 653
193 3300025914 Ga0207671_10010715 Ga0207671_100107154 653
194 3300028794 Ga0307515_10000567 Ga0307515_1000056768 653
195 3300003794 Ga0055531_10000381 Ga0055531_1000038118 655
196 3300025298 Ga0209050_1004534 Ga0209050_10045346 655
197 3300025303 Ga0209051_1015559 Ga0209051_10155591 655
198 3300025304 Ga0209257_1000117 Ga0209257_100011793 655
199 3300046506 Ga0495583_0000022 Ga0495583_0000022_134161_136161 655
200 3300046507 Ga0495606_0001282 Ga0495606_0001282_28201_30201 655
201 3300003771 Ga0055526_1001358 Ga0055526_10013583 656
202 3300025242 Ga0209258_102381 Ga0209258_1023813 656
203 3300025295 Ga0209564_1000030 Ga0209564_1000030299 656
204 3300026118 Ga0207675_100028750 Ga0207675_1000287503 656
205 3300031616 Ga0307508_10000616 Ga0307508_1000061637 656
206 3300037471 Ga0395905_0001764 Ga0395905_0001764_3121_5118 656
207 3300042876 Ga0451577_0001207 Ga0451577_0001207_27958_29955 656
208 3300046694 Ga0495649_0000099 Ga0495649_0000099_40422_42422 656
209 3300003316 rootH1_10010554 rootH1_100105544 657
210 3300005262 Ga0065165_1000757 Ga0065165_100075726 657
211 3300009093 Ga0105240_10009585 Ga0105240_100095854 657
212 3300009551 Ga0105238_10025061 Ga0105238_100250615 657
213 3300025298 Ga0209050_1000720 Ga0209050_10007207 657
214 3300005530 Ga0070679_100006893 Ga0070679_1000068938 658
215 3300025921 Ga0207652_10013150 Ga0207652_100131504 658
216 iso_pu_bacteria 2643221646 2644255653 658
217 3300003320 rootH2_10036922 rootH2_100369223 659
218 3300003322 rootL2_10002498 rootL2_1000249815 659
219 3300003794 Ga0055531_10015092 Ga0055531_100150922 659
220 3300005262 Ga0065165_1002631 Ga0065165_10026312 659
221 3300006353 Ga0075370_10006993 Ga0075370_100069932 659
222 3300012475 Ga0157317_1000016 Ga0157317_10000162 659
223 3300012497 Ga0157319_1000052 Ga0157319_10000522 659
224 3300025304 Ga0209257_1002798 Ga0209257_10027982 659
225 3300031548 Ga0307408_100013788 Ga0307408_1000137881 659
226 3300042438 Ga0439459_0000443 Ga0439459_0000443_2060_4057 659
227 3300050496 nmdc:mga07m45_6432_c2 nmdc:mga07m45_6432_c2_1856_3853 659
228 iso_pu_bacteria 2643221544 2643744592 659
229 iso_pu_bacteria 2738541337 2739054117 659
230 3300050493 nmdc:mga0k408_33948_c1 nmdc:mga0k408_33948_c1_113_2176 660
231 3300009176 Ga0105242_10002020 Ga0105242_100020206 661
232 3300050493 nmdc:mga0k408_18090_c1 nmdc:mga0k408_18090_c1_247_2232 661
233 3300050496 nmdc:mga07m45_7479_c1 nmdc:mga07m45_7479_c1_368_2353 661
234 iso_pu_bacteria 2585428057 2587729030 661
235 iso_pu_bacteria 2585428058 2587733597 661
236 iso_pu_bacteria 2585428062 2587757980 661
237 iso_pu_bacteria 2588253510 2588293996 661
238 iso_pu_bacteria 2643221592 2643967101 661
239 iso_pu_bacteria 2643221625 2644139931 661
240 iso_pu_bacteria 2643221648 2644271171 661
241 iso_pu_bacteria 2643221660 2644339499 661
242 iso_pu_bacteria 2831864461 2831864888 661
243 iso_pu_bacteria 2886848708 2886850758 661
244 iso_pu_bacteria 2643221654 2644305434 662
245 iso_pu_bacteria 2928115317 2928120026 662
246 3300028794 Ga0307515_10024901 Ga0307515_100249015 663
247 3300042130 Ga0450892_000365 Ga0450892_000365_1914_3905 663
248 3300042530 Ga0450916_000897 Ga0450916_000897_333_2324 663
249 3300045051 Ga0451576_0020010 Ga0451576_0020010_1674_3665 663
250 3300049662 Ga0501222_002412 Ga0501222_002412_440_2431 663
251 3300045051 Ga0451576_0125957 Ga0451576_0125957_290_2284 664
252 3300003775 Ga0055524_1004842 Ga0055524_10048424 665
253 3300003794 Ga0055531_10002435 Ga0055531_100024354 665
254 3300005330 Ga0070690_100014100 Ga0070690_1000141004 665
255 3300005354 Ga0070675_100003315 Ga0070675_1000033154 665
256 3300005355 Ga0070671_100008293 Ga0070671_1000082936 665
257 3300005364 Ga0070673_100004055 Ga0070673_1000040552 665
258 3300005456 Ga0070678_100002517 Ga0070678_1000025174 665
259 3300005618 Ga0068864_100002757 Ga0068864_1000027575 665
260 3300005719 Ga0068861_100023628 Ga0068861_1000236281 665
261 3300005842 Ga0068858_100001797 Ga0068858_1000017976 665
262 3300005844 Ga0068862_100042321 Ga0068862_1000423212 665
263 3300006881 Ga0068865_100036742 Ga0068865_1000367421 665
264 3300006944 Ga0099823_1000015 Ga0099823_100001532 665
265 3300009553 Ga0105249_10016976 Ga0105249_100169763 665
266 3300013296 Ga0157374_10018030 Ga0157374_100180303 665
267 3300025258 Ga0209129_1000038 Ga0209129_1000038149 665
268 3300025273 Ga0209673_1006481 Ga0209673_10064814 665
269 3300025295 Ga0209564_1000129 Ga0209564_100012938 665
270 3300025297 Ga0209758_1000197 Ga0209758_100019738 665
271 3300025298 Ga0209050_1004254 Ga0209050_10042543 665
272 3300025299 Ga0209256_1002480 Ga0209256_100248012 665
273 3300025299 Ga0209256_1003003 Ga0209256_10030034 665
274 3300025304 Ga0209257_1003755 Ga0209257_10037554 665
275 3300025903 Ga0207680_10001011 Ga0207680_100010116 665
276 3300025926 Ga0207659_10004962 Ga0207659_100049624 665
277 3300025941 Ga0207711_10010091 Ga0207711_100100911 665
278 3300025941 Ga0207711_10010274 Ga0207711_100102745 665
279 3300025960 Ga0207651_10000886 Ga0207651_100008869 665
280 3300025986 Ga0207658_10009817 Ga0207658_100098173 665
281 3300026035 Ga0207703_10006896 Ga0207703_100068965 665
282 3300026088 Ga0207641_10028442 Ga0207641_100284422 665
283 3300026095 Ga0207676_10000221 Ga0207676_1000022117 665
284 3300026118 Ga0207675_100068034 Ga0207675_1000680343 665
285 3300027296 Ga0209389_1000831 Ga0209389_10008317 665
286 3300028381 Ga0268264_10030770 Ga0268264_100307703 665
287 3300031507 Ga0307509_10024044 Ga0307509_100240445 665
288 3300031730 Ga0307516_10000677 Ga0307516_1000067715 665
289 3300039447 Ga0436361_0916410 Ga0436361_0916410_4792_6792 665
290 3300049649 Ga0501198_000003 Ga0501198_000003_149694_151694 665
291 3300049662 Ga0501222_000001 Ga0501222_000001_239477_241477 665
292 3300050496 nmdc:mga07m45_2131_c1 nmdc:mga07m45_2131_c1_5404_7401 665
293 3300053086 Ga0500578_0000393 Ga0500578_0000393_42809_44806 665
294 3300053117 Ga0500593_001995 Ga0500593_001995_3901_5901 665
295 3300053131 Ga0500652_001236 Ga0500652_001236_4558_6555 665
296 3300053156 Ga0500622_0004817 Ga0500622_0004817_4591_6588 665
297 3300005355 Ga0070671_100046334 Ga0070671_1000463343 666
298 3300009098 Ga0105245_10035094 Ga0105245_100350943 666
299 3300026095 Ga0207676_10013111 Ga0207676_100131114 666
300 3300031507 Ga0307509_10000135 Ga0307509_1000013582 666
301 3300031507 Ga0307509_10079640 Ga0307509_100796403 666
302 3300031616 Ga0307508_10002482 Ga0307508_1000248211 666
303 3300033180 Ga0307510_10004514 Ga0307510_100045146 666
304 3300033180 Ga0307510_10016068 Ga0307510_100160685 666
305 3300046660 Ga0495625_0035346 Ga0495625_0035346_1202_3205 666
306 3300047321 Ga0495676_0039312 Ga0495676_0039312_1320_3329 666
307 3300047673 Ga0495593_0046830 Ga0495593_0046830_199_2208 666
308 3300048909 Ga0496106_0010243 Ga0496106_0010243_4023_6026 666
309 3300053136 Ga0500559_0000388 Ga0500559_0000388_26955_28976 666
310 3300053730 Ga0500645_009060 Ga0500645_009060_1037_3040 666
311 3300005262 Ga0065165_1000304 Ga0065165_10003049 667
312 3300005614 Ga0068856_100008539 Ga0068856_1000085397 668
313 3300025273 Ga0209673_1015514 Ga0209673_10155141 668
314 3300025986 Ga0207658_10001308 Ga0207658_1000130816 670
315 3300002773 JGI25152J39213_1001209 JGI25152J39213_100120911 671
316 3300003215 JGI25153J46596_10004893 JGI25153J46596_100048934 671
317 3300003771 Ga0055526_1003640 Ga0055526_10036409 671

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02254

TrkA_N

TrkA-N domain

420

535

0.98

PF02080

TrkA_C

TrkA-C domain

584

654

0.93

PF00999

Na_H_Exchanger

Sodium/hydrogen exchanger family

10

385

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
8eei-assembly1.cif.gz_B unbound c. ammoniagenes monoamine oxidase (mao) 0.9365 426 456
8eek-assembly2.cif.gz_B c. ammoniagenes monoamine oxidase (mao) bound to tyramine 0.9364 426 456
6n04-assembly1.cif.gz_A the x-ray crystal structure of absh3, an fad dependent reductase from the abyssomicin biosynthesis pathway in streptomyces 0.934 425 455
8eek-assembly1.cif.gz_A c. ammoniagenes monoamine oxidase (mao) bound to tyramine 0.934 426 456
8eef-assembly1.cif.gz_A c. ammoniagenes monoamine oxidase (mao) bound to octopamine 0.9334 426 456
ID Description Score Start End Superfamily
af_O05882_87_159_3.30.70.1450 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Regulator of K+ conductance, C-terminal domain 0.9395 600 668 3.30.70.1450
af_E0AHD3_2_449_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9339 424 456 3.50.50.60
af_P60869_303_372_3.30.70.1450 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Regulator of K+ conductance, C-terminal domain 0.9336 599 668 3.30.70.1450
af_P9WFZ3_136_217_3.30.70.1450 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Regulator of K+ conductance, C-terminal domain 0.9299 596 669 3.30.70.1450
af_A0A1D6MVG0_125_298_1.20.1530.20 Mainly Alpha;Up-down Bundle;Na+/H+ antiporter like fold; 0.9152 225 396 1.20.1530.20
ID Description Score Start End GO Terms
AF-A0A529PZQ1-F1-model_v4 Potassium transporter 0.9343 426 537 GO:0005886
GO:0006813
GO:0015297
AF-A0A7Y0S198-F1-model_v4 Glutathione-regulated potassium-efflux system protein KefB 0.9257 455 538 GO:0005886
GO:0006813
GO:0015297
AF-A0A524PVD3-F1-model_v4 deleted 0.9219 15 401
AF-A0A843DLB2-F1-model_v4 Cation:proton antiporter 0.9195 11 363 GO:0015297
GO:0016020
GO:1902600
AF-A0A529PZQ1-F1-model_v4 Potassium transporter 0.9111 426 537 GO:0005886
GO:0006813
GO:0015297

Feature Viewer

pLDDT pTM Quality
83.25 0.6 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map