F404258

General Info

Members Datasets Scaffolds Average Seq Length
317 190 634 224

Family's Representative Sequence

Representative Sequence 3300039447|Ga0436361_0128426|Ga0436361_0128426_615_1268
Length 217
Sequence MLQLKNLCKSYSPTRQVIAKLNYTLAPGEYVAIMGESGVGKSTLLNLIAGLDQPDGGDIVIDGQAMAALDDDEATRLRREKFGFIFQAFHLLPHLTLTQNVALPLLLKGEAPNQRVTHMLEAVGLAQRRHDFPRQLSGGEMQRVAIARALVHKPALILADEPTGNLDPDTAAGILGLLRSEIKTNGASAILVTHSHAAAATADRVLLLTNDGLREVS

Samples

Sample ID Description Type Environment
1 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
2 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
128 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
129 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
130 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
131 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
132 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
135 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
139 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
140 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
141 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
142 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
145 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
146 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
147 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
148 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
149 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
150 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
151 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
152 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
153 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
154 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
155 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
156 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
157 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
158 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
159 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
162 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
163 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
164 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
165 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
171 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
172 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
173 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
174 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
175 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
176 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
178 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
179 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
180 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
181 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
182 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
183 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
184 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
185 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
186 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
187 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
188 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
189 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
190 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.95
Nodule 0
Rhizoplane 3.15
Rhizosphere 94.95
Stem 0
Stem Tuber 0
Unclassified 0.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436361_0128426 3300039447 Bacteria 1593
2 JGI24033J26618_1023281 3300002155 Bacteria 804
3 Ga0065704_10008560 3300005289 Bacteria 2604
4 Ga0065715_10093609 3300005293 Bacteria 4594
5 Ga0065707_10082218 3300005295 Bacteria 18935
6 Ga0065707_10136600 3300005295 Bacteria 1809
7 Ga0070676_10001535 3300005328 Bacteria 11679
8 Ga0070676_10039668 3300005328 Bacteria 2724
9 Ga0070683_100015124 3300005329 Bacteria 6772
10 Ga0070690_100003030 3300005330 Bacteria 9116
11 Ga0070690_100315947 3300005330 Bacteria 1124
12 Ga0070670_100082895 3300005331 Bacteria 2755
13 Ga0070670_100088950 3300005331 Bacteria 2655
14 Ga0070677_10006075 3300005333 Bacteria 4004
15 Ga0068869_100009482 3300005334 Bacteria 6318
16 Ga0070666_10201827 3300005335 Bacteria 1399
17 Ga0070680_100068876 3300005336 Bacteria 2905
18 Ga0068868_100045837 3300005338 Bacteria 3421
19 Ga0068868_100054135 3300005338 Bacteria 3161
20 Ga0068868_100825178 3300005338 Bacteria 838
21 Ga0070689_100000298 3300005340 Bacteria 28844
22 Ga0070689_100109099 3300005340 Bacteria 2199
23 Ga0070691_10115550 3300005341 Bacteria 1346
24 Ga0070687_100172066 3300005343 Bacteria 1290
25 Ga0070661_100011692 3300005344 Bacteria 6121
26 Ga0070668_100047047 3300005347 Bacteria 3316
27 Ga0070669_100069356 3300005353 Bacteria 2604
28 Ga0070675_100003737 3300005354 Bacteria 11567
29 Ga0070675_100058153 3300005354 Bacteria 3189
30 Ga0070671_100017408 3300005355 Bacteria 5821
31 Ga0070673_100000216 3300005364 Bacteria 28647
32 Ga0070673_100026066 3300005364 Bacteria 4312
33 Ga0070673_100446762 3300005364 Bacteria 1162
34 Ga0070688_100002736 3300005365 Bacteria 8954
35 Ga0070659_100431615 3300005366 Bacteria 1115
36 Ga0070667_100038394 3300005367 Bacteria 4014
37 Ga0070667_100038429 3300005367 Bacteria 4012
38 Ga0070701_10323241 3300005438 Bacteria 955
39 Ga0070705_100406929 3300005440 Bacteria 1009
40 Ga0070700_100023419 3300005441 Bacteria 3611
41 Ga0070694_100284263 3300005444 Bacteria 1262
42 Ga0070663_100678850 3300005455 Bacteria 874
43 Ga0070678_100010419 3300005456 Bacteria 5679
44 Ga0070678_100020492 3300005456 Bacteria 4339
45 Ga0070678_100029956 3300005456 Bacteria 3734
46 Ga0070662_100013710 3300005457 Bacteria 5398
47 Ga0070681_10347578 3300005458 Bacteria 1393
48 Ga0068867_100013992 3300005459 Bacteria 5681
49 Ga0070685_10018691 3300005466 Bacteria 3731
50 Ga0070685_10059515 3300005466 Bacteria 2231
51 Ga0070684_100003943 3300005535 Bacteria 11241
52 Ga0070684_100343208 3300005535 Bacteria 1373
53 Ga0070672_100049777 3300005543 Bacteria 3261
54 Ga0070672_100385710 3300005543 Bacteria 1199
55 Ga0070686_100004261 3300005544 Bacteria 7886
56 Ga0070665_100045006 3300005548 Bacteria 4431
57 Ga0070665_100645241 3300005548 Bacteria 1072
58 Ga0070664_100000454 3300005564 Bacteria 31058
59 Ga0070664_100059075 3300005564 Bacteria 3262
60 Ga0070664_100100165 3300005564 Bacteria 2519
61 Ga0068857_100011168 3300005577 Bacteria 7810
62 Ga0070702_100003965 3300005615 Bacteria 6713
63 Ga0070702_100019366 3300005615 Bacteria 3548
64 Ga0070702_100283652 3300005615 Bacteria 1138
65 Ga0068852_100102913 3300005616 Bacteria 2581
66 Ga0068859_100001621 3300005617 Bacteria 22990
67 Ga0068859_100154343 3300005617 Bacteria 2372
68 Ga0068864_100003376 3300005618 Bacteria 13199
69 Ga0068866_10026730 3300005718 Bacteria 2729
70 Ga0068866_10052634 3300005718 Bacteria 2078
71 Ga0068861_100006684 3300005719 Bacteria 7877
72 Ga0068861_100051364 3300005719 Bacteria 3129
73 Ga0068861_100151998 3300005719 Bacteria 1900
74 Ga0068851_10029745 3300005834 Bacteria 2706
75 Ga0068870_10015037 3300005840 Bacteria 3665
76 Ga0068863_100006215 3300005841 Bacteria 11721
77 Ga0068863_100083860 3300005841 Bacteria 3020
78 Ga0068863_100787570 3300005841 Bacteria 948
79 Ga0068858_100025635 3300005842 Bacteria 5486
80 Ga0068858_100041909 3300005842 Bacteria 4243
81 Ga0068860_100064780 3300005843 Bacteria 3471
82 Ga0068860_100531330 3300005843 Bacteria 1177
83 Ga0068862_100004765 3300005844 Bacteria 11416
84 Ga0068862_100012367 3300005844 Bacteria 7056
85 Ga0068862_100449328 3300005844 Bacteria 1215
86 Ga0097621_100015242 3300006237 Bacteria 5777
87 Ga0068871_100031307 3300006358 Bacteria 4195
88 Ga0068871_100060456 3300006358 Bacteria 3091
89 Ga0068871_100125331 3300006358 Bacteria 2174
90 Ga0075428_100000763 3300006844 Bacteria 33458
91 Ga0075428_100006725 3300006844 Bacteria 12792
92 Ga0075428_100035241 3300006844 Bacteria 5517
93 Ga0075428_100129165 3300006844 Bacteria 2749
94 Ga0075430_100052561 3300006846 Bacteria 3432
95 Ga0075430_100122463 3300006846 Bacteria 2168
96 Ga0075430_100162180 3300006846 Bacteria 1861
97 Ga0075431_100000094 3300006847 Bacteria 54906
98 Ga0075431_100007255 3300006847 Bacteria 11033
99 Ga0075431_100027858 3300006847 Bacteria 5798
100 Ga0075431_100098773 3300006847 Bacteria 3013
101 Ga0075431_100967771 3300006847 Bacteria 819
102 Ga0075429_100001370 3300006880 Bacteria 19935
103 Ga0075429_100032118 3300006880 Bacteria 4563
104 Ga0075429_100033266 3300006880 Bacteria 4480
105 Ga0075429_100046479 3300006880 Bacteria 3777
106 Ga0068865_100025517 3300006881 Bacteria 3888
107 Ga0075436_100166173 3300006914 Bacteria 1557
108 Ga0097620_100001621 3300006931 Bacteria 22990
109 Ga0097620_100154333 3300006931 Bacteria 2372
110 Ga0075435_100283002 3300007076 Bacteria 1416
111 Ga0111539_10009823 3300009094 Bacteria 12077
112 Ga0111539_10049342 3300009094 Bacteria 5020
113 Ga0111539_10072460 3300009094 Bacteria 4062
114 Ga0111539_10220570 3300009094 Bacteria 2209
115 Ga0111539_10474362 3300009094 Bacteria 1457
116 Ga0111539_10844900 3300009094 Bacteria 1065
117 Ga0105245_10211446 3300009098 Bacteria 1867
118 Ga0105247_10021595 3300009101 Bacteria 3875
119 Ga0105247_10194578 3300009101 Bacteria 1359
120 Ga0114129_10003130 3300009147 Bacteria 23215
121 Ga0114129_10015071 3300009147 Bacteria 11004
122 Ga0105243_10206478 3300009148 Bacteria 1727
123 Ga0105243_10574112 3300009148 Bacteria 1081
124 Ga0105242_10187547 3300009176 Bacteria 1829
125 Ga0105242_10189530 3300009176 Bacteria 1820
126 Ga0105248_10226848 3300009177 Bacteria 2103
127 Ga0105249_10166137 3300009553 Bacteria 2136
128 Ga0105249_10374981 3300009553 Bacteria 1447
129 Ga0157369_10388340 3300013105 Bacteria 1448
130 Ga0157374_10099209 3300013296 Bacteria 2789
131 Ga0157378_10037734 3300013297 Bacteria 4282
132 Ga0157378_10146258 3300013297 Bacteria 2198
133 Ga0157378_10176833 3300013297 Bacteria 2005
134 Ga0157378_10391763 3300013297 Bacteria 1367
135 Ga0163162_10013952 3300013306 Bacteria 7852
136 Ga0157375_10076230 3300013308 Bacteria 3379
137 Ga0157375_10484709 3300013308 Bacteria 1401
138 Ga0157375_10503344 3300013308 Bacteria 1375
139 Ga0163163_10001204 3300014325 Bacteria 21896
140 Ga0157380_10000208 3300014326 Bacteria 34802
141 Ga0157380_10149250 3300014326 Bacteria 2019
142 Ga0157377_10032659 3300014745 Bacteria 2836
143 Ga0157379_10095615 3300014968 Bacteria 2666
144 Ga0157376_10275918 3300014969 Bacteria 1581
145 Ga0157376_11135081 3300014969 Bacteria 808
146 Ga0163161_10264393 3300017792 Bacteria 1344
147 Ga0207697_10084027 3300025315 Bacteria 1343
148 Ga0207697_10088552 3300025315 Bacteria 1310
149 Ga0207656_10022459 3300025321 Bacteria 2531
150 Ga0207642_10039646 3300025899 Bacteria 2049
151 Ga0207688_10013731 3300025901 Bacteria 4403
152 Ga0207680_10029902 3300025903 Bacteria 3066
153 Ga0207680_10096803 3300025903 Bacteria 1888
154 Ga0207645_10007078 3300025907 Bacteria 7978
155 Ga0207645_10016912 3300025907 Bacteria 4819
156 Ga0207705_10284370 3300025909 Bacteria 1266
157 Ga0207662_10003617 3300025918 Bacteria 7988
158 Ga0207652_10143603 3300025921 Bacteria 2135
159 Ga0207646_10152053 3300025922 Bacteria 2087
160 Ga0207681_10198173 3300025923 Bacteria 1540
161 Ga0207681_10260997 3300025923 Bacteria 1356
162 Ga0207650_10032735 3300025925 Bacteria 3761
163 Ga0207659_10030224 3300025926 Bacteria 3699
164 Ga0207659_10047288 3300025926 Bacteria 3043
165 Ga0207659_10047686 3300025926 Bacteria 3031
166 Ga0207659_10054990 3300025926 Bacteria 2844
167 Ga0207659_10127743 3300025926 Bacteria 1957
168 Ga0207644_10004153 3300025931 Bacteria 9392
169 Ga0207644_10023887 3300025931 Bacteria 4193
170 Ga0207690_10262722 3300025932 Bacteria 1338
171 Ga0207706_10030076 3300025933 Bacteria 4847
172 Ga0207706_10040195 3300025933 Bacteria 4145
173 Ga0207709_10132583 3300025935 Bacteria 1700
174 Ga0207709_10671717 3300025935 Bacteria 827
175 Ga0207670_10003507 3300025936 Bacteria 8328
176 Ga0207669_10077284 3300025937 Bacteria 2116
177 Ga0207704_10217543 3300025938 Bacteria 1411
178 Ga0207691_10022423 3300025940 Bacteria 5954
179 Ga0207691_10048014 3300025940 Bacteria 3915
180 Ga0207711_10165863 3300025941 Bacteria 2002
181 Ga0207689_10046613 3300025942 Bacteria 3582
182 Ga0207679_10003490 3300025945 Bacteria 9724
183 Ga0207679_10023722 3300025945 Bacteria 4199
184 Ga0207651_10149020 3300025960 Bacteria 1818
185 Ga0207651_10191201 3300025960 Bacteria 1633
186 Ga0207668_10011123 3300025972 Bacteria 5460
187 Ga0207640_10111055 3300025981 Bacteria 1943
188 Ga0207640_10235131 3300025981 Bacteria 1412
189 Ga0207658_10030883 3300025986 Bacteria 3799
190 Ga0207658_10043230 3300025986 Bacteria 3274
191 Ga0207658_10171692 3300025986 Bacteria 1787
192 Ga0207703_10046604 3300026035 Bacteria 3491
193 Ga0207708_10073405 3300026075 Bacteria 2622
194 Ga0207708_10164616 3300026075 Bacteria 1753
195 Ga0207641_10012470 3300026088 Bacteria 6967
196 Ga0207641_10031691 3300026088 Bacteria 4385
197 Ga0207641_10122890 3300026088 Bacteria 2320
198 Ga0207648_10026165 3300026089 Bacteria 5187
199 Ga0207648_10124687 3300026089 Bacteria 2265
200 Ga0207676_10003649 3300026095 Bacteria 10884
201 Ga0207676_10211293 3300026095 Bacteria 1721
202 Ga0207674_10010961 3300026116 Bacteria 10201
203 Ga0207675_100017110 3300026118 Bacteria 6770
204 Ga0207675_100201388 3300026118 Bacteria 1912
205 Ga0207683_10035874 3300026121 Bacteria 4314
206 Ga0207683_10071759 3300026121 Bacteria 3061
207 Ga0207683_10116595 3300026121 Bacteria 2394
208 Ga0207698_10032560 3300026142 Bacteria 3778
209 Ga0209999_1011740 3300027543 Bacteria 1586
210 Ga0209974_10022278 3300027876 Bacteria 2099
211 Ga0207428_10001970 3300027907 Bacteria 20829
212 Ga0207428_10002262 3300027907 Bacteria 19336
213 Ga0268266_10570493 3300028379 Bacteria 1085
214 Ga0268266_10658672 3300028379 Bacteria 1008
215 Ga0268265_10001835 3300028380 Bacteria 16951
216 Ga0268265_10957633 3300028380 Bacteria 843
217 Ga0268264_10008900 3300028381 Bacteria 8326
218 Ga0268264_10067290 3300028381 Bacteria 3023
219 Ga0307513_10252286 3300031456 Bacteria 1560
220 Ga0307509_10000062 3300031507 Bacteria 143809
221 Ga0307408_100016356 3300031548 Bacteria 4950
222 Ga0316575_10040393 3300031665 Bacteria 1844
223 Ga0316576_10223007 3300031727 Bacteria 1418
224 Ga0307413_10204130 3300031824 Bacteria 1430
225 Ga0307406_10119429 3300031901 Bacteria 1830
226 Ga0307406_10189084 3300031901 Bacteria 1506
227 Ga0307406_10322363 3300031901 Bacteria 1196
228 Ga0307406_10389454 3300031901 Bacteria 1101
229 Ga0307407_10455141 3300031903 Bacteria 930
230 Ga0307412_10125147 3300031911 Bacteria 1858
231 Ga0307412_10198111 3300031911 Bacteria 1523
232 Ga0307409_100466790 3300031995 Bacteria 1222
233 Ga0307416_100006261 3300032002 Bacteria 7433
234 Ga0307411_10518213 3300032005 Bacteria 1011
235 Ga0307415_100178097 3300032126 Bacteria 1665
236 Ga0307415_100763503 3300032126 Bacteria 879
237 Ga0373958_0010926 3300034819 Bacteria 1524
238 Ga0373934_0042138 3300035086 Unclassified 1803
239 Ga0373936_0047167 3300035113 Bacteria 1737
240 Ga0373937_0051841 3300036401 Bacteria 3761
241 Ga0373937_0077356 3300036401 Bacteria 3075
242 Ga0439442_021329 3300042002 Bacteria 1343
243 Ga0439460_0069287 3300042461 Unclassified 1090
244 Ga0451577_0045635 3300042876 Bacteria 3922
245 Ga0451577_0165313 3300042876 Bacteria 1993
246 Ga0466961_0000291 3300044693 Bacteria 33308
247 Ga0453684_0172431 3300044712 Bacteria 2548
248 Ga0453684_0216965 3300044712 Bacteria 2219
249 Ga0451576_0017344 3300045051 Bacteria 7919
250 Ga0451576_0044892 3300045051 Bacteria 4656
251 Ga0495617_034280 3300046452 Bacteria 1704
252 Ga0495638_0001247 3300046460 Bacteria 23940
253 Ga0495638_0039532 3300046460 Bacteria 2994
254 Ga0495594_0144043 3300046499 Bacteria 1352
255 Ga0495632_0075841 3300046519 Bacteria 1609
256 Ga0495598_0010694 3300046537 Bacteria 2205
257 Ga0495625_0030507 3300046660 Bacteria 4021
258 Ga0495625_0253413 3300046660 Bacteria 1142
259 Ga0495626_0191970 3300048091 Bacteria 842
260 Ga0496104_0093278 3300048907 Bacteria 2880
261 Ga0496108_0014296 3300048911 Bacteria 6478
262 Ga0496108_0134002 3300048911 Bacteria 2130
263 Ga0496109_0008517 3300048912 Bacteria 8721
264 Ga0496109_0116576 3300048912 Bacteria 2486
265 Ga0496110_0025298 3300048913 Bacteria 5072
266 Ga0496110_0523288 3300048913 Bacteria 1079
267 Ga0496112_0260560 3300048915 Bacteria 1683
268 Ga0496113_0040998 3300048916 Bacteria 3414
269 Ga0496114_0059086 3300048917 Bacteria 3203
270 Ga0496121_0051271 3300048924 Bacteria 3477
271 Ga0501036_0029435 3300049572 Bacteria 4639
272 Ga0501038_0166584 3300049574 Bacteria 1787
273 Ga0501039_0084362 3300049575 Bacteria 2474
274 Ga0501040_0035473 3300049576 Bacteria 3383
275 Ga0501041_0001545 3300049577 Bacteria 12803
276 Ga0501047_0547405 3300049581 Bacteria 982
277 Ga0501071_0009110 3300049587 Bacteria 6591
278 Ga0501071_0437813 3300049587 Bacteria 1000
279 Ga0501076_0000992 3300049592 Bacteria 18553
280 Ga0501076_0008586 3300049592 Bacteria 7495
281 Ga0501079_0014254 3300049741 Bacteria 6060
282 Ga0501079_0116604 3300049741 Bacteria 2076
283 Ga0501080_0002667 3300049742 Bacteria 15614
284 Ga0501080_0033517 3300049742 Bacteria 4794
285 Ga0501081_0000988 3300049743 Bacteria 16912
286 Ga0501081_0476115 3300049743 Bacteria 929
287 Ga0501035_0337102 3300049822 Bacteria 1264
288 Ga0501045_0011739 3300049824 Bacteria 6156
289 nmdc:mga05p37_1293903_c1 3300050507 Bacteria 744
290 nmdc:mga05p37_131955_c1 3300050507 Bacteria 3065
291 nmdc:mga09592_118295_c1 3300050508 Bacteria 2274
292 nmdc:mga09592_143894_c1 3300050508 Bacteria 2056
293 nmdc:mga09592_22681_c1 3300050508 Bacteria 5180
294 nmdc:mga09592_4416_c1 3300050508 Bacteria 11383
295 nmdc:mga0qj67_114505_c1 3300050509 Bacteria 2178
296 nmdc:mga0qj67_176389_c1 3300050509 Bacteria 1735
297 nmdc:mga0qj67_29536_c1 3300050509 Bacteria 4258
298 nmdc:mga0qj67_8984_c1 3300050509 Bacteria 7412
299 nmdc:mga0qj67_9632_c1 3300050509 Bacteria 7199
300 nmdc:mga06r32_103168_c1 3300050510 Bacteria 2800
301 nmdc:mga06r32_48983_c1 3300050510 Bacteria 4041
302 nmdc:mga06r32_73032_c1 3300050510 Bacteria 1969
303 nmdc:mga06r32_88_c1 3300050510 Bacteria 63377
304 nmdc:mga08y16_454416_c1 3300050511 Bacteria 1306
305 nmdc:mga08y16_653_c1 3300050511 Bacteria 32539
306 nmdc:mga08y16_77_c1 3300050511 Bacteria 82433
307 nmdc:mga08y16_865426_c1 3300050511 Bacteria 892
308 nmdc:mga0rr50_28979_c1 3300050513 Bacteria 3897
309 nmdc:mga0rr50_898836_c1 3300050513 Bacteria 755
310 nmdc:mga08x19_261989_c1 3300050514 Bacteria 1195
311 Ga0500562_051562 3300053108 Bacteria 1101
312 Ga0500617_084097 3300053124 Bacteria 1373
313 Ga0500627_0094488 3300053158 Bacteria 1339
314 Ga0501084_0193648 3300054114 Bacteria 1715
315 Ga0501082_0001958 3300060353 Bacteria 18127
316 Ga0501082_0640539 3300060353 Bacteria 930
317 Ga0530510_0176039 3300061734 Bacteria 1585
318 Ga0436361_0128426
319 JGI24033J26618_1023281
320 Ga0065704_10008560
321 Ga0065715_10093609
322 Ga0065707_10082218
323 Ga0065707_10136600
324 Ga0070676_10001535
325 Ga0070676_10039668
326 Ga0070683_100015124
327 Ga0070690_100003030
328 Ga0070690_100315947
329 Ga0070670_100082895
330 Ga0070670_100088950
331 Ga0070677_10006075
332 Ga0068869_100009482
333 Ga0070666_10201827
334 Ga0070680_100068876
335 Ga0068868_100045837
336 Ga0068868_100054135
337 Ga0068868_100825178
338 Ga0070689_100000298
339 Ga0070689_100109099
340 Ga0070691_10115550
341 Ga0070687_100172066
342 Ga0070661_100011692
343 Ga0070668_100047047
344 Ga0070669_100069356
345 Ga0070675_100003737
346 Ga0070675_100058153
347 Ga0070671_100017408
348 Ga0070673_100000216
349 Ga0070673_100026066
350 Ga0070673_100446762
351 Ga0070688_100002736
352 Ga0070659_100431615
353 Ga0070667_100038394
354 Ga0070667_100038429
355 Ga0070701_10323241
356 Ga0070705_100406929
357 Ga0070700_100023419
358 Ga0070694_100284263
359 Ga0070663_100678850
360 Ga0070678_100010419
361 Ga0070678_100020492
362 Ga0070678_100029956
363 Ga0070662_100013710
364 Ga0070681_10347578
365 Ga0068867_100013992
366 Ga0070685_10018691
367 Ga0070685_10059515
368 Ga0070684_100003943
369 Ga0070684_100343208
370 Ga0070672_100049777
371 Ga0070672_100385710
372 Ga0070686_100004261
373 Ga0070665_100045006
374 Ga0070665_100645241
375 Ga0070664_100000454
376 Ga0070664_100059075
377 Ga0070664_100100165
378 Ga0068857_100011168
379 Ga0070702_100003965
380 Ga0070702_100019366
381 Ga0070702_100283652
382 Ga0068852_100102913
383 Ga0068859_100001621
384 Ga0068859_100154343
385 Ga0068864_100003376
386 Ga0068866_10026730
387 Ga0068866_10052634
388 Ga0068861_100006684
389 Ga0068861_100051364
390 Ga0068861_100151998
391 Ga0068851_10029745
392 Ga0068870_10015037
393 Ga0068863_100006215
394 Ga0068863_100083860
395 Ga0068863_100787570
396 Ga0068858_100025635
397 Ga0068858_100041909
398 Ga0068860_100064780
399 Ga0068860_100531330
400 Ga0068862_100004765
401 Ga0068862_100012367
402 Ga0068862_100449328
403 Ga0097621_100015242
404 Ga0068871_100031307
405 Ga0068871_100060456
406 Ga0068871_100125331
407 Ga0075428_100000763
408 Ga0075428_100006725
409 Ga0075428_100035241
410 Ga0075428_100129165
411 Ga0075430_100052561
412 Ga0075430_100122463
413 Ga0075430_100162180
414 Ga0075431_100000094
415 Ga0075431_100007255
416 Ga0075431_100027858
417 Ga0075431_100098773
418 Ga0075431_100967771
419 Ga0075429_100001370
420 Ga0075429_100032118
421 Ga0075429_100033266
422 Ga0075429_100046479
423 Ga0068865_100025517
424 Ga0075436_100166173
425 Ga0097620_100001621
426 Ga0097620_100154333
427 Ga0075435_100283002
428 Ga0111539_10009823
429 Ga0111539_10049342
430 Ga0111539_10072460
431 Ga0111539_10220570
432 Ga0111539_10474362
433 Ga0111539_10844900
434 Ga0105245_10211446
435 Ga0105247_10021595
436 Ga0105247_10194578
437 Ga0114129_10003130
438 Ga0114129_10015071
439 Ga0105243_10206478
440 Ga0105243_10574112
441 Ga0105242_10187547
442 Ga0105242_10189530
443 Ga0105248_10226848
444 Ga0105249_10166137
445 Ga0105249_10374981
446 Ga0157369_10388340
447 Ga0157374_10099209
448 Ga0157378_10037734
449 Ga0157378_10146258
450 Ga0157378_10176833
451 Ga0157378_10391763
452 Ga0163162_10013952
453 Ga0157375_10076230
454 Ga0157375_10484709
455 Ga0157375_10503344
456 Ga0163163_10001204
457 Ga0157380_10000208
458 Ga0157380_10149250
459 Ga0157377_10032659
460 Ga0157379_10095615
461 Ga0157376_10275918
462 Ga0157376_11135081
463 Ga0163161_10264393
464 Ga0207697_10084027
465 Ga0207697_10088552
466 Ga0207656_10022459
467 Ga0207642_10039646
468 Ga0207688_10013731
469 Ga0207680_10029902
470 Ga0207680_10096803
471 Ga0207645_10007078
472 Ga0207645_10016912
473 Ga0207705_10284370
474 Ga0207662_10003617
475 Ga0207652_10143603
476 Ga0207646_10152053
477 Ga0207681_10198173
478 Ga0207681_10260997
479 Ga0207650_10032735
480 Ga0207659_10030224
481 Ga0207659_10047288
482 Ga0207659_10047686
483 Ga0207659_10054990
484 Ga0207659_10127743
485 Ga0207644_10004153
486 Ga0207644_10023887
487 Ga0207690_10262722
488 Ga0207706_10030076
489 Ga0207706_10040195
490 Ga0207709_10132583
491 Ga0207709_10671717
492 Ga0207670_10003507
493 Ga0207669_10077284
494 Ga0207704_10217543
495 Ga0207691_10022423
496 Ga0207691_10048014
497 Ga0207711_10165863
498 Ga0207689_10046613
499 Ga0207679_10003490
500 Ga0207679_10023722
501 Ga0207651_10149020
502 Ga0207651_10191201
503 Ga0207668_10011123
504 Ga0207640_10111055
505 Ga0207640_10235131
506 Ga0207658_10030883
507 Ga0207658_10043230
508 Ga0207658_10171692
509 Ga0207703_10046604
510 Ga0207708_10073405
511 Ga0207708_10164616
512 Ga0207641_10012470
513 Ga0207641_10031691
514 Ga0207641_10122890
515 Ga0207648_10026165
516 Ga0207648_10124687
517 Ga0207676_10003649
518 Ga0207676_10211293
519 Ga0207674_10010961
520 Ga0207675_100017110
521 Ga0207675_100201388
522 Ga0207683_10035874
523 Ga0207683_10071759
524 Ga0207683_10116595
525 Ga0207698_10032560
526 Ga0209999_1011740
527 Ga0209974_10022278
528 Ga0207428_10001970
529 Ga0207428_10002262
530 Ga0268266_10570493
531 Ga0268266_10658672
532 Ga0268265_10001835
533 Ga0268265_10957633
534 Ga0268264_10008900
535 Ga0268264_10067290
536 Ga0307513_10252286
537 Ga0307509_10000062
538 Ga0307408_100016356
539 Ga0316575_10040393
540 Ga0316576_10223007
541 Ga0307413_10204130
542 Ga0307406_10119429
543 Ga0307406_10189084
544 Ga0307406_10322363
545 Ga0307406_10389454
546 Ga0307407_10455141
547 Ga0307412_10125147
548 Ga0307412_10198111
549 Ga0307409_100466790
550 Ga0307416_100006261
551 Ga0307411_10518213
552 Ga0307415_100178097
553 Ga0307415_100763503
554 Ga0373958_0010926
555 Ga0373934_0042138
556 Ga0373936_0047167
557 Ga0373937_0051841
558 Ga0373937_0077356
559 Ga0439442_021329
560 Ga0439460_0069287
561 Ga0451577_0045635
562 Ga0451577_0165313
563 Ga0466961_0000291
564 Ga0453684_0172431
565 Ga0453684_0216965
566 Ga0451576_0017344
567 Ga0451576_0044892
568 Ga0495617_034280
569 Ga0495638_0001247
570 Ga0495638_0039532
571 Ga0495594_0144043
572 Ga0495632_0075841
573 Ga0495598_0010694
574 Ga0495625_0030507
575 Ga0495625_0253413
576 Ga0495626_0191970
577 Ga0496104_0093278
578 Ga0496108_0014296
579 Ga0496108_0134002
580 Ga0496109_0008517
581 Ga0496109_0116576
582 Ga0496110_0025298
583 Ga0496110_0523288
584 Ga0496112_0260560
585 Ga0496113_0040998
586 Ga0496114_0059086
587 Ga0496121_0051271
588 Ga0501036_0029435
589 Ga0501038_0166584
590 Ga0501039_0084362
591 Ga0501040_0035473
592 Ga0501041_0001545
593 Ga0501047_0547405
594 Ga0501071_0009110
595 Ga0501071_0437813
596 Ga0501076_0000992
597 Ga0501076_0008586
598 Ga0501079_0014254
599 Ga0501079_0116604
600 Ga0501080_0002667
601 Ga0501080_0033517
602 Ga0501081_0000988
603 Ga0501081_0476115
604 Ga0501035_0337102
605 Ga0501045_0011739
606 nmdc:mga05p37_1293903_c1
607 nmdc:mga05p37_131955_c1
608 nmdc:mga09592_118295_c1
609 nmdc:mga09592_143894_c1
610 nmdc:mga09592_22681_c1
611 nmdc:mga09592_4416_c1
612 nmdc:mga0qj67_114505_c1
613 nmdc:mga0qj67_176389_c1
614 nmdc:mga0qj67_29536_c1
615 nmdc:mga0qj67_8984_c1
616 nmdc:mga0qj67_9632_c1
617 nmdc:mga06r32_103168_c1
618 nmdc:mga06r32_48983_c1
619 nmdc:mga06r32_73032_c1
620 nmdc:mga06r32_88_c1
621 nmdc:mga08y16_454416_c1
622 nmdc:mga08y16_653_c1
623 nmdc:mga08y16_77_c1
624 nmdc:mga08y16_865426_c1
625 nmdc:mga0rr50_28979_c1
626 nmdc:mga0rr50_898836_c1
627 nmdc:mga08x19_261989_c1
628 Ga0500562_051562
629 Ga0500617_084097
630 Ga0500627_0094488
631 Ga0501084_0193648
632 Ga0501082_0001958
633 Ga0501082_0640539
634 Ga0530510_0176039

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

18

164

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xu1-assembly1.cif.gz_A structure of a non-canonical abc transporter from streptococcus pneumoniae r6 0.9482 1 219
8tzj-assembly1.cif.gz_A cryo-em structure of vibrio cholerae ftse/ftsx complex 0.9386 2 219
6z4w-assembly1.cif.gz_A ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) 0.9373 2 221
5ws4-assembly1.cif.gz_B crystal structure of tripartite-type abc transporter macb from acinetobacter baumannii 0.9367 2 221
7w7a-assembly2.cif.gz_E heme exporter in complex with mn-containing protoporphyrin ix, mn-anomalous data 0.935 2 217
ID Description Score Start End Superfamily
af_P9WQK1_1_231_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9507 2 224 3.40.50.300
5xu1A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9482 1 219 3.40.50.300
af_P0A9T8_2_228_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9454 2 222 3.40.50.300
af_O05779_1_226_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9447 1 221 3.40.50.300
af_Q2FVR1_1_221_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9443 2 219 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1I3TBZ0-F1-model_v4 Putative ABC transport system ATP-binding protein 0.9674 2 219 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A3C0M3S7-F1-model_v4 deleted 0.9654 1 222
AF-A0A3C0M3S7-F1-model_v4 deleted 0.9611 1 222
AF-A0A075HTZ4-F1-model_v4 ABC transporter ATP-binding protein (ABC.CD.A) 0.9599 2 218 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A538RLX8-F1-model_v4 ABC transporter ATP-binding protein 0.9597 1 224 GO:0005524
GO:0005886
GO:0016887
GO:0022857

Map