F404246

General Info

Members Datasets Scaffolds Average Seq Length
317 235 634 124

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0502268|Ga0395899_0502268_78_503
Length 141
Sequence METMAESTFSISAMTPMPASDSPEAVVQRQLDAYNARDLDALLATYAPDARQYELPGKLLATGHAEMRPRFAVRFQEPDLHARLLQRAVMGNIVIDHETVSRNFPEGRGKVDLVAIYEVADGLIRSQTVQVSNQRLDAQAD

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
16 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
17 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
18 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
19 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
20 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
21 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
22 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
23 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
24 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
25 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
26 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
27 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
28 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
31 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
32 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
33 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
34 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
35 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
36 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
37 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
38 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
39 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
40 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
41 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
42 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
43 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
44 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
45 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
46 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
47 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
48 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
49 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
50 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
51 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
52 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
53 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
71 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
72 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
73 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
74 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
75 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
76 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
77 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
78 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
79 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
80 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
81 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
82 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
83 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
84 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
85 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
86 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
87 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
88 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
89 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
90 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
91 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
92 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
93 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
94 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
95 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
96 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
97 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
98 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
99 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
100 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
101 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
102 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
103 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
104 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
105 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
106 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
107 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
108 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
109 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
110 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
111 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
112 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
113 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
114 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
115 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
116 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
117 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
118 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
119 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
120 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
121 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
122 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
123 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
124 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
125 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
126 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
127 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
128 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
129 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
130 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
131 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
132 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
133 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
134 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
135 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
136 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
137 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
138 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
139 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
140 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
141 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
142 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
143 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
144 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
145 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
146 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
147 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
148 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
149 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
150 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
151 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
152 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
153 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
154 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
155 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
156 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
157 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
158 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
159 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
160 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
161 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
162 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
163 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
164 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
165 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
166 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
167 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
168 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
169 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
170 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
171 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
172 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
173 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
174 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
175 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
176 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
177 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
178 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
179 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
180 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
181 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
182 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
183 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
184 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
185 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
186 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
187 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
188 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
189 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
190 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
191 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
192 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
193 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
194 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
195 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
196 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
197 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
198 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
200 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
201 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
202 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
203 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
204 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
205 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
206 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
210 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
211 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
212 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
213 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
214 2643221556 Massilia sp. Root1485 Isolate Unclassified
215 2643221607 Rhizobium sp. Root73 Isolate Unclassified
216 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
217 2643221684 Massilia sp. Root133 Isolate Unclassified
218 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
219 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
220 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
221 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
222 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
223 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
224 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
225 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
226 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
227 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
228 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
229 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
230 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
231 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
232 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
233 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
234 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
235 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 90.54
Metatranscriptomes 0.95
Isolates 8.52

Biome Distribution

Category Percentage (%)
Aerial Root 0.32
Bulb 0
Endosphere 7.89
Nodule 1.89
Rhizoplane 3.47
Rhizosphere 78.86
Stem 0
Stem Tuber 0
Unclassified 1.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0502268 3300037312 Bacteria 786
2 JGI25158J39367_1001568 3300002739 Bacteria 3959
3 JGI25152J39213_1003240 3300002773 Bacteria 5652
4 JGI25151J46595_10036171 3300003187 Bacteria 1866
5 JGI25153J46596_10000365 3300003215 Bacteria 31062
6 JGI25153J46596_10011189 3300003215 Bacteria 3986
7 Ga0055530_10075236 3300003791 Bacteria 720
8 Ga0065704_10268876 3300005289 Bacteria 948
9 Ga0070660_100020154 3300005339 Bacteria 4897
10 Ga0070661_100004868 3300005344 Bacteria 9244
11 Ga0070675_101577527 3300005354 Bacteria 606
12 Ga0070659_100090193 3300005366 Bacteria 2456
13 Ga0070678_100133626 3300005456 Bacteria 1975
14 Ga0070678_101648114 3300005456 Bacteria 603
15 Ga0070662_100242905 3300005457 Bacteria 1445
16 Ga0068867_100365584 3300005459 Bacteria 1208
17 Ga0068853_100456097 3300005539 Bacteria 1203
18 Ga0070696_100100390 3300005546 Bacteria 2073
19 Ga0068855_100135297 3300005563 Bacteria 2812
20 Ga0070664_100039888 3300005564 Bacteria 3958
21 Ga0068854_100134759 3300005578 Bacteria 1890
22 Ga0068852_100050614 3300005616 Bacteria 3560
23 Ga0075365_10692303 3300006038 Bacteria 720
24 Ga0075364_10000069 3300006051 Bacteria 39713
25 Ga0075364_10129801 3300006051 Bacteria 1691
26 Ga0070716_100516080 3300006173 Bacteria 884
27 Ga0068871_100753369 3300006358 Unclassified 895
28 Ga0068865_100352503 3300006881 Bacteria 1193
29 Ga0099826_10043626 3300006948 Bacteria 3085
30 Ga0105244_10023572 3300009036 Bacteria 3372
31 Ga0105240_10785560 3300009093 Bacteria 1032
32 Ga0105245_10167392 3300009098 Bacteria 2090
33 Ga0105243_10071165 3300009148 Bacteria 2811
34 Ga0105243_11294607 3300009148 Bacteria 746
35 Ga0105241_10021403 3300009174 Bacteria 4780
36 Ga0105242_10086517 3300009176 Bacteria 2630
37 Ga0105237_10034774 3300009545 Bacteria 5100
38 Ga0105238_10697593 3300009551 Bacteria 1027
39 Ga0105246_10210878 3300011119 Bacteria 1516
40 Ga0171463_1002 3300013249 Bacteria 1274851
41 Ga0157374_10703763 3300013296 Bacteria 1023
42 Ga0157378_11884904 3300013297 Bacteria 647
43 Ga0157372_10257001 3300013307 Bacteria 2028
44 Ga0157372_11320720 3300013307 Bacteria 832
45 Ga0182008_10001618 3300014497 Bacteria 14925
46 Ga0182006_1286473 3300015261 Bacteria 540
47 Ga0183363_1360 3300015690 Bacteria 4996
48 Ga0163161_10410259 3300017792 Bacteria 1088
49 Ga0213872_10021930 3300021361 Bacteria 2941
50 Ga0207425_1000686 3300025245 Bacteria 18501
51 Ga0209148_1000292 3300025254 Bacteria 74834
52 Ga0209129_1000035 3300025258 Bacteria 329303
53 Ga0209565_1012048 3300025263 Bacteria 2078
54 Ga0209565_1014718 3300025263 Bacteria 1787
55 Ga0209673_1016225 3300025273 Bacteria 2795
56 Ga0209564_1000024 3300025295 Bacteria 535041
57 Ga0209758_1000066 3300025297 Bacteria 298620
58 Ga0209758_1000213 3300025297 Bacteria 126745
59 Ga0209256_1041970 3300025299 Bacteria 1159
60 Ga0207705_10001893 3300025909 Bacteria 16406
61 Ga0207654_10009723 3300025911 Bacteria 4892
62 Ga0207695_10658574 3300025913 Bacteria 928
63 Ga0207671_10117799 3300025914 Bacteria 2027
64 Ga0207657_10010733 3300025919 Bacteria 9120
65 Ga0207694_10809920 3300025924 Bacteria 791
66 Ga0207659_10553205 3300025926 Bacteria 978
67 Ga0207690_10079772 3300025932 Bacteria 2282
68 Ga0207686_10008166 3300025934 Bacteria 5647
69 Ga0207709_10009923 3300025935 Bacteria 5245
70 Ga0207704_10074309 3300025938 Bacteria 2169
71 Ga0207679_10114972 3300025945 Bacteria 2131
72 Ga0207667_10027089 3300025949 Bacteria 6249
73 Ga0207640_10297798 3300025981 Bacteria 1275
74 Ga0207639_10694904 3300026041 Bacteria 943
75 Ga0207683_11021756 3300026121 Bacteria 767
76 Ga0209371_1000852 3300027312 Bacteria 24736
77 Ga0209371_1001634 3300027312 Bacteria 14475
78 Ga0209282_1037667 3300027666 Bacteria 2904
79 Ga0265323_10006246 3300028653 Bacteria 5014
80 Ga0268256_1005849 3300030500 Bacteria 4720
81 Ga0316177_1065328 3300030731 Bacteria 8758
82 Ga0316180_1015449 3300030736 Bacteria 2402
83 Ga0316182_1098467 3300030745 Bacteria 8015
84 Ga0265316_10207403 3300031344 Bacteria 1451
85 Ga0307416_100606080 3300032002 Bacteria 1175
86 Ga0307411_11285980 3300032005 Bacteria 666
87 Ga0373947_0719742 3300035725 Unclassified 681
88 Ga0395899_0007438 3300037312 Bacteria 8460
89 Ga0395899_0011562 3300037312 Bacteria 6757
90 Ga0395900_0003460 3300037418 Bacteria 17050
91 Ga0395900_0155390 3300037418 Bacteria 2336
92 Ga0395900_0249770 3300037418 Bacteria 1775
93 Ga0395900_0497088 3300037418 Bacteria 1170
94 Ga0395898_0269057 3300037466 Bacteria 1625
95 Ga0395898_0361973 3300037466 Bacteria 1383
96 Ga0395905_0166062 3300037471 Bacteria 2074
97 Ga0395905_0401014 3300037471 Bacteria 1266
98 Ga0395901_0000044 3300038443 Bacteria 197088
99 Ga0395901_0127133 3300038443 Bacteria 2678
100 Ga0395901_0328853 3300038443 Bacteria 1580
101 Ga0436361_0624214 3300039447 Bacteria 5305
102 Ga0439448_0004894 3300042005 Bacteria 3799
103 Ga0450898_003682 3300042134 Bacteria 2216
104 Ga0439458_0187776 3300042157 Bacteria 562
105 Ga0439434_0028703 3300042435 Bacteria 1686
106 Ga0450918_100597 3300042531 Bacteria 565
107 Ga0466969_0024961 3300044656 Bacteria 3074
108 Ga0466972_0000548 3300044658 Bacteria 18421
109 Ga0466965_0008001 3300044683 Bacteria 4877
110 Ga0466965_0049788 3300044683 Bacteria 2076
111 Ga0466966_0002648 3300044684 Bacteria 11728
112 Ga0466966_0114645 3300044684 Bacteria 1659
113 Ga0466961_0108967 3300044693 Bacteria 1743
114 Ga0466963_0031202 3300044694 Bacteria 3444
115 Ga0466963_0219644 3300044694 Bacteria 1331
116 Ga0466964_0000133 3300044706 Bacteria 19447
117 Ga0466964_0498550 3300044706 Bacteria 653
118 Ga0453684_1305807 3300044712 Bacteria 757
119 Ga0466971_0685755 3300044719 Bacteria 514
120 Ga0466968_0000499 3300044735 Bacteria 13309
121 Ga0466970_0191001 3300044765 Bacteria 1138
122 Ga0466957_0003936 3300044842 Bacteria 8208
123 Ga0466957_0087205 3300044842 Bacteria 1951
124 Ga0466960_0164866 3300044901 Bacteria 1192
125 Ga0466959_0055449 3300045049 Bacteria 2893
126 Ga0466959_0075423 3300045049 Bacteria 2436
127 Ga0466958_0038395 3300045836 Bacteria 2873
128 Ga0466967_0001466 3300045976 Bacteria 13726
129 Ga0466967_0646778 3300045976 Bacteria 1045
130 Ga0495592_0605093 3300046454 Bacteria 668
131 Ga0495653_0014909 3300046463 Bacteria 6339
132 Ga0495653_0104175 3300046463 Bacteria 2050
133 Ga0495650_0000056 3300046471 Bacteria 307565
134 Ga0495650_0000351 3300046471 Bacteria 81358
135 Ga0495580_0023783 3300046472 Bacteria 4493
136 Ga0495582_0120760 3300046473 Bacteria 1476
137 Ga0495605_0005561 3300046474 Bacteria 7331
138 Ga0495605_0089300 3300046474 Bacteria 1430
139 Ga0495605_0090618 3300046474 Bacteria 1417
140 Ga0495584_0000031 3300046491 Bacteria 100128
141 Ga0495584_0004406 3300046491 Bacteria 7584
142 Ga0495585_0188726 3300046492 Bacteria 1055
143 Ga0495594_0196137 3300046499 Bacteria 1150
144 Ga0495596_0002256 3300046500 Bacteria 10490
145 Ga0495596_0019523 3300046500 Bacteria 2782
146 Ga0495596_0023001 3300046500 Bacteria 2531
147 Ga0495607_0000402 3300046501 Bacteria 43913
148 Ga0495607_0097888 3300046501 Bacteria 1576
149 Ga0495583_0000074 3300046506 Bacteria 177273
150 Ga0495583_0000106 3300046506 Bacteria 140932
151 Ga0495606_0009957 3300046507 Bacteria 7950
152 Ga0495606_0293344 3300046507 Bacteria 884
153 Ga0495616_0018180 3300046513 Bacteria 3864
154 Ga0495616_0052046 3300046513 Bacteria 2039
155 Ga0495616_0196909 3300046513 Bacteria 887
156 Ga0495630_0043462 3300046517 Bacteria 3357
157 Ga0495631_0002082 3300046518 Bacteria 11623
158 Ga0495632_0001750 3300046519 Bacteria 17560
159 Ga0495632_0001965 3300046519 Bacteria 16348
160 Ga0495632_0036813 3300046519 Bacteria 2487
161 Ga0495643_0000362 3300046522 Bacteria 61748
162 Ga0495643_0019672 3300046522 Bacteria 3902
163 Ga0495643_0335744 3300046522 Bacteria 680
164 Ga0495644_0004765 3300046523 Bacteria 5328
165 Ga0495648_0005442 3300046524 Bacteria 10572
166 Ga0495648_0028800 3300046524 Bacteria 3695
167 Ga0495666_0004986 3300046526 Bacteria 6717
168 Ga0495666_0013142 3300046526 Bacteria 4125
169 Ga0495642_0012678 3300046528 Bacteria 3252
170 Ga0495642_0022464 3300046528 Bacteria 2486
171 Ga0495652_0014111 3300046529 Bacteria 7176
172 Ga0495665_0135210 3300046531 Bacteria 1290
173 Ga0495586_0047407 3300046535 Bacteria 2319
174 Ga0495587_0029387 3300046536 Bacteria 3336
175 Ga0495587_0130152 3300046536 Bacteria 1438
176 Ga0495587_0639811 3300046536 Bacteria 584
177 Ga0495609_0000150 3300046538 Bacteria 72210
178 Ga0495609_0250928 3300046538 Bacteria 728
179 Ga0495597_0026310 3300046542 Bacteria 2673
180 Ga0495597_0106914 3300046542 Bacteria 1176
181 Ga0495645_0035323 3300046543 Bacteria 3644
182 Ga0495645_0816237 3300046543 Bacteria 559
183 Ga0495622_0105199 3300046557 Bacteria 1293
184 Ga0495633_0005743 3300046558 Bacteria 7500
185 Ga0495633_0583420 3300046558 Bacteria 503
186 Ga0495656_0017471 3300046615 Bacteria 2738
187 Ga0495656_0029942 3300046615 Bacteria 2196
188 Ga0495656_0110804 3300046615 Bacteria 1283
189 Ga0495668_0075666 3300046616 Bacteria 1849
190 Ga0495668_0077341 3300046616 Bacteria 1826
191 Ga0495668_0220255 3300046616 Bacteria 1039
192 Ga0495634_0001354 3300046642 Bacteria 22298
193 Ga0495611_0047419 3300046648 Bacteria 1928
194 Ga0495625_0022399 3300046660 Bacteria 4844
195 Ga0495659_0007759 3300046664 Bacteria 3404
196 Ga0495659_0196866 3300046664 Bacteria 825
197 Ga0495659_0198739 3300046664 Bacteria 822
198 Ga0495661_0022190 3300046665 Bacteria 4130
199 Ga0495661_0038735 3300046665 Bacteria 2966
200 Ga0495661_0064664 3300046665 Bacteria 2157
201 Ga0495661_0148627 3300046665 Bacteria 1267
202 Ga0495588_0000125 3300046674 Bacteria 130469
203 Ga0495588_0036458 3300046674 Bacteria 2495
204 Ga0495588_0109923 3300046674 Bacteria 1452
205 Ga0495623_0000450 3300046679 Bacteria 27056
206 Ga0495623_0042278 3300046679 Bacteria 2904
207 Ga0495646_0388101 3300046680 Bacteria 727
208 Ga0495670_0104583 3300046691 Bacteria 1461
209 Ga0495649_0002289 3300046694 Bacteria 13611
210 Ga0495649_0052770 3300046694 Bacteria 2202
211 Ga0495649_0097922 3300046694 Bacteria 1560
212 Ga0495589_0001905 3300046794 Bacteria 11804
213 Ga0495589_0531306 3300046794 Bacteria 536
214 Ga0495600_0034976 3300046809 Bacteria 3262
215 Ga0495660_0001623 3300046810 Bacteria 15095
216 Ga0495660_0296114 3300046810 Bacteria 735
217 Ga0495581_0022215 3300047315 Bacteria 3676
218 Ga0495604_0051000 3300047317 Bacteria 3210
219 Ga0495636_0375628 3300047318 Unclassified 674
220 Ga0495672_0000101 3300047320 Bacteria 139193
221 Ga0495672_0030183 3300047320 Bacteria 3405
222 Ga0495672_0427157 3300047320 Bacteria 601
223 Ga0495676_0070885 3300047321 Bacteria 2681
224 Ga0495680_0128622 3300047322 Bacteria 1863
225 Ga0495683_0001745 3300047323 Bacteria 13729
226 Ga0495683_0149274 3300047323 Bacteria 1089
227 Ga0495687_000205 3300047443 Bacteria 84650
228 Ga0495675_0001580 3300047444 Bacteria 13738
229 Ga0495675_0012609 3300047444 Bacteria 5320
230 Ga0495677_0000521 3300047445 Bacteria 16089
231 Ga0495677_0003014 3300047445 Bacteria 6547
232 Ga0495677_0162593 3300047445 Bacteria 862
233 Ga0495679_107329 3300047446 Bacteria 771
234 Ga0495685_052627 3300047447 Bacteria 1379
235 Ga0495681_0007299 3300047470 Bacteria 7083
236 Ga0495593_0135578 3300047673 Bacteria 1248
237 Ga0495602_0031762 3300048088 Bacteria 4986
238 Ga0495614_0166721 3300048089 Bacteria 987
239 Ga0495626_0004266 3300048091 Bacteria 8824
240 Ga0495626_0008846 3300048091 Bacteria 5474
241 Ga0495626_0024888 3300048091 Bacteria 2931
242 Ga0495626_0036587 3300048091 Bacteria 2337
243 Ga0496102_0087493 3300048905 Bacteria 2878
244 Ga0496102_0914273 3300048905 Bacteria 799
245 Ga0496102_0929589 3300048905 Bacteria 791
246 Ga0496104_0071540 3300048907 Bacteria 3298
247 Ga0496106_0069454 3300048909 Bacteria 2689
248 Ga0496107_0499053 3300048910 Bacteria 903
249 Ga0496110_0113519 3300048913 Bacteria 2437
250 Ga0496114_0679871 3300048917 Bacteria 904
251 Ga0496115_0315964 3300048918 Bacteria 1278
252 Ga0496116_0000080 3300048919 Bacteria 224530
253 Ga0496116_0027785 3300048919 Bacteria 4111
254 Ga0496117_0230351 3300048920 Bacteria 1024
255 Ga0496118_0092575 3300048921 Bacteria 2074
256 Ga0496119_0017789 3300048922 Bacteria 5329
257 Ga0496119_0081630 3300048922 Bacteria 1861
258 Ga0496120_0027561 3300048923 Bacteria 3492
259 Ga0496122_0011009 3300048925 Bacteria 9243
260 Ga0496124_0001513 3300048927 Bacteria 33856
261 Ga0496124_0003305 3300048927 Bacteria 19883
262 Ga0496125_0066316 3300048928 Bacteria 2854
263 Ga0496126_0255357 3300048929 Bacteria 1459
264 Ga0495678_024755 3300049459 Bacteria 2587
265 Ga0501292_105382 3300049515 Bacteria 562
266 Ga0501293_005199 3300049516 Bacteria 1040
267 Ga0501294_004677 3300049517 Bacteria 1291
268 Ga0501295_156246 3300049518 Bacteria 565
269 Ga0501297_093131 3300049520 Unclassified 504
270 Ga0501298_058638 3300049521 Bacteria 811
271 Ga0501206_002395 3300049653 Bacteria 2365
272 Ga0501249_039666 3300049679 Bacteria 1065
273 Ga0501257_004828 3300049686 Bacteria 2950
274 Ga0501262_001710 3300049759 Bacteria 2463
275 Ga0501265_001830 3300049762 Bacteria 2410
276 Ga0501281_01588 3300049777 Bacteria 1765
277 Ga0501035_0002896 3300049822 Bacteria 16527
278 Ga0501044_0162144 3300049823 Bacteria 2211
279 nmdc:mga00v17_49_c1 3300050491 Bacteria 74057
280 nmdc:mga07m45_143498_c1 3300050496 Bacteria 1383
281 nmdc:mga0sz30_111576_c1 3300050516 Bacteria 1199
282 Ga0500572_000934 3300053111 Bacteria 8946
283 Ga0500573_0002375 3300053140 Bacteria 9382
284 Ga0500636_0000859 3300053177 Bacteria 16342
285 Ga0587080_067903 3300059503 Bacteria 708
286 Ga0587068_066126 3300059641 Bacteria 705
287 Ga0587079_040871 3300059647 Bacteria 936
288 Ga0466962_0210937 3300061719 Bacteria 950
289 Ga0466962_0451561 3300061719 Bacteria 647
290 Ga0466962_0561530 3300061719 Bacteria 580
291 2523470844 2523231067 Bacteria 5230452
292 2537874396 2537561587 Bacteria 5425293
293 2601609029 2600255279 Bacteria 5605316
294 2601745804 2600255308 Bacteria 5611129
295 2643801341 2643221556 Bacteria 7251154
296 2644051760 2643221607 Bacteria 6314006
297 2644200244 2643221636 Bacteria 6583769
298 2644471759 2643221684 Bacteria 7145183
299 2644480628 2643221686 Bacteria 6310811
300 2739351438 2738543031 Bacteria 5769731
301 2809145656 2808606418 Bacteria 6724496
302 2841860309 2841859092 Bacteria 5436171
303 2842517094 2842515876 Bacteria 5436280
304 2894775178 2894772417 Bacteria 5305674
305 2899792374 2899792073 Bacteria 4926588
306 2899848394 2899845264 Bacteria 5672268
307 2919108122 2919100787 Bacteria 7710546
308 2928525283 2928521798 Bacteria 4960112
309 2928525504 2928521798 Bacteria 4960112
310 2933012263 2933011516 Bacteria 5439334
311 2933594708 2933594066 Bacteria 5594265
312 2978973357 2978969890 Bacteria 5400756
313 2984591639 2984587000 Bacteria 5263363
314 3005419421 3005416602 Bacteria 7064308
315 8003570193 8003570095 Bacteria 5747666
316 8005318894 8005314921 Bacteria 7072929
317 8055432225 8055431914 Bacteria 4551896
318 Ga0395899_0502268
319 JGI25158J39367_1001568
320 JGI25152J39213_1003240
321 JGI25151J46595_10036171
322 JGI25153J46596_10000365
323 JGI25153J46596_10011189
324 Ga0055530_10075236
325 Ga0065704_10268876
326 Ga0070660_100020154
327 Ga0070661_100004868
328 Ga0070675_101577527
329 Ga0070659_100090193
330 Ga0070678_100133626
331 Ga0070678_101648114
332 Ga0070662_100242905
333 Ga0068867_100365584
334 Ga0068853_100456097
335 Ga0070696_100100390
336 Ga0068855_100135297
337 Ga0070664_100039888
338 Ga0068854_100134759
339 Ga0068852_100050614
340 Ga0075365_10692303
341 Ga0075364_10000069
342 Ga0075364_10129801
343 Ga0070716_100516080
344 Ga0068871_100753369
345 Ga0068865_100352503
346 Ga0099826_10043626
347 Ga0105244_10023572
348 Ga0105240_10785560
349 Ga0105245_10167392
350 Ga0105243_10071165
351 Ga0105243_11294607
352 Ga0105241_10021403
353 Ga0105242_10086517
354 Ga0105237_10034774
355 Ga0105238_10697593
356 Ga0105246_10210878
357 Ga0171463_1002
358 Ga0157374_10703763
359 Ga0157378_11884904
360 Ga0157372_10257001
361 Ga0157372_11320720
362 Ga0182008_10001618
363 Ga0182006_1286473
364 Ga0183363_1360
365 Ga0163161_10410259
366 Ga0213872_10021930
367 Ga0207425_1000686
368 Ga0209148_1000292
369 Ga0209129_1000035
370 Ga0209565_1012048
371 Ga0209565_1014718
372 Ga0209673_1016225
373 Ga0209564_1000024
374 Ga0209758_1000066
375 Ga0209758_1000213
376 Ga0209256_1041970
377 Ga0207705_10001893
378 Ga0207654_10009723
379 Ga0207695_10658574
380 Ga0207671_10117799
381 Ga0207657_10010733
382 Ga0207694_10809920
383 Ga0207659_10553205
384 Ga0207690_10079772
385 Ga0207686_10008166
386 Ga0207709_10009923
387 Ga0207704_10074309
388 Ga0207679_10114972
389 Ga0207667_10027089
390 Ga0207640_10297798
391 Ga0207639_10694904
392 Ga0207683_11021756
393 Ga0209371_1000852
394 Ga0209371_1001634
395 Ga0209282_1037667
396 Ga0265323_10006246
397 Ga0268256_1005849
398 Ga0316177_1065328
399 Ga0316180_1015449
400 Ga0316182_1098467
401 Ga0265316_10207403
402 Ga0307416_100606080
403 Ga0307411_11285980
404 Ga0373947_0719742
405 Ga0395899_0007438
406 Ga0395899_0011562
407 Ga0395900_0003460
408 Ga0395900_0155390
409 Ga0395900_0249770
410 Ga0395900_0497088
411 Ga0395898_0269057
412 Ga0395898_0361973
413 Ga0395905_0166062
414 Ga0395905_0401014
415 Ga0395901_0000044
416 Ga0395901_0127133
417 Ga0395901_0328853
418 Ga0436361_0624214
419 Ga0439448_0004894
420 Ga0450898_003682
421 Ga0439458_0187776
422 Ga0439434_0028703
423 Ga0450918_100597
424 Ga0466969_0024961
425 Ga0466972_0000548
426 Ga0466965_0008001
427 Ga0466965_0049788
428 Ga0466966_0002648
429 Ga0466966_0114645
430 Ga0466961_0108967
431 Ga0466963_0031202
432 Ga0466963_0219644
433 Ga0466964_0000133
434 Ga0466964_0498550
435 Ga0453684_1305807
436 Ga0466971_0685755
437 Ga0466968_0000499
438 Ga0466970_0191001
439 Ga0466957_0003936
440 Ga0466957_0087205
441 Ga0466960_0164866
442 Ga0466959_0055449
443 Ga0466959_0075423
444 Ga0466958_0038395
445 Ga0466967_0001466
446 Ga0466967_0646778
447 Ga0495592_0605093
448 Ga0495653_0014909
449 Ga0495653_0104175
450 Ga0495650_0000056
451 Ga0495650_0000351
452 Ga0495580_0023783
453 Ga0495582_0120760
454 Ga0495605_0005561
455 Ga0495605_0089300
456 Ga0495605_0090618
457 Ga0495584_0000031
458 Ga0495584_0004406
459 Ga0495585_0188726
460 Ga0495594_0196137
461 Ga0495596_0002256
462 Ga0495596_0019523
463 Ga0495596_0023001
464 Ga0495607_0000402
465 Ga0495607_0097888
466 Ga0495583_0000074
467 Ga0495583_0000106
468 Ga0495606_0009957
469 Ga0495606_0293344
470 Ga0495616_0018180
471 Ga0495616_0052046
472 Ga0495616_0196909
473 Ga0495630_0043462
474 Ga0495631_0002082
475 Ga0495632_0001750
476 Ga0495632_0001965
477 Ga0495632_0036813
478 Ga0495643_0000362
479 Ga0495643_0019672
480 Ga0495643_0335744
481 Ga0495644_0004765
482 Ga0495648_0005442
483 Ga0495648_0028800
484 Ga0495666_0004986
485 Ga0495666_0013142
486 Ga0495642_0012678
487 Ga0495642_0022464
488 Ga0495652_0014111
489 Ga0495665_0135210
490 Ga0495586_0047407
491 Ga0495587_0029387
492 Ga0495587_0130152
493 Ga0495587_0639811
494 Ga0495609_0000150
495 Ga0495609_0250928
496 Ga0495597_0026310
497 Ga0495597_0106914
498 Ga0495645_0035323
499 Ga0495645_0816237
500 Ga0495622_0105199
501 Ga0495633_0005743
502 Ga0495633_0583420
503 Ga0495656_0017471
504 Ga0495656_0029942
505 Ga0495656_0110804
506 Ga0495668_0075666
507 Ga0495668_0077341
508 Ga0495668_0220255
509 Ga0495634_0001354
510 Ga0495611_0047419
511 Ga0495625_0022399
512 Ga0495659_0007759
513 Ga0495659_0196866
514 Ga0495659_0198739
515 Ga0495661_0022190
516 Ga0495661_0038735
517 Ga0495661_0064664
518 Ga0495661_0148627
519 Ga0495588_0000125
520 Ga0495588_0036458
521 Ga0495588_0109923
522 Ga0495623_0000450
523 Ga0495623_0042278
524 Ga0495646_0388101
525 Ga0495670_0104583
526 Ga0495649_0002289
527 Ga0495649_0052770
528 Ga0495649_0097922
529 Ga0495589_0001905
530 Ga0495589_0531306
531 Ga0495600_0034976
532 Ga0495660_0001623
533 Ga0495660_0296114
534 Ga0495581_0022215
535 Ga0495604_0051000
536 Ga0495636_0375628
537 Ga0495672_0000101
538 Ga0495672_0030183
539 Ga0495672_0427157
540 Ga0495676_0070885
541 Ga0495680_0128622
542 Ga0495683_0001745
543 Ga0495683_0149274
544 Ga0495687_000205
545 Ga0495675_0001580
546 Ga0495675_0012609
547 Ga0495677_0000521
548 Ga0495677_0003014
549 Ga0495677_0162593
550 Ga0495679_107329
551 Ga0495685_052627
552 Ga0495681_0007299
553 Ga0495593_0135578
554 Ga0495602_0031762
555 Ga0495614_0166721
556 Ga0495626_0004266
557 Ga0495626_0008846
558 Ga0495626_0024888
559 Ga0495626_0036587
560 Ga0496102_0087493
561 Ga0496102_0914273
562 Ga0496102_0929589
563 Ga0496104_0071540
564 Ga0496106_0069454
565 Ga0496107_0499053
566 Ga0496110_0113519
567 Ga0496114_0679871
568 Ga0496115_0315964
569 Ga0496116_0000080
570 Ga0496116_0027785
571 Ga0496117_0230351
572 Ga0496118_0092575
573 Ga0496119_0017789
574 Ga0496119_0081630
575 Ga0496120_0027561
576 Ga0496122_0011009
577 Ga0496124_0001513
578 Ga0496124_0003305
579 Ga0496125_0066316
580 Ga0496126_0255357
581 Ga0495678_024755
582 Ga0501292_105382
583 Ga0501293_005199
584 Ga0501294_004677
585 Ga0501295_156246
586 Ga0501297_093131
587 Ga0501298_058638
588 Ga0501206_002395
589 Ga0501249_039666
590 Ga0501257_004828
591 Ga0501262_001710
592 Ga0501265_001830
593 Ga0501281_01588
594 Ga0501035_0002896
595 Ga0501044_0162144
596 nmdc:mga00v17_49_c1
597 nmdc:mga07m45_143498_c1
598 nmdc:mga0sz30_111576_c1
599 Ga0500572_000934
600 Ga0500573_0002375
601 Ga0500636_0000859
602 Ga0587080_067903
603 Ga0587068_066126
604 Ga0587079_040871
605 Ga0466962_0210937
606 Ga0466962_0451561
607 Ga0466962_0561530
608 2523470844
609 2537874396
610 2601609029
611 2601745804
612 2643801341
613 2644051760
614 2644200244
615 2644471759
616 2644480628
617 2739351438
618 2809145656
619 2841860309
620 2842517094
621 2894775178
622 2899792374
623 2899848394
624 2919108122
625 2928525283
626 2928525504
627 2933012263
628 2933594708
629 2978973357
630 2984591639
631 3005419421
632 8003570193
633 8005318894
634 8055432225

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12680

SnoaL_2

SnoaL-like domain

27

127

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
2k54-assembly1.cif.gz_A solution nmr structure of protein atu0742 from agrobacterium tumefaciens. northeast structural genomics consortium (nesg0) target att8. ontario center for structural proteomics target atc0727 . 0.9398 7 121
3f40-assembly1.cif.gz_A-2 crystal structure of ntf2-like protein of unknown function (yp_677363.1) from cytophaga hutchinsonii atcc 33406 at 1.27 a resolution 0.9144 12 118
1e3r-assembly1.cif.gz_A crystal structure of ketosteroid isomerase mutant d40n (d38n ti numbering) from pseudomonas putida complexed with androsten-3beta-ol-17-one 0.9105 9 118
3fzw-assembly1.cif.gz_B crystal structure of ketosteroid isomerase d40n-d103n from pseudomonas putida (pksi) with bound equilenin 0.8986 8 118
6ucw-assembly1.cif.gz_B multi-conformer model of apo ketosteroid isomerase from pseudomonas putida (pksi) at 250 k 0.8983 9 119
ID Description Score Start End Superfamily
2k54A00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9398 7 121 3.10.450.50
3ov4D00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8888 5 119 3.10.450.50
4k1uB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8812 8 118 3.10.450.50
3f40A00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8723 12 118 3.10.450.50
af_Q55DR3_11_130_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.8628 7 116 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A353GBV8-F1-model_v4 Steroid delta-isomerase 1.002 10 123 GO:0016853
AF-A0A0D6I1M3-F1-model_v4 deleted 1.002 12 121
AF-A0A4Q2T351-F1-model_v4 Steroid delta-isomerase 1.001 7 123 GO:0016853
AF-A0A7W3W9W2-F1-model_v4 deleted 1 7 121
AF-A0A1T4M2H9-F1-model_v4 SnoaL-like domain-containing protein 0.9998 9 121

Map