F404207

General Info

Members Datasets Scaffolds Average Seq Length
317 204 316 149

Family's Representative Sequence

Representative Sequence 3300028786|Ga0307517_10308595|Ga0307517_103085952
Length 146
Sequence MQIHEMFPYLRMRDAEAAVRFYKAAFGVTEKFRLVEPSGRVGHVELAFGPHILMISDEFPEYGILAADPADVRITMHLHVEDCDALIAQAIDAGATPVRAAKDQFYGERSGTVRDPFGYDWSIGHSLEALEPAEMQRRYTEMLKTA

Samples

Sample ID Description Type Environment
1 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
2 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
3 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
52 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
53 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
60 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
85 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
131 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
135 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
136 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
138 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
139 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
140 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
141 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
142 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
143 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
144 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
147 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
148 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
149 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
150 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
153 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
154 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
155 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
156 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
157 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
158 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
159 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
160 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
161 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
162 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
163 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
164 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
165 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
166 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
167 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
168 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
174 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
175 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
176 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
177 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
178 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
179 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
180 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
181 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
182 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
183 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
184 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
185 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
186 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
187 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
188 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
189 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
190 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
191 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
192 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
193 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
194 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
195 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
196 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
197 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
198 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
199 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
200 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
201 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
202 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
203 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
204 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.79
Metatranscriptomes 1.89
Isolates 0.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.31
Nodule 0
Rhizoplane 0.63
Rhizosphere 89.91
Stem 0
Stem Tuber 0
Unclassified 3.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1009770 3300001904 Bacteria 1576
2 JGI24741J21665_1004163 3300001915 Bacteria 3268
3 JGI24740J21852_10001127 3300001979 Bacteria 12096
4 rootL2_10101893 3300003322 Bacteria 2452
5 Ga0055528_1001227 3300003790 Bacteria 16369
6 Ga0070658_10065644 3300005327 Bacteria 2963
7 Ga0070658_10205488 3300005327 Bacteria 1663
8 Ga0070658_10318748 3300005327 Bacteria 1327
9 Ga0070683_100203687 3300005329 Bacteria 1879
10 Ga0070683_101190147 3300005329 Bacteria 732
11 Ga0070677_10225955 3300005333 Bacteria 917
12 Ga0068869_100049460 3300005334 Bacteria 3043
13 Ga0070666_10168948 3300005335 Bacteria 1531
14 Ga0070682_100009898 3300005337 Bacteria 5398
15 Ga0070691_10015354 3300005341 Bacteria 3519
16 Ga0070661_100060965 3300005344 Bacteria 2768
17 Ga0070661_100121056 3300005344 Bacteria 1960
18 Ga0070692_10021827 3300005345 Bacteria 3119
19 Ga0070668_100277436 3300005347 Bacteria 1399
20 Ga0070669_100012775 3300005353 Bacteria 5963
21 Ga0070669_100026322 3300005353 Bacteria 4185
22 Ga0070669_100202656 3300005353 Bacteria 1562
23 Ga0070671_100893952 3300005355 Bacteria 776
24 Ga0070674_100015724 3300005356 Bacteria 4731
25 Ga0070674_100627497 3300005356 Bacteria 911
26 Ga0070659_100088471 3300005366 Bacteria 2480
27 Ga0070659_100442183 3300005366 Bacteria 1102
28 Ga0070667_100000008 3300005367 Bacteria 285591
29 Ga0070703_10529248 3300005406 Unclassified 534
30 Ga0070694_100458471 3300005444 Bacteria 1008
31 Ga0070663_100024278 3300005455 Bacteria 4078
32 Ga0070663_100521452 3300005455 Bacteria 989
33 Ga0070662_100031542 3300005457 Bacteria 3720
34 Ga0070662_100210988 3300005457 Bacteria 1545
35 Ga0070681_10018467 3300005458 Bacteria 6970
36 Ga0070681_10522527 3300005458 Bacteria 1100
37 Ga0070706_101615154 3300005467 Unclassified 591
38 Ga0070679_100001424 3300005530 Bacteria 21153
39 Ga0070679_100337193 3300005530 Bacteria 1456
40 Ga0070684_100043385 3300005535 Bacteria 3883
41 Ga0068853_100032506 3300005539 Bacteria 4420
42 Ga0068853_101618358 3300005539 Bacteria 628
43 Ga0070695_100579887 3300005545 Bacteria 878
44 Ga0070696_100000766 3300005546 Bacteria 20607
45 Ga0070696_100014024 3300005546 Bacteria 5381
46 Ga0070696_100021034 3300005546 Bacteria 4422
47 Ga0070696_100959926 3300005546 Bacteria 712
48 Ga0070665_100519718 3300005548 Bacteria 1202
49 Ga0070704_100446659 3300005549 Bacteria 1112
50 Ga0068855_100200616 3300005563 Bacteria 2246
51 Ga0070664_100022611 3300005564 Bacteria 5184
52 Ga0068857_100445276 3300005577 Unclassified 1210
53 Ga0068854_100005171 3300005578 Bacteria 8229
54 Ga0068854_100017485 3300005578 Bacteria 4797
55 Ga0068856_100031561 3300005614 Bacteria 5184
56 Ga0068856_100663014 3300005614 Bacteria 1064
57 Ga0068852_100011983 3300005616 Bacteria 6558
58 Ga0068852_100491666 3300005616 Bacteria 1221
59 Ga0068859_100471388 3300005617 Bacteria 1351
60 Ga0068866_10142281 3300005718 Unclassified 1378
61 Ga0068861_100000305 3300005719 Bacteria 27433
62 Ga0068851_10001581 3300005834 Bacteria 9995
63 Ga0068858_100110233 3300005842 Bacteria 2570
64 Ga0068860_100077819 3300005843 Bacteria 3155
65 Ga0068862_100008974 3300005844 Bacteria 8279
66 Ga0068862_100024079 3300005844 Bacteria 5105
67 Ga0068862_100505830 3300005844 Bacteria 1147
68 Ga0081455_10255719 3300005937 Bacteria 1278
69 Ga0081538_10000854 3300005981 Bacteria 32885
70 Ga0081538_10030126 3300005981 Bacteria 3691
71 Ga0070717_10102458 3300006028 Bacteria 2432
72 Ga0075362_10041793 3300006177 Bacteria 2023
73 Ga0075428_100002664 3300006844 Bacteria 19393
74 Ga0075428_100066813 3300006844 Bacteria 3937
75 Ga0075428_100108207 3300006844 Bacteria 3030
76 Ga0075428_100949685 3300006844 Bacteria 911
77 Ga0075428_101328170 3300006844 Bacteria 756
78 Ga0075430_100167803 3300006846 Bacteria 1826
79 Ga0075430_100320052 3300006846 Bacteria 1282
80 Ga0075430_100549915 3300006846 Bacteria 952
81 Ga0075431_100007019 3300006847 Bacteria 11190
82 Ga0075431_100401533 3300006847 Bacteria 1372
83 Ga0075431_100428253 3300006847 Bacteria 1322
84 Ga0075433_10419023 3300006852 Bacteria 1181
85 Ga0075433_11421176 3300006852 Bacteria 600
86 Ga0075429_100015329 3300006880 Bacteria 6641
87 Ga0075429_100055145 3300006880 Unclassified 3458
88 Ga0075429_100255934 3300006880 Bacteria 1533
89 Ga0075429_100275098 3300006880 Bacteria 1474
90 Ga0075429_101673312 3300006880 Bacteria 553
91 Ga0068865_100238739 3300006881 Bacteria 1429
92 Ga0097620_100471316 3300006931 Bacteria 1351
93 Ga0099794_10007584 3300007265 Bacteria 4464
94 Ga0105250_10102268 3300009092 Unclassified 1170
95 Ga0105240_10000512 3300009093 Bacteria 71437
96 Ga0105240_10086457 3300009093 Bacteria 3840
97 Ga0105240_10101742 3300009093 Bacteria 3494
98 Ga0105240_10459441 3300009093 Bacteria 1423
99 Ga0111539_10000211 3300009094 Bacteria 69441
100 Ga0111539_10004652 3300009094 Bacteria 17934
101 Ga0111539_10005924 3300009094 Bacteria 15790
102 Ga0111539_10092321 3300009094 Bacteria 3558
103 Ga0111539_10187654 3300009094 Bacteria 2414
104 Ga0111539_10570977 3300009094 Bacteria 1317
105 Ga0105247_10016477 3300009101 Bacteria 4430
106 Ga0114129_10079481 3300009147 Bacteria 4560
107 Ga0114129_10092608 3300009147 Bacteria 4187
108 Ga0105241_10060803 3300009174 Bacteria 2907
109 Ga0105242_10578281 3300009176 Bacteria 1081
110 Ga0105242_10849279 3300009176 Bacteria 908
111 Ga0105248_10237427 3300009177 Bacteria 2052
112 Ga0105237_10333651 3300009545 Bacteria 1521
113 Ga0105237_10629898 3300009545 Bacteria 1079
114 Ga0105238_10002639 3300009551 Bacteria 17877
115 Ga0105249_10003666 3300009553 Bacteria 13244
116 Ga0105249_10063980 3300009553 Bacteria 3381
117 Ga0105249_10755248 3300009553 Bacteria 1035
118 Ga0105239_10448256 3300010375 Unclassified 1464
119 Ga0157373_10153059 3300013100 Bacteria 1622
120 Ga0157370_10014688 3300013104 Bacteria 7998
121 Ga0157370_10020717 3300013104 Bacteria 6561
122 Ga0157370_10393748 3300013104 Bacteria 1275
123 Ga0157370_10408939 3300013104 Bacteria 1249
124 Ga0157369_10864035 3300013105 Bacteria 928
125 Ga0157372_10333539 3300013307 Bacteria 1766
126 Ga0157372_10472684 3300013307 Bacteria 1461
127 Ga0157375_10167901 3300013308 Bacteria 2340
128 Ga0163163_10117209 3300014325 Bacteria 2694
129 Ga0157380_10028663 3300014326 Bacteria 4247
130 Ga0157379_10068181 3300014968 Bacteria 3181
131 Ga0157379_10167853 3300014968 Bacteria 1981
132 Ga0157379_10298098 3300014968 Bacteria 1469
133 Ga0197907_10336673 3300020069 Bacteria 4585
134 Ga0206356_10120843 3300020070 Bacteria 8985
135 Ga0206354_10217729 3300020081 Bacteria 8957
136 Ga0206354_10453580 3300020081 Bacteria 1496
137 Ga0206353_11626200 3300020082 Bacteria 3457
138 Ga0213876_10270611 3300021384 Bacteria 903
139 Ga0209565_1023063 3300025263 Bacteria 1282
140 Ga0209673_1000026 3300025273 Bacteria 373739
141 Ga0209564_1004704 3300025295 Bacteria 8182
142 Ga0207656_10204688 3300025321 Unclassified 954
143 Ga0207696_1112783 3300025711 Unclassified 736
144 Ga0207642_10229760 3300025899 Bacteria 1042
145 Ga0207710_10013100 3300025900 Bacteria 3492
146 Ga0207680_10187846 3300025903 Bacteria 1401
147 Ga0207647_10001000 3300025904 Bacteria 21924
148 Ga0207643_10038034 3300025908 Bacteria 2702
149 Ga0207705_10002892 3300025909 Bacteria 13142
150 Ga0207705_10004208 3300025909 Bacteria 10914
151 Ga0207705_10092238 3300025909 Bacteria 2219
152 Ga0207705_10137431 3300025909 Bacteria 1823
153 Ga0207684_11344541 3300025910 Unclassified 587
154 Ga0207654_10023480 3300025911 Bacteria 3304
155 Ga0207707_10000099 3300025912 Bacteria 85950
156 Ga0207707_10000750 3300025912 Bacteria 31974
157 Ga0207695_10006285 3300025913 Bacteria 15455
158 Ga0207695_10013230 3300025913 Bacteria 9845
159 Ga0207695_10256185 3300025913 Bacteria 1648
160 Ga0207695_10842553 3300025913 Bacteria 797
161 Ga0207671_10564072 3300025914 Unclassified 908
162 Ga0207671_10719526 3300025914 Bacteria 793
163 Ga0207671_11033100 3300025914 Unclassified 647
164 Ga0207660_10005917 3300025917 Bacteria 7943
165 Ga0207660_10162599 3300025917 Bacteria 1723
166 Ga0207657_10012284 3300025919 Bacteria 8460
167 Ga0207657_11109380 3300025919 Bacteria 604
168 Ga0207649_10001083 3300025920 Bacteria 16578
169 Ga0207649_10098374 3300025920 Bacteria 1931
170 Ga0207652_10000212 3300025921 Bacteria 61500
171 Ga0207652_10010900 3300025921 Bacteria 7326
172 Ga0207652_10012677 3300025921 Bacteria 6816
173 Ga0207652_10235290 3300025921 Bacteria 1651
174 Ga0207681_10041953 3300025923 Bacteria 3053
175 Ga0207681_10249389 3300025923 Bacteria 1385
176 Ga0207681_10253894 3300025923 Bacteria 1374
177 Ga0207694_10004332 3300025924 Bacteria 11085
178 Ga0207650_11041345 3300025925 Bacteria 696
179 Ga0207690_10000982 3300025932 Bacteria 18292
180 Ga0207690_10907291 3300025932 Bacteria 731
181 Ga0207706_10006207 3300025933 Bacteria 11102
182 Ga0207706_10014564 3300025933 Bacteria 7124
183 Ga0207706_11091310 3300025933 Bacteria 667
184 Ga0207686_10871277 3300025934 Bacteria 725
185 Ga0207669_10012436 3300025937 Bacteria 4185
186 Ga0207704_10292819 3300025938 Bacteria 1243
187 Ga0207711_10294253 3300025941 Bacteria 1497
188 Ga0207689_10076647 3300025942 Bacteria 2749
189 Ga0207661_10004864 3300025944 Bacteria 9413
190 Ga0207679_10003088 3300025945 Bacteria 10309
191 Ga0207667_10007992 3300025949 Bacteria 12620
192 Ga0207712_10189806 3300025961 Bacteria 1621
193 Ga0207712_10797770 3300025961 Bacteria 830
194 Ga0207640_10001471 3300025981 Bacteria 12708
195 Ga0207640_10009359 3300025981 Bacteria 5483
196 Ga0207658_10000066 3300025986 Bacteria 116921
197 Ga0207639_10000724 3300026041 Bacteria 22521
198 Ga0207639_12117378 3300026041 Bacteria 524
199 Ga0207678_10019574 3300026067 Bacteria 5949
200 Ga0207678_10267400 3300026067 Bacteria 1466
201 Ga0207702_10004008 3300026078 Bacteria 13227
202 Ga0207702_10644488 3300026078 Bacteria 1042
203 Ga0207641_10832296 3300026088 Unclassified 914
204 Ga0207674_10019736 3300026116 Bacteria 7295
205 Ga0207674_10268678 3300026116 Bacteria 1653
206 Ga0207674_11454437 3300026116 Bacteria 654
207 Ga0207675_100001056 3300026118 Bacteria 27310
208 Ga0207675_100027997 3300026118 Bacteria 5247
209 Ga0207675_100569640 3300026118 Unclassified 1133
210 Ga0207698_10001598 3300026142 Bacteria 13185
211 Ga0209983_1020366 3300027665 Bacteria 1382
212 Ga0209588_1009741 3300027671 Bacteria 2875
213 Ga0209813_10294724 3300027866 Bacteria 628
214 Ga0207428_10000689 3300027907 Bacteria 39258
215 Ga0207428_10009627 3300027907 Bacteria 8656
216 Ga0207428_10091838 3300027907 Bacteria 2357
217 Ga0207428_10289110 3300027907 Bacteria 1215
218 Ga0268265_10016191 3300028380 Bacteria 5118
219 Ga0268265_10030070 3300028380 Bacteria 3907
220 Ga0268264_10163028 3300028381 Bacteria 2010
221 Ga0307517_10308595 3300028786 Unclassified 883
222 Ga0307515_10108595 3300028794 Bacteria 3267
223 Ga0265762_1053904 3300030760 Bacteria 813
224 Ga0307513_10056201 3300031456 Bacteria 4204
225 Ga0307509_10040420 3300031507 Bacteria 5072
226 Ga0307509_10084866 3300031507 Bacteria 3261
227 Ga0307413_10007545 3300031824 Bacteria 5060
228 Ga0307410_10296315 3300031852 Bacteria 1275
229 Ga0307406_10208103 3300031901 Bacteria 1445
230 Ga0307407_10010443 3300031903 Bacteria 4380
231 Ga0307407_10781063 3300031903 Bacteria 725
232 Ga0307412_10285719 3300031911 Bacteria 1297
233 Ga0307409_100010292 3300031995 Bacteria 5804
234 Ga0307416_100094535 3300032002 Bacteria 2578
235 Ga0307416_101732588 3300032002 Bacteria 729
236 Ga0307411_10125563 3300032005 Bacteria 1865
237 Ga0373937_0277795 3300036401 Bacteria 1581
238 Ga0373937_0559894 3300036401 Bacteria 1086
239 Ga0395899_0029433 3300037312 Bacteria 4130
240 Ga0395899_0405090 3300037312 Bacteria 902
241 Ga0395900_0190078 3300037418 Bacteria 2083
242 Ga0395898_0003877 3300037466 Bacteria 16516
243 Ga0395901_0035663 3300038443 Bacteria 5139
244 Ga0436365_0430459 3300039437 Bacteria 1649
245 Ga0436365_0476991 3300039437 Unclassified 801
246 Ga0451793_1901245 3300041452 Unclassified 516
247 Ga0451837_0656683 3300041494 Bacteria 546
248 Ga0439445_0142830 3300042004 Bacteria 694
249 Ga0439448_0069549 3300042005 Bacteria 1171
250 Ga0439450_081410 3300042008 Bacteria 806
251 Ga0439458_0014975 3300042157 Bacteria 1753
252 Ga0439435_0077461 3300042436 Bacteria 993
253 Ga0439460_0336470 3300042461 Bacteria 531
254 Ga0466966_0294856 3300044684 Bacteria 975
255 Ga0466961_0010179 3300044693 Bacteria 5991
256 Ga0451576_0863157 3300045051 Bacteria 950
257 Ga0495650_0041739 3300046471 Bacteria 1959
258 Ga0495658_0090850 3300046683 Bacteria 1808
259 Ga0495624_0103317 3300046690 Unclassified 1754
260 Ga0496115_0378727 3300048918 Unclassified 1151
261 Ga0501033_0030057 3300049570 Bacteria 4082
262 Ga0501034_0261346 3300049571 Bacteria 1674
263 Ga0501036_0084093 3300049572 Bacteria 2691
264 Ga0501037_0872285 3300049573 Bacteria 591
265 Ga0501039_0259471 3300049575 Bacteria 1366
266 Ga0501069_0140687 3300049585 Bacteria 1384
267 Ga0501069_0253983 3300049585 Unclassified 1026
268 Ga0501070_0001427 3300049586 Bacteria 21397
269 Ga0501072_0121774 3300049588 Bacteria 2079
270 Ga0501073_0041497 3300049589 Bacteria 3251
271 Ga0501074_0004029 3300049590 Bacteria 10476
272 Ga0501077_0011274 3300049593 Bacteria 5579
273 Ga0501077_0039411 3300049593 Bacteria 3010
274 Ga0501214_024155 3300049659 Bacteria 794
275 Ga0501079_0670411 3300049741 Bacteria 816
276 Ga0501080_0057482 3300049742 Bacteria 3621
277 Ga0501081_0909659 3300049743 Unclassified 664
278 Ga0501081_1325777 3300049743 Bacteria 546
279 Ga0501083_0627725 3300049744 Bacteria 699
280 nmdc:mga03683_286537_c1 3300050489 Bacteria 770
281 nmdc:mga04h51_330148_c1 3300050495 Bacteria 627
282 nmdc:mga05p37_62323_c1 3300050507 Bacteria 4589
283 nmdc:mga05p37_85836_c1 3300050507 Bacteria 3879
284 nmdc:mga09592_13600_c1 3300050508 Bacteria 6649
285 nmdc:mga09592_1669362_c1 3300050508 Bacteria 514
286 nmdc:mga09592_505671_c1 3300050508 Bacteria 1040
287 nmdc:mga0qj67_126268_c1 3300050509 Unclassified 2070
288 nmdc:mga0qj67_154678_c1 3300050509 Bacteria 1861
289 nmdc:mga0qj67_515287_c1 3300050509 Bacteria 961
290 nmdc:mga0qj67_612948_c1 3300050509 Bacteria 870
291 nmdc:mga06r32_13253_c1 3300050510 Bacteria 7467
292 nmdc:mga06r32_727121_c1 3300050510 Bacteria 957
293 nmdc:mga06r32_824166_c1 3300050510 Unclassified 887
294 nmdc:mga08y16_106829_c1 3300050511 Bacteria 2914
295 nmdc:mga08y16_145524_c1 3300050511 Bacteria 2463
296 nmdc:mga08y16_1603320_c1 3300050511 Bacteria 609
297 nmdc:mga08y16_2567_c1 3300050511 Bacteria 18669
298 nmdc:mga08y16_4099_c1 3300050511 Bacteria 6244
299 nmdc:mga08y16_432644_c1 3300050511 Bacteria 1344
300 nmdc:mga0a205_491979_c1 3300050515 Bacteria 1084
301 nmdc:mga0a205_648227_c1 3300050515 Bacteria 907
302 Ga0500578_0036756 3300053086 Bacteria 3145
303 Ga0500651_0004006 3300053093 Bacteria 8175
304 Ga0500651_0124286 3300053093 Bacteria 1564
305 Ga0500566_0101107 3300053094 Bacteria 1580
306 Ga0500650_0307341 3300053098 Bacteria 701
307 Ga0500555_002678 3300053103 Bacteria 5133
308 Ga0500555_082230 3300053103 Unclassified 836
309 Ga0500556_0000174 3300053104 Bacteria 52844
310 Ga0500595_001310 3300053119 Bacteria 13517
311 Ga0500655_088128 3300053133 Unclassified 643
312 Ga0500588_0166445 3300053146 Bacteria 805
313 Ga0500622_0393241 3300053156 Bacteria 564
314 Ga0590071_033676 3300059421 Bacteria 1225
315 Ga0501082_0465252 3300060353 Bacteria 1105
316 Ga0530510_0778488 3300061734 Unclassified 730

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009094 Ga0111539_10187654 Ga0111539_101876543 142
2 3300041452 Ga0451793_1901245 Ga0451793_1901245_57_503 142
3 3300050511 nmdc:mga08y16_145524_c1 nmdc:mga08y16_145524_c1_1853_2287 142
4 iso_pu_bacteria 2863421361 2863422297 143
5 3300006846 Ga0075430_100167803 Ga0075430_1001678031 144
6 3300050509 nmdc:mga0qj67_154678_c1 nmdc:mga0qj67_154678_c1_34_468 144
7 3300005458 Ga0070681_10522527 Ga0070681_105225272 145
8 3300005545 Ga0070695_100579887 Ga0070695_1005798872 145
9 3300005549 Ga0070704_100446659 Ga0070704_1004466592 145
10 3300005577 Ga0068857_100445276 Ga0068857_1004452762 145
11 3300009093 Ga0105240_10000512 Ga0105240_1000051211 145
12 3300025913 Ga0207695_10013230 Ga0207695_100132302 145
13 3300025914 Ga0207671_10564072 Ga0207671_105640722 145
14 3300027665 Ga0209983_1020366 Ga0209983_10203662 145
15 3300031852 Ga0307410_10296315 Ga0307410_102963152 145
16 3300031903 Ga0307407_10781063 Ga0307407_107810632 145
17 3300036401 Ga0373937_0559894 Ga0373937_0559894_359_796 145
18 3300046683 Ga0495658_0090850 Ga0495658_0090850_544_981 145
19 3300046690 Ga0495624_0103317 Ga0495624_0103317_111_548 145
20 3300048918 Ga0496115_0378727 Ga0496115_0378727_577_1017 145
21 3300049659 Ga0501214_024155 Ga0501214_024155_125_580 145
22 3300061734 Ga0530510_0778488 Ga0530510_0778488_86_523 145
23 3300005333 Ga0070677_10225955 Ga0070677_102259551 146
24 3300005347 Ga0070668_100277436 Ga0070668_1002774362 146
25 3300005353 Ga0070669_100026322 Ga0070669_1000263222 146
26 3300005355 Ga0070671_100893952 Ga0070671_1008939522 146
27 3300005356 Ga0070674_100627497 Ga0070674_1006274971 146
28 3300005366 Ga0070659_100442183 Ga0070659_1004421832 146
29 3300005444 Ga0070694_100458471 Ga0070694_1004584712 146
30 3300005457 Ga0070662_100031542 Ga0070662_1000315421 146
31 3300005530 Ga0070679_100337193 Ga0070679_1003371932 146
32 3300005546 Ga0070696_100959926 Ga0070696_1009599261 146
33 3300005548 Ga0070665_100519718 Ga0070665_1005197182 146
34 3300005719 Ga0068861_100000305 Ga0068861_10000030512 146
35 3300005844 Ga0068862_100024079 Ga0068862_1000240797 146
36 3300006028 Ga0070717_10102458 Ga0070717_101024583 146
37 3300006844 Ga0075428_100002664 Ga0075428_10000266418 146
38 3300006844 Ga0075428_100949685 Ga0075428_1009496851 146
39 3300006844 Ga0075428_101328170 Ga0075428_1013281701 146
40 3300006846 Ga0075430_100549915 Ga0075430_1005499152 146
41 3300006847 Ga0075431_100007019 Ga0075431_1000070196 146
42 3300006847 Ga0075431_100401533 Ga0075431_1004015332 146
43 3300006852 Ga0075433_11421176 Ga0075433_114211761 146
44 3300006880 Ga0075429_100015329 Ga0075429_1000153295 146
45 3300006880 Ga0075429_100275098 Ga0075429_1002750982 146
46 3300009094 Ga0111539_10000211 Ga0111539_1000021160 146
47 3300009094 Ga0111539_10004652 Ga0111539_1000465213 146
48 3300009094 Ga0111539_10092321 Ga0111539_100923214 146
49 3300009147 Ga0114129_10092608 Ga0114129_100926084 146
50 3300009553 Ga0105249_10003666 Ga0105249_100036664 146
51 3300013308 Ga0157375_10167901 Ga0157375_101679013 146
52 3300014326 Ga0157380_10028663 Ga0157380_100286632 146
53 3300014968 Ga0157379_10298098 Ga0157379_102980981 146
54 3300025917 Ga0207660_10162599 Ga0207660_101625992 146
55 3300025921 Ga0207652_10235290 Ga0207652_102352902 146
56 3300025923 Ga0207681_10249389 Ga0207681_102493891 146
57 3300025925 Ga0207650_11041345 Ga0207650_110413452 146
58 3300025932 Ga0207690_10907291 Ga0207690_109072911 146
59 3300025933 Ga0207706_10014564 Ga0207706_100145645 146
60 3300025933 Ga0207706_11091310 Ga0207706_110913101 146
61 3300026116 Ga0207674_10268678 Ga0207674_102686782 146
62 3300026118 Ga0207675_100001056 Ga0207675_10000105630 146
63 3300027907 Ga0207428_10009627 Ga0207428_100096274 146
64 3300027907 Ga0207428_10091838 Ga0207428_100918382 146
65 3300028380 Ga0268265_10016191 Ga0268265_100161913 146
66 3300028786 Ga0307517_10308595 Ga0307517_103085952 146
67 3300028794 Ga0307515_10108595 Ga0307515_101085951 146
68 3300030760 Ga0265762_1053904 Ga0265762_10539041 146
69 3300031456 Ga0307513_10056201 Ga0307513_100562015 146
70 3300031507 Ga0307509_10040420 Ga0307509_100404204 146
71 3300031507 Ga0307509_10084866 Ga0307509_100848664 146
72 3300037312 Ga0395899_0405090 Ga0395899_0405090_33_476 146
73 3300037466 Ga0395898_0003877 Ga0395898_0003877_5823_6266 146
74 3300039437 Ga0436365_0476991 Ga0436365_0476991_274_717 146
75 3300049593 Ga0501077_0039411 Ga0501077_0039411_1974_2414 146
76 3300049741 Ga0501079_0670411 Ga0501079_0670411_224_685 146
77 3300049744 Ga0501083_0627725 Ga0501083_0627725_46_486 146
78 3300050489 nmdc:mga03683_286537_c1 nmdc:mga03683_286537_c1_11_451 146
79 3300050507 nmdc:mga05p37_85836_c1 nmdc:mga05p37_85836_c1_1151_1612 146
80 3300050508 nmdc:mga09592_13600_c1 nmdc:mga09592_13600_c1_4985_5446 146
81 3300050508 nmdc:mga09592_505671_c1 nmdc:mga09592_505671_c1_521_982 146
82 3300050509 nmdc:mga0qj67_126268_c1 nmdc:mga0qj67_126268_c1_1456_1917 146
83 3300050509 nmdc:mga0qj67_515287_c1 nmdc:mga0qj67_515287_c1_480_920 146
84 3300050510 nmdc:mga06r32_13253_c1 nmdc:mga06r32_13253_c1_2453_2914 146
85 3300050510 nmdc:mga06r32_824166_c1 nmdc:mga06r32_824166_c1_74_529 146
86 3300050511 nmdc:mga08y16_106829_c1 nmdc:mga08y16_106829_c1_2232_2693 146
87 3300050511 nmdc:mga08y16_1603320_c1 nmdc:mga08y16_1603320_c1_25_480 146
88 3300050511 nmdc:mga08y16_4099_c1 nmdc:mga08y16_4099_c1_610_1071 146
89 3300050515 nmdc:mga0a205_648227_c1 nmdc:mga0a205_648227_c1_387_848 146
90 3300053093 Ga0500651_0004006 Ga0500651_0004006_6208_6648 146
91 3300053094 Ga0500566_0101107 Ga0500566_0101107_803_1243 146
92 3300053098 Ga0500650_0307341 Ga0500650_0307341_36_476 146
93 3300053103 Ga0500555_002678 Ga0500555_002678_1415_1855 146
94 3300053103 Ga0500555_082230 Ga0500555_082230_311_751 146
95 3300053119 Ga0500595_001310 Ga0500595_001310_5900_6340 146
96 3300053133 Ga0500655_088128 Ga0500655_088128_51_491 146
97 3300053146 Ga0500588_0166445 Ga0500588_0166445_189_629 146
98 3300053156 Ga0500622_0393241 Ga0500622_0393241_91_531 146
99 3300060353 Ga0501082_0465252 Ga0501082_0465252_152_592 146
100 3300001904 JGI24736J21556_1009770 JGI24736J21556_10097703 147
101 3300001915 JGI24741J21665_1004163 JGI24741J21665_10041632 147
102 3300001979 JGI24740J21852_10001127 JGI24740J21852_1000112715 147
103 3300003322 rootL2_10101893 rootL2_101018932 147
104 3300003790 Ga0055528_1001227 Ga0055528_100122710 147
105 3300005327 Ga0070658_10065644 Ga0070658_100656442 147
106 3300005327 Ga0070658_10205488 Ga0070658_102054884 147
107 3300005327 Ga0070658_10318748 Ga0070658_103187481 147
108 3300005329 Ga0070683_100203687 Ga0070683_1002036873 147
109 3300005329 Ga0070683_101190147 Ga0070683_1011901472 147
110 3300005334 Ga0068869_100049460 Ga0068869_1000494603 147
111 3300005335 Ga0070666_10168948 Ga0070666_101689482 147
112 3300005337 Ga0070682_100009898 Ga0070682_1000098985 147
113 3300005341 Ga0070691_10015354 Ga0070691_100153543 147
114 3300005344 Ga0070661_100060965 Ga0070661_1000609653 147
115 3300005344 Ga0070661_100121056 Ga0070661_1001210562 147
116 3300005345 Ga0070692_10021827 Ga0070692_100218275 147
117 3300005353 Ga0070669_100012775 Ga0070669_1000127754 147
118 3300005353 Ga0070669_100202656 Ga0070669_1002026562 147
119 3300005356 Ga0070674_100015724 Ga0070674_1000157245 147
120 3300005366 Ga0070659_100088471 Ga0070659_1000884715 147
121 3300005367 Ga0070667_100000008 Ga0070667_100000008219 147
122 3300005406 Ga0070703_10529248 Ga0070703_105292481 147
123 3300005455 Ga0070663_100024278 Ga0070663_1000242786 147
124 3300005455 Ga0070663_100521452 Ga0070663_1005214522 147
125 3300005457 Ga0070662_100210988 Ga0070662_1002109883 147
126 3300005458 Ga0070681_10018467 Ga0070681_100184676 147
127 3300005467 Ga0070706_101615154 Ga0070706_1016151541 147
128 3300005530 Ga0070679_100001424 Ga0070679_10000142419 147
129 3300005535 Ga0070684_100043385 Ga0070684_1000433855 147
130 3300005539 Ga0068853_100032506 Ga0068853_1000325065 147
131 3300005539 Ga0068853_101618358 Ga0068853_1016183581 147
132 3300005546 Ga0070696_100000766 Ga0070696_10000076622 147
133 3300005546 Ga0070696_100014024 Ga0070696_1000140245 147
134 3300005546 Ga0070696_100021034 Ga0070696_1000210346 147
135 3300005563 Ga0068855_100200616 Ga0068855_1002006163 147
136 3300005564 Ga0070664_100022611 Ga0070664_1000226114 147
137 3300005578 Ga0068854_100005171 Ga0068854_1000051716 147
138 3300005578 Ga0068854_100017485 Ga0068854_1000174853 147
139 3300005614 Ga0068856_100031561 Ga0068856_1000315614 147
140 3300005614 Ga0068856_100663014 Ga0068856_1006630142 147
141 3300005616 Ga0068852_100011983 Ga0068852_1000119837 147
142 3300005616 Ga0068852_100491666 Ga0068852_1004916662 147
143 3300005617 Ga0068859_100471388 Ga0068859_1004713882 147
144 3300005718 Ga0068866_10142281 Ga0068866_101422812 147
145 3300005834 Ga0068851_10001581 Ga0068851_100015817 147
146 3300005842 Ga0068858_100110233 Ga0068858_1001102332 147
147 3300005843 Ga0068860_100077819 Ga0068860_1000778192 147
148 3300005844 Ga0068862_100008974 Ga0068862_1000089747 147
149 3300005844 Ga0068862_100505830 Ga0068862_1005058302 147
150 3300005937 Ga0081455_10255719 Ga0081455_102557192 147
151 3300005981 Ga0081538_10000854 Ga0081538_1000085434 147
152 3300005981 Ga0081538_10030126 Ga0081538_100301264 147
153 3300006177 Ga0075362_10041793 Ga0075362_100417933 147
154 3300006844 Ga0075428_100066813 Ga0075428_1000668135 147
155 3300006844 Ga0075428_100108207 Ga0075428_1001082076 147
156 3300006846 Ga0075430_100320052 Ga0075430_1003200522 147
157 3300006847 Ga0075431_100428253 Ga0075431_1004282532 147
158 3300006852 Ga0075433_10419023 Ga0075433_104190232 147
159 3300006880 Ga0075429_100055145 Ga0075429_1000551452 147
160 3300006880 Ga0075429_100255934 Ga0075429_1002559343 147
161 3300006880 Ga0075429_101673312 Ga0075429_1016733121 147
162 3300006881 Ga0068865_100238739 Ga0068865_1002387393 147
163 3300006931 Ga0097620_100471316 Ga0097620_1004713162 147
164 3300007265 Ga0099794_10007584 Ga0099794_100075844 147
165 3300009092 Ga0105250_10102268 Ga0105250_101022681 147
166 3300009093 Ga0105240_10086457 Ga0105240_100864575 147
167 3300009093 Ga0105240_10101742 Ga0105240_101017422 147
168 3300009093 Ga0105240_10459441 Ga0105240_104594412 147
169 3300009094 Ga0111539_10005924 Ga0111539_100059246 147
170 3300009094 Ga0111539_10570977 Ga0111539_105709773 147
171 3300009101 Ga0105247_10016477 Ga0105247_100164774 147
172 3300009147 Ga0114129_10079481 Ga0114129_100794813 147
173 3300009174 Ga0105241_10060803 Ga0105241_100608035 147
174 3300009176 Ga0105242_10578281 Ga0105242_105782811 147
175 3300009176 Ga0105242_10849279 Ga0105242_108492792 147
176 3300009177 Ga0105248_10237427 Ga0105248_102374272 147
177 3300009545 Ga0105237_10333651 Ga0105237_103336512 147
178 3300009545 Ga0105237_10629898 Ga0105237_106298983 147
179 3300009551 Ga0105238_10002639 Ga0105238_100026393 147
180 3300009553 Ga0105249_10063980 Ga0105249_100639804 147
181 3300009553 Ga0105249_10755248 Ga0105249_107552482 147
182 3300010375 Ga0105239_10448256 Ga0105239_104482562 147
183 3300013100 Ga0157373_10153059 Ga0157373_101530592 147
184 3300013104 Ga0157370_10014688 Ga0157370_100146888 147
185 3300013104 Ga0157370_10020717 Ga0157370_100207176 147
186 3300013104 Ga0157370_10393748 Ga0157370_103937483 147
187 3300013104 Ga0157370_10408939 Ga0157370_104089391 147
188 3300013105 Ga0157369_10864035 Ga0157369_108640352 147
189 3300013307 Ga0157372_10333539 Ga0157372_103335394 147
190 3300013307 Ga0157372_10472684 Ga0157372_104726843 147
191 3300014325 Ga0163163_10117209 Ga0163163_101172092 147
192 3300014968 Ga0157379_10068181 Ga0157379_100681812 147
193 3300014968 Ga0157379_10167853 Ga0157379_101678531 147
194 3300020069 Ga0197907_10336673 Ga0197907_103366732 147
195 3300020070 Ga0206356_10120843 Ga0206356_1012084310 147
196 3300020081 Ga0206354_10217729 Ga0206354_102177298 147
197 3300020081 Ga0206354_10453580 Ga0206354_104535802 147
198 3300020082 Ga0206353_11626200 Ga0206353_116262005 147
199 3300021384 Ga0213876_10270611 Ga0213876_102706111 147
200 3300025263 Ga0209565_1023063 Ga0209565_10230631 147
201 3300025273 Ga0209673_1000026 Ga0209673_1000026279 147
202 3300025295 Ga0209564_1004704 Ga0209564_10047043 147
203 3300025321 Ga0207656_10204688 Ga0207656_102046881 147
204 3300025711 Ga0207696_1112783 Ga0207696_11127831 147
205 3300025899 Ga0207642_10229760 Ga0207642_102297601 147
206 3300025900 Ga0207710_10013100 Ga0207710_100131003 147
207 3300025903 Ga0207680_10187846 Ga0207680_101878462 147
208 3300025904 Ga0207647_10001000 Ga0207647_1000100016 147
209 3300025908 Ga0207643_10038034 Ga0207643_100380343 147
210 3300025909 Ga0207705_10002892 Ga0207705_1000289210 147
211 3300025909 Ga0207705_10004208 Ga0207705_100042087 147
212 3300025909 Ga0207705_10092238 Ga0207705_100922385 147
213 3300025909 Ga0207705_10137431 Ga0207705_101374312 147
214 3300025910 Ga0207684_11344541 Ga0207684_113445411 147
215 3300025911 Ga0207654_10023480 Ga0207654_100234802 147
216 3300025912 Ga0207707_10000099 Ga0207707_1000009923 147
217 3300025912 Ga0207707_10000750 Ga0207707_1000075026 147
218 3300025913 Ga0207695_10006285 Ga0207695_1000628513 147
219 3300025913 Ga0207695_10256185 Ga0207695_102561852 147
220 3300025913 Ga0207695_10842553 Ga0207695_108425532 147
221 3300025914 Ga0207671_10719526 Ga0207671_107195261 147
222 3300025914 Ga0207671_11033100 Ga0207671_110331001 147
223 3300025917 Ga0207660_10005917 Ga0207660_1000591710 147
224 3300025919 Ga0207657_10012284 Ga0207657_100122847 147
225 3300025919 Ga0207657_11109380 Ga0207657_111093801 147
226 3300025920 Ga0207649_10001083 Ga0207649_1000108316 147
227 3300025920 Ga0207649_10098374 Ga0207649_100983743 147
228 3300025921 Ga0207652_10000212 Ga0207652_1000021245 147
229 3300025921 Ga0207652_10010900 Ga0207652_100109009 147
230 3300025921 Ga0207652_10012677 Ga0207652_100126779 147
231 3300025923 Ga0207681_10041953 Ga0207681_100419535 147
232 3300025923 Ga0207681_10253894 Ga0207681_102538942 147
233 3300025924 Ga0207694_10004332 Ga0207694_100043324 147
234 3300025932 Ga0207690_10000982 Ga0207690_100009829 147
235 3300025933 Ga0207706_10006207 Ga0207706_1000620714 147
236 3300025934 Ga0207686_10871277 Ga0207686_108712771 147
237 3300025937 Ga0207669_10012436 Ga0207669_100124363 147
238 3300025938 Ga0207704_10292819 Ga0207704_102928191 147
239 3300025941 Ga0207711_10294253 Ga0207711_102942532 147
240 3300025942 Ga0207689_10076647 Ga0207689_100766473 147
241 3300025944 Ga0207661_10004864 Ga0207661_100048645 147
242 3300025945 Ga0207679_10003088 Ga0207679_100030887 147
243 3300025949 Ga0207667_10007992 Ga0207667_100079929 147
244 3300025961 Ga0207712_10189806 Ga0207712_101898061 147
245 3300025961 Ga0207712_10797770 Ga0207712_107977702 147
246 3300025981 Ga0207640_10001471 Ga0207640_1000147115 147
247 3300025981 Ga0207640_10009359 Ga0207640_100093597 147
248 3300025986 Ga0207658_10000066 Ga0207658_1000006640 147
249 3300026041 Ga0207639_10000724 Ga0207639_1000072410 147
250 3300026041 Ga0207639_12117378 Ga0207639_121173781 147
251 3300026067 Ga0207678_10019574 Ga0207678_100195747 147
252 3300026067 Ga0207678_10267400 Ga0207678_102674002 147
253 3300026078 Ga0207702_10004008 Ga0207702_100040086 147
254 3300026078 Ga0207702_10644488 Ga0207702_106444883 147
255 3300026088 Ga0207641_10832296 Ga0207641_108322962 147
256 3300026116 Ga0207674_10019736 Ga0207674_100197369 147
257 3300026116 Ga0207674_11454437 Ga0207674_114544371 147
258 3300026118 Ga0207675_100027997 Ga0207675_1000279974 147
259 3300026118 Ga0207675_100569640 Ga0207675_1005696402 147
260 3300026142 Ga0207698_10001598 Ga0207698_1000159810 147
261 3300027671 Ga0209588_1009741 Ga0209588_10097412 147
262 3300027866 Ga0209813_10294724 Ga0209813_102947241 147
263 3300027907 Ga0207428_10000689 Ga0207428_100006893 147
264 3300027907 Ga0207428_10289110 Ga0207428_102891101 147
265 3300028380 Ga0268265_10030070 Ga0268265_100300703 147
266 3300028381 Ga0268264_10163028 Ga0268264_101630282 147
267 3300031824 Ga0307413_10007545 Ga0307413_100075456 147
268 3300031901 Ga0307406_10208103 Ga0307406_102081032 147
269 3300031903 Ga0307407_10010443 Ga0307407_100104432 147
270 3300031911 Ga0307412_10285719 Ga0307412_102857192 147
271 3300031995 Ga0307409_100010292 Ga0307409_1000102925 147
272 3300032002 Ga0307416_100094535 Ga0307416_1000945353 147
273 3300032002 Ga0307416_101732588 Ga0307416_1017325882 147
274 3300032005 Ga0307411_10125563 Ga0307411_101255632 147
275 3300036401 Ga0373937_0277795 Ga0373937_0277795_32_493 147
276 3300037312 Ga0395899_0029433 Ga0395899_0029433_1496_1939 147
277 3300037418 Ga0395900_0190078 Ga0395900_0190078_875_1318 147
278 3300038443 Ga0395901_0035663 Ga0395901_0035663_4686_5129 147
279 3300039437 Ga0436365_0430459 Ga0436365_0430459_947_1402 147
280 3300041494 Ga0451837_0656683 Ga0451837_0656683_83_526 147
281 3300042004 Ga0439445_0142830 Ga0439445_0142830_25_471 147
282 3300042005 Ga0439448_0069549 Ga0439448_0069549_584_1027 147
283 3300042008 Ga0439450_081410 Ga0439450_081410_291_734 147
284 3300042157 Ga0439458_0014975 Ga0439458_0014975_327_770 147
285 3300042436 Ga0439435_0077461 Ga0439435_0077461_530_973 147
286 3300042461 Ga0439460_0336470 Ga0439460_0336470_56_517 147
287 3300044684 Ga0466966_0294856 Ga0466966_0294856_376_822 147
288 3300044693 Ga0466961_0010179 Ga0466961_0010179_1297_1743 147
289 3300045051 Ga0451576_0863157 Ga0451576_0863157_47_490 147
290 3300046471 Ga0495650_0041739 Ga0495650_0041739_693_1163 147
291 3300049570 Ga0501033_0030057 Ga0501033_0030057_2462_2905 147
292 3300049571 Ga0501034_0261346 Ga0501034_0261346_42_485 147
293 3300049572 Ga0501036_0084093 Ga0501036_0084093_1341_1784 147
294 3300049573 Ga0501037_0872285 Ga0501037_0872285_23_466 147
295 3300049575 Ga0501039_0259471 Ga0501039_0259471_281_724 147
296 3300049585 Ga0501069_0140687 Ga0501069_0140687_845_1288 147
297 3300049585 Ga0501069_0253983 Ga0501069_0253983_18_461 147
298 3300049586 Ga0501070_0001427 Ga0501070_0001427_8061_8504 147
299 3300049588 Ga0501072_0121774 Ga0501072_0121774_334_777 147
300 3300049589 Ga0501073_0041497 Ga0501073_0041497_1151_1594 147
301 3300049590 Ga0501074_0004029 Ga0501074_0004029_8472_8915 147
302 3300049593 Ga0501077_0011274 Ga0501077_0011274_1234_1677 147
303 3300049742 Ga0501080_0057482 Ga0501080_0057482_1735_2178 147
304 3300049743 Ga0501081_0909659 Ga0501081_0909659_119_571 147
305 3300049743 Ga0501081_1325777 Ga0501081_1325777_86_532 147
306 3300050495 nmdc:mga04h51_330148_c1 nmdc:mga04h51_330148_c1_20_463 147
307 3300050507 nmdc:mga05p37_62323_c1 nmdc:mga05p37_62323_c1_2138_2581 147
308 3300050508 nmdc:mga09592_1669362_c1 nmdc:mga09592_1669362_c1_22_465 147
309 3300050509 nmdc:mga0qj67_612948_c1 nmdc:mga0qj67_612948_c1_29_478 147
310 3300050510 nmdc:mga06r32_727121_c1 nmdc:mga06r32_727121_c1_80_523 147
311 3300050511 nmdc:mga08y16_2567_c1 nmdc:mga08y16_2567_c1_17873_18322 147
312 3300050511 nmdc:mga08y16_432644_c1 nmdc:mga08y16_432644_c1_114_557 147
313 3300050515 nmdc:mga0a205_491979_c1 nmdc:mga0a205_491979_c1_186_635 147
314 3300053086 Ga0500578_0036756 Ga0500578_0036756_576_1019 147
315 3300053093 Ga0500651_0124286 Ga0500651_0124286_943_1386 147
316 3300053104 Ga0500556_0000174 Ga0500556_0000174_38316_38777 147
317 3300059421 Ga0590071_033676 Ga0590071_033676_22_504 147

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22650

At5g48480-like_C

Glyoxalase At5g48480-like C-terminal domain

75

123

0.93

PF18029

Glyoxalase_6

Glyoxalase-like domain

9

123

0.85

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

2

123

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xy7-assembly1.cif.gz_B x-ray structure of gene product from arabidopsis thaliana at5g48480 0.8634 2 124
1xy7-assembly1.cif.gz_B x-ray structure of gene product from arabidopsis thaliana at5g48480 0.8437 2 124
4pav-assembly4.cif.gz_D structure of hypothetical protein sa1046 from s. aureus. 0.8379 1 127
4pav-assembly4.cif.gz_D structure of hypothetical protein sa1046 from s. aureus. 0.8311 1 127
1xy7-assembly1.cif.gz_A x-ray structure of gene product from arabidopsis thaliana at5g48480 0.825 1 124
ID Description Score Start End Superfamily
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9313 74 140 3.30.720.110
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9061 74 140 3.30.720.110
af_I1N1R1_19_162_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8692 2 133 3.10.180.10
af_Q5VMX8_15_124_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8567 8 127 3.10.180.10
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8543 75 124 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A430HKT6-F1-model_v4 VOC family protein 0.9842 3 142
AF-A0A7W5D6L0-F1-model_v4 Putative glyoxalase superfamily protein PhnB 0.9813 34 144
AF-A0A3M1P423-F1-model_v4 VOC family protein 0.9778 3 144
AF-A0A495QDT8-F1-model_v4 deleted 0.9764 4 146
AF-A0A1G0M996-F1-model_v4 Glyoxalase 0.9759 4 122

Feature Viewer

pLDDT pTM Quality
95.57 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map