F404207
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 317 | 204 | 316 | 149 |
Family's Representative Sequence
| Representative Sequence | 3300028786|Ga0307517_10308595|Ga0307517_103085952 |
| Length | 146 |
| Sequence | MQIHEMFPYLRMRDAEAAVRFYKAAFGVTEKFRLVEPSGRVGHVELAFGPHILMISDEFPEYGILAADPADVRITMHLHVEDCDALIAQAIDAGATPVRAAKDQFYGERSGTVRDPFGYDWSIGHSLEALEPAEMQRRYTEMLKTA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 2 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 3 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 4 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 27 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 31 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 36 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 38 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 39 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 40 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 41 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 42 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 43 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 44 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 45 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 46 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 47 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 48 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 49 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 50 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 52 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 53 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 54 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 55 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 56 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 57 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 58 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 60 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 81 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 82 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 83 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 84 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 85 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 86 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 87 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 88 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 132 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 135 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 136 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 137 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 138 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 139 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 140 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 141 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 142 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 143 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 144 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 145 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 146 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 147 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 148 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 149 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 150 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 151 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 152 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 153 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 154 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 155 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 156 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 157 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 158 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 159 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 160 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 161 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 162 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 163 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 164 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 168 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 169 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 170 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 171 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 172 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 173 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 174 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 175 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 176 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 177 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 178 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 179 | 3300049659 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control | Metagenome | Rhizosphere |
| 180 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 181 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 183 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 184 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 185 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 186 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 187 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 188 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 189 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 190 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 191 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 192 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 193 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 194 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 195 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 196 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 197 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 198 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 199 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 200 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 201 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 202 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 203 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.79 |
| Metatranscriptomes | 1.89 |
| Isolates | 0.32 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.31 |
| Nodule | 0 |
| Rhizoplane | 0.63 |
| Rhizosphere | 89.91 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.15 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1009770 | 3300001904 | Bacteria | 1576 |
| 2 | JGI24741J21665_1004163 | 3300001915 | Bacteria | 3268 |
| 3 | JGI24740J21852_10001127 | 3300001979 | Bacteria | 12096 |
| 4 | rootL2_10101893 | 3300003322 | Bacteria | 2452 |
| 5 | Ga0055528_1001227 | 3300003790 | Bacteria | 16369 |
| 6 | Ga0070658_10065644 | 3300005327 | Bacteria | 2963 |
| 7 | Ga0070658_10205488 | 3300005327 | Bacteria | 1663 |
| 8 | Ga0070658_10318748 | 3300005327 | Bacteria | 1327 |
| 9 | Ga0070683_100203687 | 3300005329 | Bacteria | 1879 |
| 10 | Ga0070683_101190147 | 3300005329 | Bacteria | 732 |
| 11 | Ga0070677_10225955 | 3300005333 | Bacteria | 917 |
| 12 | Ga0068869_100049460 | 3300005334 | Bacteria | 3043 |
| 13 | Ga0070666_10168948 | 3300005335 | Bacteria | 1531 |
| 14 | Ga0070682_100009898 | 3300005337 | Bacteria | 5398 |
| 15 | Ga0070691_10015354 | 3300005341 | Bacteria | 3519 |
| 16 | Ga0070661_100060965 | 3300005344 | Bacteria | 2768 |
| 17 | Ga0070661_100121056 | 3300005344 | Bacteria | 1960 |
| 18 | Ga0070692_10021827 | 3300005345 | Bacteria | 3119 |
| 19 | Ga0070668_100277436 | 3300005347 | Bacteria | 1399 |
| 20 | Ga0070669_100012775 | 3300005353 | Bacteria | 5963 |
| 21 | Ga0070669_100026322 | 3300005353 | Bacteria | 4185 |
| 22 | Ga0070669_100202656 | 3300005353 | Bacteria | 1562 |
| 23 | Ga0070671_100893952 | 3300005355 | Bacteria | 776 |
| 24 | Ga0070674_100015724 | 3300005356 | Bacteria | 4731 |
| 25 | Ga0070674_100627497 | 3300005356 | Bacteria | 911 |
| 26 | Ga0070659_100088471 | 3300005366 | Bacteria | 2480 |
| 27 | Ga0070659_100442183 | 3300005366 | Bacteria | 1102 |
| 28 | Ga0070667_100000008 | 3300005367 | Bacteria | 285591 |
| 29 | Ga0070703_10529248 | 3300005406 | Unclassified | 534 |
| 30 | Ga0070694_100458471 | 3300005444 | Bacteria | 1008 |
| 31 | Ga0070663_100024278 | 3300005455 | Bacteria | 4078 |
| 32 | Ga0070663_100521452 | 3300005455 | Bacteria | 989 |
| 33 | Ga0070662_100031542 | 3300005457 | Bacteria | 3720 |
| 34 | Ga0070662_100210988 | 3300005457 | Bacteria | 1545 |
| 35 | Ga0070681_10018467 | 3300005458 | Bacteria | 6970 |
| 36 | Ga0070681_10522527 | 3300005458 | Bacteria | 1100 |
| 37 | Ga0070706_101615154 | 3300005467 | Unclassified | 591 |
| 38 | Ga0070679_100001424 | 3300005530 | Bacteria | 21153 |
| 39 | Ga0070679_100337193 | 3300005530 | Bacteria | 1456 |
| 40 | Ga0070684_100043385 | 3300005535 | Bacteria | 3883 |
| 41 | Ga0068853_100032506 | 3300005539 | Bacteria | 4420 |
| 42 | Ga0068853_101618358 | 3300005539 | Bacteria | 628 |
| 43 | Ga0070695_100579887 | 3300005545 | Bacteria | 878 |
| 44 | Ga0070696_100000766 | 3300005546 | Bacteria | 20607 |
| 45 | Ga0070696_100014024 | 3300005546 | Bacteria | 5381 |
| 46 | Ga0070696_100021034 | 3300005546 | Bacteria | 4422 |
| 47 | Ga0070696_100959926 | 3300005546 | Bacteria | 712 |
| 48 | Ga0070665_100519718 | 3300005548 | Bacteria | 1202 |
| 49 | Ga0070704_100446659 | 3300005549 | Bacteria | 1112 |
| 50 | Ga0068855_100200616 | 3300005563 | Bacteria | 2246 |
| 51 | Ga0070664_100022611 | 3300005564 | Bacteria | 5184 |
| 52 | Ga0068857_100445276 | 3300005577 | Unclassified | 1210 |
| 53 | Ga0068854_100005171 | 3300005578 | Bacteria | 8229 |
| 54 | Ga0068854_100017485 | 3300005578 | Bacteria | 4797 |
| 55 | Ga0068856_100031561 | 3300005614 | Bacteria | 5184 |
| 56 | Ga0068856_100663014 | 3300005614 | Bacteria | 1064 |
| 57 | Ga0068852_100011983 | 3300005616 | Bacteria | 6558 |
| 58 | Ga0068852_100491666 | 3300005616 | Bacteria | 1221 |
| 59 | Ga0068859_100471388 | 3300005617 | Bacteria | 1351 |
| 60 | Ga0068866_10142281 | 3300005718 | Unclassified | 1378 |
| 61 | Ga0068861_100000305 | 3300005719 | Bacteria | 27433 |
| 62 | Ga0068851_10001581 | 3300005834 | Bacteria | 9995 |
| 63 | Ga0068858_100110233 | 3300005842 | Bacteria | 2570 |
| 64 | Ga0068860_100077819 | 3300005843 | Bacteria | 3155 |
| 65 | Ga0068862_100008974 | 3300005844 | Bacteria | 8279 |
| 66 | Ga0068862_100024079 | 3300005844 | Bacteria | 5105 |
| 67 | Ga0068862_100505830 | 3300005844 | Bacteria | 1147 |
| 68 | Ga0081455_10255719 | 3300005937 | Bacteria | 1278 |
| 69 | Ga0081538_10000854 | 3300005981 | Bacteria | 32885 |
| 70 | Ga0081538_10030126 | 3300005981 | Bacteria | 3691 |
| 71 | Ga0070717_10102458 | 3300006028 | Bacteria | 2432 |
| 72 | Ga0075362_10041793 | 3300006177 | Bacteria | 2023 |
| 73 | Ga0075428_100002664 | 3300006844 | Bacteria | 19393 |
| 74 | Ga0075428_100066813 | 3300006844 | Bacteria | 3937 |
| 75 | Ga0075428_100108207 | 3300006844 | Bacteria | 3030 |
| 76 | Ga0075428_100949685 | 3300006844 | Bacteria | 911 |
| 77 | Ga0075428_101328170 | 3300006844 | Bacteria | 756 |
| 78 | Ga0075430_100167803 | 3300006846 | Bacteria | 1826 |
| 79 | Ga0075430_100320052 | 3300006846 | Bacteria | 1282 |
| 80 | Ga0075430_100549915 | 3300006846 | Bacteria | 952 |
| 81 | Ga0075431_100007019 | 3300006847 | Bacteria | 11190 |
| 82 | Ga0075431_100401533 | 3300006847 | Bacteria | 1372 |
| 83 | Ga0075431_100428253 | 3300006847 | Bacteria | 1322 |
| 84 | Ga0075433_10419023 | 3300006852 | Bacteria | 1181 |
| 85 | Ga0075433_11421176 | 3300006852 | Bacteria | 600 |
| 86 | Ga0075429_100015329 | 3300006880 | Bacteria | 6641 |
| 87 | Ga0075429_100055145 | 3300006880 | Unclassified | 3458 |
| 88 | Ga0075429_100255934 | 3300006880 | Bacteria | 1533 |
| 89 | Ga0075429_100275098 | 3300006880 | Bacteria | 1474 |
| 90 | Ga0075429_101673312 | 3300006880 | Bacteria | 553 |
| 91 | Ga0068865_100238739 | 3300006881 | Bacteria | 1429 |
| 92 | Ga0097620_100471316 | 3300006931 | Bacteria | 1351 |
| 93 | Ga0099794_10007584 | 3300007265 | Bacteria | 4464 |
| 94 | Ga0105250_10102268 | 3300009092 | Unclassified | 1170 |
| 95 | Ga0105240_10000512 | 3300009093 | Bacteria | 71437 |
| 96 | Ga0105240_10086457 | 3300009093 | Bacteria | 3840 |
| 97 | Ga0105240_10101742 | 3300009093 | Bacteria | 3494 |
| 98 | Ga0105240_10459441 | 3300009093 | Bacteria | 1423 |
| 99 | Ga0111539_10000211 | 3300009094 | Bacteria | 69441 |
| 100 | Ga0111539_10004652 | 3300009094 | Bacteria | 17934 |
| 101 | Ga0111539_10005924 | 3300009094 | Bacteria | 15790 |
| 102 | Ga0111539_10092321 | 3300009094 | Bacteria | 3558 |
| 103 | Ga0111539_10187654 | 3300009094 | Bacteria | 2414 |
| 104 | Ga0111539_10570977 | 3300009094 | Bacteria | 1317 |
| 105 | Ga0105247_10016477 | 3300009101 | Bacteria | 4430 |
| 106 | Ga0114129_10079481 | 3300009147 | Bacteria | 4560 |
| 107 | Ga0114129_10092608 | 3300009147 | Bacteria | 4187 |
| 108 | Ga0105241_10060803 | 3300009174 | Bacteria | 2907 |
| 109 | Ga0105242_10578281 | 3300009176 | Bacteria | 1081 |
| 110 | Ga0105242_10849279 | 3300009176 | Bacteria | 908 |
| 111 | Ga0105248_10237427 | 3300009177 | Bacteria | 2052 |
| 112 | Ga0105237_10333651 | 3300009545 | Bacteria | 1521 |
| 113 | Ga0105237_10629898 | 3300009545 | Bacteria | 1079 |
| 114 | Ga0105238_10002639 | 3300009551 | Bacteria | 17877 |
| 115 | Ga0105249_10003666 | 3300009553 | Bacteria | 13244 |
| 116 | Ga0105249_10063980 | 3300009553 | Bacteria | 3381 |
| 117 | Ga0105249_10755248 | 3300009553 | Bacteria | 1035 |
| 118 | Ga0105239_10448256 | 3300010375 | Unclassified | 1464 |
| 119 | Ga0157373_10153059 | 3300013100 | Bacteria | 1622 |
| 120 | Ga0157370_10014688 | 3300013104 | Bacteria | 7998 |
| 121 | Ga0157370_10020717 | 3300013104 | Bacteria | 6561 |
| 122 | Ga0157370_10393748 | 3300013104 | Bacteria | 1275 |
| 123 | Ga0157370_10408939 | 3300013104 | Bacteria | 1249 |
| 124 | Ga0157369_10864035 | 3300013105 | Bacteria | 928 |
| 125 | Ga0157372_10333539 | 3300013307 | Bacteria | 1766 |
| 126 | Ga0157372_10472684 | 3300013307 | Bacteria | 1461 |
| 127 | Ga0157375_10167901 | 3300013308 | Bacteria | 2340 |
| 128 | Ga0163163_10117209 | 3300014325 | Bacteria | 2694 |
| 129 | Ga0157380_10028663 | 3300014326 | Bacteria | 4247 |
| 130 | Ga0157379_10068181 | 3300014968 | Bacteria | 3181 |
| 131 | Ga0157379_10167853 | 3300014968 | Bacteria | 1981 |
| 132 | Ga0157379_10298098 | 3300014968 | Bacteria | 1469 |
| 133 | Ga0197907_10336673 | 3300020069 | Bacteria | 4585 |
| 134 | Ga0206356_10120843 | 3300020070 | Bacteria | 8985 |
| 135 | Ga0206354_10217729 | 3300020081 | Bacteria | 8957 |
| 136 | Ga0206354_10453580 | 3300020081 | Bacteria | 1496 |
| 137 | Ga0206353_11626200 | 3300020082 | Bacteria | 3457 |
| 138 | Ga0213876_10270611 | 3300021384 | Bacteria | 903 |
| 139 | Ga0209565_1023063 | 3300025263 | Bacteria | 1282 |
| 140 | Ga0209673_1000026 | 3300025273 | Bacteria | 373739 |
| 141 | Ga0209564_1004704 | 3300025295 | Bacteria | 8182 |
| 142 | Ga0207656_10204688 | 3300025321 | Unclassified | 954 |
| 143 | Ga0207696_1112783 | 3300025711 | Unclassified | 736 |
| 144 | Ga0207642_10229760 | 3300025899 | Bacteria | 1042 |
| 145 | Ga0207710_10013100 | 3300025900 | Bacteria | 3492 |
| 146 | Ga0207680_10187846 | 3300025903 | Bacteria | 1401 |
| 147 | Ga0207647_10001000 | 3300025904 | Bacteria | 21924 |
| 148 | Ga0207643_10038034 | 3300025908 | Bacteria | 2702 |
| 149 | Ga0207705_10002892 | 3300025909 | Bacteria | 13142 |
| 150 | Ga0207705_10004208 | 3300025909 | Bacteria | 10914 |
| 151 | Ga0207705_10092238 | 3300025909 | Bacteria | 2219 |
| 152 | Ga0207705_10137431 | 3300025909 | Bacteria | 1823 |
| 153 | Ga0207684_11344541 | 3300025910 | Unclassified | 587 |
| 154 | Ga0207654_10023480 | 3300025911 | Bacteria | 3304 |
| 155 | Ga0207707_10000099 | 3300025912 | Bacteria | 85950 |
| 156 | Ga0207707_10000750 | 3300025912 | Bacteria | 31974 |
| 157 | Ga0207695_10006285 | 3300025913 | Bacteria | 15455 |
| 158 | Ga0207695_10013230 | 3300025913 | Bacteria | 9845 |
| 159 | Ga0207695_10256185 | 3300025913 | Bacteria | 1648 |
| 160 | Ga0207695_10842553 | 3300025913 | Bacteria | 797 |
| 161 | Ga0207671_10564072 | 3300025914 | Unclassified | 908 |
| 162 | Ga0207671_10719526 | 3300025914 | Bacteria | 793 |
| 163 | Ga0207671_11033100 | 3300025914 | Unclassified | 647 |
| 164 | Ga0207660_10005917 | 3300025917 | Bacteria | 7943 |
| 165 | Ga0207660_10162599 | 3300025917 | Bacteria | 1723 |
| 166 | Ga0207657_10012284 | 3300025919 | Bacteria | 8460 |
| 167 | Ga0207657_11109380 | 3300025919 | Bacteria | 604 |
| 168 | Ga0207649_10001083 | 3300025920 | Bacteria | 16578 |
| 169 | Ga0207649_10098374 | 3300025920 | Bacteria | 1931 |
| 170 | Ga0207652_10000212 | 3300025921 | Bacteria | 61500 |
| 171 | Ga0207652_10010900 | 3300025921 | Bacteria | 7326 |
| 172 | Ga0207652_10012677 | 3300025921 | Bacteria | 6816 |
| 173 | Ga0207652_10235290 | 3300025921 | Bacteria | 1651 |
| 174 | Ga0207681_10041953 | 3300025923 | Bacteria | 3053 |
| 175 | Ga0207681_10249389 | 3300025923 | Bacteria | 1385 |
| 176 | Ga0207681_10253894 | 3300025923 | Bacteria | 1374 |
| 177 | Ga0207694_10004332 | 3300025924 | Bacteria | 11085 |
| 178 | Ga0207650_11041345 | 3300025925 | Bacteria | 696 |
| 179 | Ga0207690_10000982 | 3300025932 | Bacteria | 18292 |
| 180 | Ga0207690_10907291 | 3300025932 | Bacteria | 731 |
| 181 | Ga0207706_10006207 | 3300025933 | Bacteria | 11102 |
| 182 | Ga0207706_10014564 | 3300025933 | Bacteria | 7124 |
| 183 | Ga0207706_11091310 | 3300025933 | Bacteria | 667 |
| 184 | Ga0207686_10871277 | 3300025934 | Bacteria | 725 |
| 185 | Ga0207669_10012436 | 3300025937 | Bacteria | 4185 |
| 186 | Ga0207704_10292819 | 3300025938 | Bacteria | 1243 |
| 187 | Ga0207711_10294253 | 3300025941 | Bacteria | 1497 |
| 188 | Ga0207689_10076647 | 3300025942 | Bacteria | 2749 |
| 189 | Ga0207661_10004864 | 3300025944 | Bacteria | 9413 |
| 190 | Ga0207679_10003088 | 3300025945 | Bacteria | 10309 |
| 191 | Ga0207667_10007992 | 3300025949 | Bacteria | 12620 |
| 192 | Ga0207712_10189806 | 3300025961 | Bacteria | 1621 |
| 193 | Ga0207712_10797770 | 3300025961 | Bacteria | 830 |
| 194 | Ga0207640_10001471 | 3300025981 | Bacteria | 12708 |
| 195 | Ga0207640_10009359 | 3300025981 | Bacteria | 5483 |
| 196 | Ga0207658_10000066 | 3300025986 | Bacteria | 116921 |
| 197 | Ga0207639_10000724 | 3300026041 | Bacteria | 22521 |
| 198 | Ga0207639_12117378 | 3300026041 | Bacteria | 524 |
| 199 | Ga0207678_10019574 | 3300026067 | Bacteria | 5949 |
| 200 | Ga0207678_10267400 | 3300026067 | Bacteria | 1466 |
| 201 | Ga0207702_10004008 | 3300026078 | Bacteria | 13227 |
| 202 | Ga0207702_10644488 | 3300026078 | Bacteria | 1042 |
| 203 | Ga0207641_10832296 | 3300026088 | Unclassified | 914 |
| 204 | Ga0207674_10019736 | 3300026116 | Bacteria | 7295 |
| 205 | Ga0207674_10268678 | 3300026116 | Bacteria | 1653 |
| 206 | Ga0207674_11454437 | 3300026116 | Bacteria | 654 |
| 207 | Ga0207675_100001056 | 3300026118 | Bacteria | 27310 |
| 208 | Ga0207675_100027997 | 3300026118 | Bacteria | 5247 |
| 209 | Ga0207675_100569640 | 3300026118 | Unclassified | 1133 |
| 210 | Ga0207698_10001598 | 3300026142 | Bacteria | 13185 |
| 211 | Ga0209983_1020366 | 3300027665 | Bacteria | 1382 |
| 212 | Ga0209588_1009741 | 3300027671 | Bacteria | 2875 |
| 213 | Ga0209813_10294724 | 3300027866 | Bacteria | 628 |
| 214 | Ga0207428_10000689 | 3300027907 | Bacteria | 39258 |
| 215 | Ga0207428_10009627 | 3300027907 | Bacteria | 8656 |
| 216 | Ga0207428_10091838 | 3300027907 | Bacteria | 2357 |
| 217 | Ga0207428_10289110 | 3300027907 | Bacteria | 1215 |
| 218 | Ga0268265_10016191 | 3300028380 | Bacteria | 5118 |
| 219 | Ga0268265_10030070 | 3300028380 | Bacteria | 3907 |
| 220 | Ga0268264_10163028 | 3300028381 | Bacteria | 2010 |
| 221 | Ga0307517_10308595 | 3300028786 | Unclassified | 883 |
| 222 | Ga0307515_10108595 | 3300028794 | Bacteria | 3267 |
| 223 | Ga0265762_1053904 | 3300030760 | Bacteria | 813 |
| 224 | Ga0307513_10056201 | 3300031456 | Bacteria | 4204 |
| 225 | Ga0307509_10040420 | 3300031507 | Bacteria | 5072 |
| 226 | Ga0307509_10084866 | 3300031507 | Bacteria | 3261 |
| 227 | Ga0307413_10007545 | 3300031824 | Bacteria | 5060 |
| 228 | Ga0307410_10296315 | 3300031852 | Bacteria | 1275 |
| 229 | Ga0307406_10208103 | 3300031901 | Bacteria | 1445 |
| 230 | Ga0307407_10010443 | 3300031903 | Bacteria | 4380 |
| 231 | Ga0307407_10781063 | 3300031903 | Bacteria | 725 |
| 232 | Ga0307412_10285719 | 3300031911 | Bacteria | 1297 |
| 233 | Ga0307409_100010292 | 3300031995 | Bacteria | 5804 |
| 234 | Ga0307416_100094535 | 3300032002 | Bacteria | 2578 |
| 235 | Ga0307416_101732588 | 3300032002 | Bacteria | 729 |
| 236 | Ga0307411_10125563 | 3300032005 | Bacteria | 1865 |
| 237 | Ga0373937_0277795 | 3300036401 | Bacteria | 1581 |
| 238 | Ga0373937_0559894 | 3300036401 | Bacteria | 1086 |
| 239 | Ga0395899_0029433 | 3300037312 | Bacteria | 4130 |
| 240 | Ga0395899_0405090 | 3300037312 | Bacteria | 902 |
| 241 | Ga0395900_0190078 | 3300037418 | Bacteria | 2083 |
| 242 | Ga0395898_0003877 | 3300037466 | Bacteria | 16516 |
| 243 | Ga0395901_0035663 | 3300038443 | Bacteria | 5139 |
| 244 | Ga0436365_0430459 | 3300039437 | Bacteria | 1649 |
| 245 | Ga0436365_0476991 | 3300039437 | Unclassified | 801 |
| 246 | Ga0451793_1901245 | 3300041452 | Unclassified | 516 |
| 247 | Ga0451837_0656683 | 3300041494 | Bacteria | 546 |
| 248 | Ga0439445_0142830 | 3300042004 | Bacteria | 694 |
| 249 | Ga0439448_0069549 | 3300042005 | Bacteria | 1171 |
| 250 | Ga0439450_081410 | 3300042008 | Bacteria | 806 |
| 251 | Ga0439458_0014975 | 3300042157 | Bacteria | 1753 |
| 252 | Ga0439435_0077461 | 3300042436 | Bacteria | 993 |
| 253 | Ga0439460_0336470 | 3300042461 | Bacteria | 531 |
| 254 | Ga0466966_0294856 | 3300044684 | Bacteria | 975 |
| 255 | Ga0466961_0010179 | 3300044693 | Bacteria | 5991 |
| 256 | Ga0451576_0863157 | 3300045051 | Bacteria | 950 |
| 257 | Ga0495650_0041739 | 3300046471 | Bacteria | 1959 |
| 258 | Ga0495658_0090850 | 3300046683 | Bacteria | 1808 |
| 259 | Ga0495624_0103317 | 3300046690 | Unclassified | 1754 |
| 260 | Ga0496115_0378727 | 3300048918 | Unclassified | 1151 |
| 261 | Ga0501033_0030057 | 3300049570 | Bacteria | 4082 |
| 262 | Ga0501034_0261346 | 3300049571 | Bacteria | 1674 |
| 263 | Ga0501036_0084093 | 3300049572 | Bacteria | 2691 |
| 264 | Ga0501037_0872285 | 3300049573 | Bacteria | 591 |
| 265 | Ga0501039_0259471 | 3300049575 | Bacteria | 1366 |
| 266 | Ga0501069_0140687 | 3300049585 | Bacteria | 1384 |
| 267 | Ga0501069_0253983 | 3300049585 | Unclassified | 1026 |
| 268 | Ga0501070_0001427 | 3300049586 | Bacteria | 21397 |
| 269 | Ga0501072_0121774 | 3300049588 | Bacteria | 2079 |
| 270 | Ga0501073_0041497 | 3300049589 | Bacteria | 3251 |
| 271 | Ga0501074_0004029 | 3300049590 | Bacteria | 10476 |
| 272 | Ga0501077_0011274 | 3300049593 | Bacteria | 5579 |
| 273 | Ga0501077_0039411 | 3300049593 | Bacteria | 3010 |
| 274 | Ga0501214_024155 | 3300049659 | Bacteria | 794 |
| 275 | Ga0501079_0670411 | 3300049741 | Bacteria | 816 |
| 276 | Ga0501080_0057482 | 3300049742 | Bacteria | 3621 |
| 277 | Ga0501081_0909659 | 3300049743 | Unclassified | 664 |
| 278 | Ga0501081_1325777 | 3300049743 | Bacteria | 546 |
| 279 | Ga0501083_0627725 | 3300049744 | Bacteria | 699 |
| 280 | nmdc:mga03683_286537_c1 | 3300050489 | Bacteria | 770 |
| 281 | nmdc:mga04h51_330148_c1 | 3300050495 | Bacteria | 627 |
| 282 | nmdc:mga05p37_62323_c1 | 3300050507 | Bacteria | 4589 |
| 283 | nmdc:mga05p37_85836_c1 | 3300050507 | Bacteria | 3879 |
| 284 | nmdc:mga09592_13600_c1 | 3300050508 | Bacteria | 6649 |
| 285 | nmdc:mga09592_1669362_c1 | 3300050508 | Bacteria | 514 |
| 286 | nmdc:mga09592_505671_c1 | 3300050508 | Bacteria | 1040 |
| 287 | nmdc:mga0qj67_126268_c1 | 3300050509 | Unclassified | 2070 |
| 288 | nmdc:mga0qj67_154678_c1 | 3300050509 | Bacteria | 1861 |
| 289 | nmdc:mga0qj67_515287_c1 | 3300050509 | Bacteria | 961 |
| 290 | nmdc:mga0qj67_612948_c1 | 3300050509 | Bacteria | 870 |
| 291 | nmdc:mga06r32_13253_c1 | 3300050510 | Bacteria | 7467 |
| 292 | nmdc:mga06r32_727121_c1 | 3300050510 | Bacteria | 957 |
| 293 | nmdc:mga06r32_824166_c1 | 3300050510 | Unclassified | 887 |
| 294 | nmdc:mga08y16_106829_c1 | 3300050511 | Bacteria | 2914 |
| 295 | nmdc:mga08y16_145524_c1 | 3300050511 | Bacteria | 2463 |
| 296 | nmdc:mga08y16_1603320_c1 | 3300050511 | Bacteria | 609 |
| 297 | nmdc:mga08y16_2567_c1 | 3300050511 | Bacteria | 18669 |
| 298 | nmdc:mga08y16_4099_c1 | 3300050511 | Bacteria | 6244 |
| 299 | nmdc:mga08y16_432644_c1 | 3300050511 | Bacteria | 1344 |
| 300 | nmdc:mga0a205_491979_c1 | 3300050515 | Bacteria | 1084 |
| 301 | nmdc:mga0a205_648227_c1 | 3300050515 | Bacteria | 907 |
| 302 | Ga0500578_0036756 | 3300053086 | Bacteria | 3145 |
| 303 | Ga0500651_0004006 | 3300053093 | Bacteria | 8175 |
| 304 | Ga0500651_0124286 | 3300053093 | Bacteria | 1564 |
| 305 | Ga0500566_0101107 | 3300053094 | Bacteria | 1580 |
| 306 | Ga0500650_0307341 | 3300053098 | Bacteria | 701 |
| 307 | Ga0500555_002678 | 3300053103 | Bacteria | 5133 |
| 308 | Ga0500555_082230 | 3300053103 | Unclassified | 836 |
| 309 | Ga0500556_0000174 | 3300053104 | Bacteria | 52844 |
| 310 | Ga0500595_001310 | 3300053119 | Bacteria | 13517 |
| 311 | Ga0500655_088128 | 3300053133 | Unclassified | 643 |
| 312 | Ga0500588_0166445 | 3300053146 | Bacteria | 805 |
| 313 | Ga0500622_0393241 | 3300053156 | Bacteria | 564 |
| 314 | Ga0590071_033676 | 3300059421 | Bacteria | 1225 |
| 315 | Ga0501082_0465252 | 3300060353 | Bacteria | 1105 |
| 316 | Ga0530510_0778488 | 3300061734 | Unclassified | 730 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009094 | Ga0111539_10187654 | Ga0111539_101876543 | 142 |
| 2 | 3300041452 | Ga0451793_1901245 | Ga0451793_1901245_57_503 | 142 |
| 3 | 3300050511 | nmdc:mga08y16_145524_c1 | nmdc:mga08y16_145524_c1_1853_2287 | 142 |
| 4 | iso_pu_bacteria | 2863421361 | 2863422297 | 143 |
| 5 | 3300006846 | Ga0075430_100167803 | Ga0075430_1001678031 | 144 |
| 6 | 3300050509 | nmdc:mga0qj67_154678_c1 | nmdc:mga0qj67_154678_c1_34_468 | 144 |
| 7 | 3300005458 | Ga0070681_10522527 | Ga0070681_105225272 | 145 |
| 8 | 3300005545 | Ga0070695_100579887 | Ga0070695_1005798872 | 145 |
| 9 | 3300005549 | Ga0070704_100446659 | Ga0070704_1004466592 | 145 |
| 10 | 3300005577 | Ga0068857_100445276 | Ga0068857_1004452762 | 145 |
| 11 | 3300009093 | Ga0105240_10000512 | Ga0105240_1000051211 | 145 |
| 12 | 3300025913 | Ga0207695_10013230 | Ga0207695_100132302 | 145 |
| 13 | 3300025914 | Ga0207671_10564072 | Ga0207671_105640722 | 145 |
| 14 | 3300027665 | Ga0209983_1020366 | Ga0209983_10203662 | 145 |
| 15 | 3300031852 | Ga0307410_10296315 | Ga0307410_102963152 | 145 |
| 16 | 3300031903 | Ga0307407_10781063 | Ga0307407_107810632 | 145 |
| 17 | 3300036401 | Ga0373937_0559894 | Ga0373937_0559894_359_796 | 145 |
| 18 | 3300046683 | Ga0495658_0090850 | Ga0495658_0090850_544_981 | 145 |
| 19 | 3300046690 | Ga0495624_0103317 | Ga0495624_0103317_111_548 | 145 |
| 20 | 3300048918 | Ga0496115_0378727 | Ga0496115_0378727_577_1017 | 145 |
| 21 | 3300049659 | Ga0501214_024155 | Ga0501214_024155_125_580 | 145 |
| 22 | 3300061734 | Ga0530510_0778488 | Ga0530510_0778488_86_523 | 145 |
| 23 | 3300005333 | Ga0070677_10225955 | Ga0070677_102259551 | 146 |
| 24 | 3300005347 | Ga0070668_100277436 | Ga0070668_1002774362 | 146 |
| 25 | 3300005353 | Ga0070669_100026322 | Ga0070669_1000263222 | 146 |
| 26 | 3300005355 | Ga0070671_100893952 | Ga0070671_1008939522 | 146 |
| 27 | 3300005356 | Ga0070674_100627497 | Ga0070674_1006274971 | 146 |
| 28 | 3300005366 | Ga0070659_100442183 | Ga0070659_1004421832 | 146 |
| 29 | 3300005444 | Ga0070694_100458471 | Ga0070694_1004584712 | 146 |
| 30 | 3300005457 | Ga0070662_100031542 | Ga0070662_1000315421 | 146 |
| 31 | 3300005530 | Ga0070679_100337193 | Ga0070679_1003371932 | 146 |
| 32 | 3300005546 | Ga0070696_100959926 | Ga0070696_1009599261 | 146 |
| 33 | 3300005548 | Ga0070665_100519718 | Ga0070665_1005197182 | 146 |
| 34 | 3300005719 | Ga0068861_100000305 | Ga0068861_10000030512 | 146 |
| 35 | 3300005844 | Ga0068862_100024079 | Ga0068862_1000240797 | 146 |
| 36 | 3300006028 | Ga0070717_10102458 | Ga0070717_101024583 | 146 |
| 37 | 3300006844 | Ga0075428_100002664 | Ga0075428_10000266418 | 146 |
| 38 | 3300006844 | Ga0075428_100949685 | Ga0075428_1009496851 | 146 |
| 39 | 3300006844 | Ga0075428_101328170 | Ga0075428_1013281701 | 146 |
| 40 | 3300006846 | Ga0075430_100549915 | Ga0075430_1005499152 | 146 |
| 41 | 3300006847 | Ga0075431_100007019 | Ga0075431_1000070196 | 146 |
| 42 | 3300006847 | Ga0075431_100401533 | Ga0075431_1004015332 | 146 |
| 43 | 3300006852 | Ga0075433_11421176 | Ga0075433_114211761 | 146 |
| 44 | 3300006880 | Ga0075429_100015329 | Ga0075429_1000153295 | 146 |
| 45 | 3300006880 | Ga0075429_100275098 | Ga0075429_1002750982 | 146 |
| 46 | 3300009094 | Ga0111539_10000211 | Ga0111539_1000021160 | 146 |
| 47 | 3300009094 | Ga0111539_10004652 | Ga0111539_1000465213 | 146 |
| 48 | 3300009094 | Ga0111539_10092321 | Ga0111539_100923214 | 146 |
| 49 | 3300009147 | Ga0114129_10092608 | Ga0114129_100926084 | 146 |
| 50 | 3300009553 | Ga0105249_10003666 | Ga0105249_100036664 | 146 |
| 51 | 3300013308 | Ga0157375_10167901 | Ga0157375_101679013 | 146 |
| 52 | 3300014326 | Ga0157380_10028663 | Ga0157380_100286632 | 146 |
| 53 | 3300014968 | Ga0157379_10298098 | Ga0157379_102980981 | 146 |
| 54 | 3300025917 | Ga0207660_10162599 | Ga0207660_101625992 | 146 |
| 55 | 3300025921 | Ga0207652_10235290 | Ga0207652_102352902 | 146 |
| 56 | 3300025923 | Ga0207681_10249389 | Ga0207681_102493891 | 146 |
| 57 | 3300025925 | Ga0207650_11041345 | Ga0207650_110413452 | 146 |
| 58 | 3300025932 | Ga0207690_10907291 | Ga0207690_109072911 | 146 |
| 59 | 3300025933 | Ga0207706_10014564 | Ga0207706_100145645 | 146 |
| 60 | 3300025933 | Ga0207706_11091310 | Ga0207706_110913101 | 146 |
| 61 | 3300026116 | Ga0207674_10268678 | Ga0207674_102686782 | 146 |
| 62 | 3300026118 | Ga0207675_100001056 | Ga0207675_10000105630 | 146 |
| 63 | 3300027907 | Ga0207428_10009627 | Ga0207428_100096274 | 146 |
| 64 | 3300027907 | Ga0207428_10091838 | Ga0207428_100918382 | 146 |
| 65 | 3300028380 | Ga0268265_10016191 | Ga0268265_100161913 | 146 |
| 66 | 3300028786 | Ga0307517_10308595 | Ga0307517_103085952 | 146 |
| 67 | 3300028794 | Ga0307515_10108595 | Ga0307515_101085951 | 146 |
| 68 | 3300030760 | Ga0265762_1053904 | Ga0265762_10539041 | 146 |
| 69 | 3300031456 | Ga0307513_10056201 | Ga0307513_100562015 | 146 |
| 70 | 3300031507 | Ga0307509_10040420 | Ga0307509_100404204 | 146 |
| 71 | 3300031507 | Ga0307509_10084866 | Ga0307509_100848664 | 146 |
| 72 | 3300037312 | Ga0395899_0405090 | Ga0395899_0405090_33_476 | 146 |
| 73 | 3300037466 | Ga0395898_0003877 | Ga0395898_0003877_5823_6266 | 146 |
| 74 | 3300039437 | Ga0436365_0476991 | Ga0436365_0476991_274_717 | 146 |
| 75 | 3300049593 | Ga0501077_0039411 | Ga0501077_0039411_1974_2414 | 146 |
| 76 | 3300049741 | Ga0501079_0670411 | Ga0501079_0670411_224_685 | 146 |
| 77 | 3300049744 | Ga0501083_0627725 | Ga0501083_0627725_46_486 | 146 |
| 78 | 3300050489 | nmdc:mga03683_286537_c1 | nmdc:mga03683_286537_c1_11_451 | 146 |
| 79 | 3300050507 | nmdc:mga05p37_85836_c1 | nmdc:mga05p37_85836_c1_1151_1612 | 146 |
| 80 | 3300050508 | nmdc:mga09592_13600_c1 | nmdc:mga09592_13600_c1_4985_5446 | 146 |
| 81 | 3300050508 | nmdc:mga09592_505671_c1 | nmdc:mga09592_505671_c1_521_982 | 146 |
| 82 | 3300050509 | nmdc:mga0qj67_126268_c1 | nmdc:mga0qj67_126268_c1_1456_1917 | 146 |
| 83 | 3300050509 | nmdc:mga0qj67_515287_c1 | nmdc:mga0qj67_515287_c1_480_920 | 146 |
| 84 | 3300050510 | nmdc:mga06r32_13253_c1 | nmdc:mga06r32_13253_c1_2453_2914 | 146 |
| 85 | 3300050510 | nmdc:mga06r32_824166_c1 | nmdc:mga06r32_824166_c1_74_529 | 146 |
| 86 | 3300050511 | nmdc:mga08y16_106829_c1 | nmdc:mga08y16_106829_c1_2232_2693 | 146 |
| 87 | 3300050511 | nmdc:mga08y16_1603320_c1 | nmdc:mga08y16_1603320_c1_25_480 | 146 |
| 88 | 3300050511 | nmdc:mga08y16_4099_c1 | nmdc:mga08y16_4099_c1_610_1071 | 146 |
| 89 | 3300050515 | nmdc:mga0a205_648227_c1 | nmdc:mga0a205_648227_c1_387_848 | 146 |
| 90 | 3300053093 | Ga0500651_0004006 | Ga0500651_0004006_6208_6648 | 146 |
| 91 | 3300053094 | Ga0500566_0101107 | Ga0500566_0101107_803_1243 | 146 |
| 92 | 3300053098 | Ga0500650_0307341 | Ga0500650_0307341_36_476 | 146 |
| 93 | 3300053103 | Ga0500555_002678 | Ga0500555_002678_1415_1855 | 146 |
| 94 | 3300053103 | Ga0500555_082230 | Ga0500555_082230_311_751 | 146 |
| 95 | 3300053119 | Ga0500595_001310 | Ga0500595_001310_5900_6340 | 146 |
| 96 | 3300053133 | Ga0500655_088128 | Ga0500655_088128_51_491 | 146 |
| 97 | 3300053146 | Ga0500588_0166445 | Ga0500588_0166445_189_629 | 146 |
| 98 | 3300053156 | Ga0500622_0393241 | Ga0500622_0393241_91_531 | 146 |
| 99 | 3300060353 | Ga0501082_0465252 | Ga0501082_0465252_152_592 | 146 |
| 100 | 3300001904 | JGI24736J21556_1009770 | JGI24736J21556_10097703 | 147 |
| 101 | 3300001915 | JGI24741J21665_1004163 | JGI24741J21665_10041632 | 147 |
| 102 | 3300001979 | JGI24740J21852_10001127 | JGI24740J21852_1000112715 | 147 |
| 103 | 3300003322 | rootL2_10101893 | rootL2_101018932 | 147 |
| 104 | 3300003790 | Ga0055528_1001227 | Ga0055528_100122710 | 147 |
| 105 | 3300005327 | Ga0070658_10065644 | Ga0070658_100656442 | 147 |
| 106 | 3300005327 | Ga0070658_10205488 | Ga0070658_102054884 | 147 |
| 107 | 3300005327 | Ga0070658_10318748 | Ga0070658_103187481 | 147 |
| 108 | 3300005329 | Ga0070683_100203687 | Ga0070683_1002036873 | 147 |
| 109 | 3300005329 | Ga0070683_101190147 | Ga0070683_1011901472 | 147 |
| 110 | 3300005334 | Ga0068869_100049460 | Ga0068869_1000494603 | 147 |
| 111 | 3300005335 | Ga0070666_10168948 | Ga0070666_101689482 | 147 |
| 112 | 3300005337 | Ga0070682_100009898 | Ga0070682_1000098985 | 147 |
| 113 | 3300005341 | Ga0070691_10015354 | Ga0070691_100153543 | 147 |
| 114 | 3300005344 | Ga0070661_100060965 | Ga0070661_1000609653 | 147 |
| 115 | 3300005344 | Ga0070661_100121056 | Ga0070661_1001210562 | 147 |
| 116 | 3300005345 | Ga0070692_10021827 | Ga0070692_100218275 | 147 |
| 117 | 3300005353 | Ga0070669_100012775 | Ga0070669_1000127754 | 147 |
| 118 | 3300005353 | Ga0070669_100202656 | Ga0070669_1002026562 | 147 |
| 119 | 3300005356 | Ga0070674_100015724 | Ga0070674_1000157245 | 147 |
| 120 | 3300005366 | Ga0070659_100088471 | Ga0070659_1000884715 | 147 |
| 121 | 3300005367 | Ga0070667_100000008 | Ga0070667_100000008219 | 147 |
| 122 | 3300005406 | Ga0070703_10529248 | Ga0070703_105292481 | 147 |
| 123 | 3300005455 | Ga0070663_100024278 | Ga0070663_1000242786 | 147 |
| 124 | 3300005455 | Ga0070663_100521452 | Ga0070663_1005214522 | 147 |
| 125 | 3300005457 | Ga0070662_100210988 | Ga0070662_1002109883 | 147 |
| 126 | 3300005458 | Ga0070681_10018467 | Ga0070681_100184676 | 147 |
| 127 | 3300005467 | Ga0070706_101615154 | Ga0070706_1016151541 | 147 |
| 128 | 3300005530 | Ga0070679_100001424 | Ga0070679_10000142419 | 147 |
| 129 | 3300005535 | Ga0070684_100043385 | Ga0070684_1000433855 | 147 |
| 130 | 3300005539 | Ga0068853_100032506 | Ga0068853_1000325065 | 147 |
| 131 | 3300005539 | Ga0068853_101618358 | Ga0068853_1016183581 | 147 |
| 132 | 3300005546 | Ga0070696_100000766 | Ga0070696_10000076622 | 147 |
| 133 | 3300005546 | Ga0070696_100014024 | Ga0070696_1000140245 | 147 |
| 134 | 3300005546 | Ga0070696_100021034 | Ga0070696_1000210346 | 147 |
| 135 | 3300005563 | Ga0068855_100200616 | Ga0068855_1002006163 | 147 |
| 136 | 3300005564 | Ga0070664_100022611 | Ga0070664_1000226114 | 147 |
| 137 | 3300005578 | Ga0068854_100005171 | Ga0068854_1000051716 | 147 |
| 138 | 3300005578 | Ga0068854_100017485 | Ga0068854_1000174853 | 147 |
| 139 | 3300005614 | Ga0068856_100031561 | Ga0068856_1000315614 | 147 |
| 140 | 3300005614 | Ga0068856_100663014 | Ga0068856_1006630142 | 147 |
| 141 | 3300005616 | Ga0068852_100011983 | Ga0068852_1000119837 | 147 |
| 142 | 3300005616 | Ga0068852_100491666 | Ga0068852_1004916662 | 147 |
| 143 | 3300005617 | Ga0068859_100471388 | Ga0068859_1004713882 | 147 |
| 144 | 3300005718 | Ga0068866_10142281 | Ga0068866_101422812 | 147 |
| 145 | 3300005834 | Ga0068851_10001581 | Ga0068851_100015817 | 147 |
| 146 | 3300005842 | Ga0068858_100110233 | Ga0068858_1001102332 | 147 |
| 147 | 3300005843 | Ga0068860_100077819 | Ga0068860_1000778192 | 147 |
| 148 | 3300005844 | Ga0068862_100008974 | Ga0068862_1000089747 | 147 |
| 149 | 3300005844 | Ga0068862_100505830 | Ga0068862_1005058302 | 147 |
| 150 | 3300005937 | Ga0081455_10255719 | Ga0081455_102557192 | 147 |
| 151 | 3300005981 | Ga0081538_10000854 | Ga0081538_1000085434 | 147 |
| 152 | 3300005981 | Ga0081538_10030126 | Ga0081538_100301264 | 147 |
| 153 | 3300006177 | Ga0075362_10041793 | Ga0075362_100417933 | 147 |
| 154 | 3300006844 | Ga0075428_100066813 | Ga0075428_1000668135 | 147 |
| 155 | 3300006844 | Ga0075428_100108207 | Ga0075428_1001082076 | 147 |
| 156 | 3300006846 | Ga0075430_100320052 | Ga0075430_1003200522 | 147 |
| 157 | 3300006847 | Ga0075431_100428253 | Ga0075431_1004282532 | 147 |
| 158 | 3300006852 | Ga0075433_10419023 | Ga0075433_104190232 | 147 |
| 159 | 3300006880 | Ga0075429_100055145 | Ga0075429_1000551452 | 147 |
| 160 | 3300006880 | Ga0075429_100255934 | Ga0075429_1002559343 | 147 |
| 161 | 3300006880 | Ga0075429_101673312 | Ga0075429_1016733121 | 147 |
| 162 | 3300006881 | Ga0068865_100238739 | Ga0068865_1002387393 | 147 |
| 163 | 3300006931 | Ga0097620_100471316 | Ga0097620_1004713162 | 147 |
| 164 | 3300007265 | Ga0099794_10007584 | Ga0099794_100075844 | 147 |
| 165 | 3300009092 | Ga0105250_10102268 | Ga0105250_101022681 | 147 |
| 166 | 3300009093 | Ga0105240_10086457 | Ga0105240_100864575 | 147 |
| 167 | 3300009093 | Ga0105240_10101742 | Ga0105240_101017422 | 147 |
| 168 | 3300009093 | Ga0105240_10459441 | Ga0105240_104594412 | 147 |
| 169 | 3300009094 | Ga0111539_10005924 | Ga0111539_100059246 | 147 |
| 170 | 3300009094 | Ga0111539_10570977 | Ga0111539_105709773 | 147 |
| 171 | 3300009101 | Ga0105247_10016477 | Ga0105247_100164774 | 147 |
| 172 | 3300009147 | Ga0114129_10079481 | Ga0114129_100794813 | 147 |
| 173 | 3300009174 | Ga0105241_10060803 | Ga0105241_100608035 | 147 |
| 174 | 3300009176 | Ga0105242_10578281 | Ga0105242_105782811 | 147 |
| 175 | 3300009176 | Ga0105242_10849279 | Ga0105242_108492792 | 147 |
| 176 | 3300009177 | Ga0105248_10237427 | Ga0105248_102374272 | 147 |
| 177 | 3300009545 | Ga0105237_10333651 | Ga0105237_103336512 | 147 |
| 178 | 3300009545 | Ga0105237_10629898 | Ga0105237_106298983 | 147 |
| 179 | 3300009551 | Ga0105238_10002639 | Ga0105238_100026393 | 147 |
| 180 | 3300009553 | Ga0105249_10063980 | Ga0105249_100639804 | 147 |
| 181 | 3300009553 | Ga0105249_10755248 | Ga0105249_107552482 | 147 |
| 182 | 3300010375 | Ga0105239_10448256 | Ga0105239_104482562 | 147 |
| 183 | 3300013100 | Ga0157373_10153059 | Ga0157373_101530592 | 147 |
| 184 | 3300013104 | Ga0157370_10014688 | Ga0157370_100146888 | 147 |
| 185 | 3300013104 | Ga0157370_10020717 | Ga0157370_100207176 | 147 |
| 186 | 3300013104 | Ga0157370_10393748 | Ga0157370_103937483 | 147 |
| 187 | 3300013104 | Ga0157370_10408939 | Ga0157370_104089391 | 147 |
| 188 | 3300013105 | Ga0157369_10864035 | Ga0157369_108640352 | 147 |
| 189 | 3300013307 | Ga0157372_10333539 | Ga0157372_103335394 | 147 |
| 190 | 3300013307 | Ga0157372_10472684 | Ga0157372_104726843 | 147 |
| 191 | 3300014325 | Ga0163163_10117209 | Ga0163163_101172092 | 147 |
| 192 | 3300014968 | Ga0157379_10068181 | Ga0157379_100681812 | 147 |
| 193 | 3300014968 | Ga0157379_10167853 | Ga0157379_101678531 | 147 |
| 194 | 3300020069 | Ga0197907_10336673 | Ga0197907_103366732 | 147 |
| 195 | 3300020070 | Ga0206356_10120843 | Ga0206356_1012084310 | 147 |
| 196 | 3300020081 | Ga0206354_10217729 | Ga0206354_102177298 | 147 |
| 197 | 3300020081 | Ga0206354_10453580 | Ga0206354_104535802 | 147 |
| 198 | 3300020082 | Ga0206353_11626200 | Ga0206353_116262005 | 147 |
| 199 | 3300021384 | Ga0213876_10270611 | Ga0213876_102706111 | 147 |
| 200 | 3300025263 | Ga0209565_1023063 | Ga0209565_10230631 | 147 |
| 201 | 3300025273 | Ga0209673_1000026 | Ga0209673_1000026279 | 147 |
| 202 | 3300025295 | Ga0209564_1004704 | Ga0209564_10047043 | 147 |
| 203 | 3300025321 | Ga0207656_10204688 | Ga0207656_102046881 | 147 |
| 204 | 3300025711 | Ga0207696_1112783 | Ga0207696_11127831 | 147 |
| 205 | 3300025899 | Ga0207642_10229760 | Ga0207642_102297601 | 147 |
| 206 | 3300025900 | Ga0207710_10013100 | Ga0207710_100131003 | 147 |
| 207 | 3300025903 | Ga0207680_10187846 | Ga0207680_101878462 | 147 |
| 208 | 3300025904 | Ga0207647_10001000 | Ga0207647_1000100016 | 147 |
| 209 | 3300025908 | Ga0207643_10038034 | Ga0207643_100380343 | 147 |
| 210 | 3300025909 | Ga0207705_10002892 | Ga0207705_1000289210 | 147 |
| 211 | 3300025909 | Ga0207705_10004208 | Ga0207705_100042087 | 147 |
| 212 | 3300025909 | Ga0207705_10092238 | Ga0207705_100922385 | 147 |
| 213 | 3300025909 | Ga0207705_10137431 | Ga0207705_101374312 | 147 |
| 214 | 3300025910 | Ga0207684_11344541 | Ga0207684_113445411 | 147 |
| 215 | 3300025911 | Ga0207654_10023480 | Ga0207654_100234802 | 147 |
| 216 | 3300025912 | Ga0207707_10000099 | Ga0207707_1000009923 | 147 |
| 217 | 3300025912 | Ga0207707_10000750 | Ga0207707_1000075026 | 147 |
| 218 | 3300025913 | Ga0207695_10006285 | Ga0207695_1000628513 | 147 |
| 219 | 3300025913 | Ga0207695_10256185 | Ga0207695_102561852 | 147 |
| 220 | 3300025913 | Ga0207695_10842553 | Ga0207695_108425532 | 147 |
| 221 | 3300025914 | Ga0207671_10719526 | Ga0207671_107195261 | 147 |
| 222 | 3300025914 | Ga0207671_11033100 | Ga0207671_110331001 | 147 |
| 223 | 3300025917 | Ga0207660_10005917 | Ga0207660_1000591710 | 147 |
| 224 | 3300025919 | Ga0207657_10012284 | Ga0207657_100122847 | 147 |
| 225 | 3300025919 | Ga0207657_11109380 | Ga0207657_111093801 | 147 |
| 226 | 3300025920 | Ga0207649_10001083 | Ga0207649_1000108316 | 147 |
| 227 | 3300025920 | Ga0207649_10098374 | Ga0207649_100983743 | 147 |
| 228 | 3300025921 | Ga0207652_10000212 | Ga0207652_1000021245 | 147 |
| 229 | 3300025921 | Ga0207652_10010900 | Ga0207652_100109009 | 147 |
| 230 | 3300025921 | Ga0207652_10012677 | Ga0207652_100126779 | 147 |
| 231 | 3300025923 | Ga0207681_10041953 | Ga0207681_100419535 | 147 |
| 232 | 3300025923 | Ga0207681_10253894 | Ga0207681_102538942 | 147 |
| 233 | 3300025924 | Ga0207694_10004332 | Ga0207694_100043324 | 147 |
| 234 | 3300025932 | Ga0207690_10000982 | Ga0207690_100009829 | 147 |
| 235 | 3300025933 | Ga0207706_10006207 | Ga0207706_1000620714 | 147 |
| 236 | 3300025934 | Ga0207686_10871277 | Ga0207686_108712771 | 147 |
| 237 | 3300025937 | Ga0207669_10012436 | Ga0207669_100124363 | 147 |
| 238 | 3300025938 | Ga0207704_10292819 | Ga0207704_102928191 | 147 |
| 239 | 3300025941 | Ga0207711_10294253 | Ga0207711_102942532 | 147 |
| 240 | 3300025942 | Ga0207689_10076647 | Ga0207689_100766473 | 147 |
| 241 | 3300025944 | Ga0207661_10004864 | Ga0207661_100048645 | 147 |
| 242 | 3300025945 | Ga0207679_10003088 | Ga0207679_100030887 | 147 |
| 243 | 3300025949 | Ga0207667_10007992 | Ga0207667_100079929 | 147 |
| 244 | 3300025961 | Ga0207712_10189806 | Ga0207712_101898061 | 147 |
| 245 | 3300025961 | Ga0207712_10797770 | Ga0207712_107977702 | 147 |
| 246 | 3300025981 | Ga0207640_10001471 | Ga0207640_1000147115 | 147 |
| 247 | 3300025981 | Ga0207640_10009359 | Ga0207640_100093597 | 147 |
| 248 | 3300025986 | Ga0207658_10000066 | Ga0207658_1000006640 | 147 |
| 249 | 3300026041 | Ga0207639_10000724 | Ga0207639_1000072410 | 147 |
| 250 | 3300026041 | Ga0207639_12117378 | Ga0207639_121173781 | 147 |
| 251 | 3300026067 | Ga0207678_10019574 | Ga0207678_100195747 | 147 |
| 252 | 3300026067 | Ga0207678_10267400 | Ga0207678_102674002 | 147 |
| 253 | 3300026078 | Ga0207702_10004008 | Ga0207702_100040086 | 147 |
| 254 | 3300026078 | Ga0207702_10644488 | Ga0207702_106444883 | 147 |
| 255 | 3300026088 | Ga0207641_10832296 | Ga0207641_108322962 | 147 |
| 256 | 3300026116 | Ga0207674_10019736 | Ga0207674_100197369 | 147 |
| 257 | 3300026116 | Ga0207674_11454437 | Ga0207674_114544371 | 147 |
| 258 | 3300026118 | Ga0207675_100027997 | Ga0207675_1000279974 | 147 |
| 259 | 3300026118 | Ga0207675_100569640 | Ga0207675_1005696402 | 147 |
| 260 | 3300026142 | Ga0207698_10001598 | Ga0207698_1000159810 | 147 |
| 261 | 3300027671 | Ga0209588_1009741 | Ga0209588_10097412 | 147 |
| 262 | 3300027866 | Ga0209813_10294724 | Ga0209813_102947241 | 147 |
| 263 | 3300027907 | Ga0207428_10000689 | Ga0207428_100006893 | 147 |
| 264 | 3300027907 | Ga0207428_10289110 | Ga0207428_102891101 | 147 |
| 265 | 3300028380 | Ga0268265_10030070 | Ga0268265_100300703 | 147 |
| 266 | 3300028381 | Ga0268264_10163028 | Ga0268264_101630282 | 147 |
| 267 | 3300031824 | Ga0307413_10007545 | Ga0307413_100075456 | 147 |
| 268 | 3300031901 | Ga0307406_10208103 | Ga0307406_102081032 | 147 |
| 269 | 3300031903 | Ga0307407_10010443 | Ga0307407_100104432 | 147 |
| 270 | 3300031911 | Ga0307412_10285719 | Ga0307412_102857192 | 147 |
| 271 | 3300031995 | Ga0307409_100010292 | Ga0307409_1000102925 | 147 |
| 272 | 3300032002 | Ga0307416_100094535 | Ga0307416_1000945353 | 147 |
| 273 | 3300032002 | Ga0307416_101732588 | Ga0307416_1017325882 | 147 |
| 274 | 3300032005 | Ga0307411_10125563 | Ga0307411_101255632 | 147 |
| 275 | 3300036401 | Ga0373937_0277795 | Ga0373937_0277795_32_493 | 147 |
| 276 | 3300037312 | Ga0395899_0029433 | Ga0395899_0029433_1496_1939 | 147 |
| 277 | 3300037418 | Ga0395900_0190078 | Ga0395900_0190078_875_1318 | 147 |
| 278 | 3300038443 | Ga0395901_0035663 | Ga0395901_0035663_4686_5129 | 147 |
| 279 | 3300039437 | Ga0436365_0430459 | Ga0436365_0430459_947_1402 | 147 |
| 280 | 3300041494 | Ga0451837_0656683 | Ga0451837_0656683_83_526 | 147 |
| 281 | 3300042004 | Ga0439445_0142830 | Ga0439445_0142830_25_471 | 147 |
| 282 | 3300042005 | Ga0439448_0069549 | Ga0439448_0069549_584_1027 | 147 |
| 283 | 3300042008 | Ga0439450_081410 | Ga0439450_081410_291_734 | 147 |
| 284 | 3300042157 | Ga0439458_0014975 | Ga0439458_0014975_327_770 | 147 |
| 285 | 3300042436 | Ga0439435_0077461 | Ga0439435_0077461_530_973 | 147 |
| 286 | 3300042461 | Ga0439460_0336470 | Ga0439460_0336470_56_517 | 147 |
| 287 | 3300044684 | Ga0466966_0294856 | Ga0466966_0294856_376_822 | 147 |
| 288 | 3300044693 | Ga0466961_0010179 | Ga0466961_0010179_1297_1743 | 147 |
| 289 | 3300045051 | Ga0451576_0863157 | Ga0451576_0863157_47_490 | 147 |
| 290 | 3300046471 | Ga0495650_0041739 | Ga0495650_0041739_693_1163 | 147 |
| 291 | 3300049570 | Ga0501033_0030057 | Ga0501033_0030057_2462_2905 | 147 |
| 292 | 3300049571 | Ga0501034_0261346 | Ga0501034_0261346_42_485 | 147 |
| 293 | 3300049572 | Ga0501036_0084093 | Ga0501036_0084093_1341_1784 | 147 |
| 294 | 3300049573 | Ga0501037_0872285 | Ga0501037_0872285_23_466 | 147 |
| 295 | 3300049575 | Ga0501039_0259471 | Ga0501039_0259471_281_724 | 147 |
| 296 | 3300049585 | Ga0501069_0140687 | Ga0501069_0140687_845_1288 | 147 |
| 297 | 3300049585 | Ga0501069_0253983 | Ga0501069_0253983_18_461 | 147 |
| 298 | 3300049586 | Ga0501070_0001427 | Ga0501070_0001427_8061_8504 | 147 |
| 299 | 3300049588 | Ga0501072_0121774 | Ga0501072_0121774_334_777 | 147 |
| 300 | 3300049589 | Ga0501073_0041497 | Ga0501073_0041497_1151_1594 | 147 |
| 301 | 3300049590 | Ga0501074_0004029 | Ga0501074_0004029_8472_8915 | 147 |
| 302 | 3300049593 | Ga0501077_0011274 | Ga0501077_0011274_1234_1677 | 147 |
| 303 | 3300049742 | Ga0501080_0057482 | Ga0501080_0057482_1735_2178 | 147 |
| 304 | 3300049743 | Ga0501081_0909659 | Ga0501081_0909659_119_571 | 147 |
| 305 | 3300049743 | Ga0501081_1325777 | Ga0501081_1325777_86_532 | 147 |
| 306 | 3300050495 | nmdc:mga04h51_330148_c1 | nmdc:mga04h51_330148_c1_20_463 | 147 |
| 307 | 3300050507 | nmdc:mga05p37_62323_c1 | nmdc:mga05p37_62323_c1_2138_2581 | 147 |
| 308 | 3300050508 | nmdc:mga09592_1669362_c1 | nmdc:mga09592_1669362_c1_22_465 | 147 |
| 309 | 3300050509 | nmdc:mga0qj67_612948_c1 | nmdc:mga0qj67_612948_c1_29_478 | 147 |
| 310 | 3300050510 | nmdc:mga06r32_727121_c1 | nmdc:mga06r32_727121_c1_80_523 | 147 |
| 311 | 3300050511 | nmdc:mga08y16_2567_c1 | nmdc:mga08y16_2567_c1_17873_18322 | 147 |
| 312 | 3300050511 | nmdc:mga08y16_432644_c1 | nmdc:mga08y16_432644_c1_114_557 | 147 |
| 313 | 3300050515 | nmdc:mga0a205_491979_c1 | nmdc:mga0a205_491979_c1_186_635 | 147 |
| 314 | 3300053086 | Ga0500578_0036756 | Ga0500578_0036756_576_1019 | 147 |
| 315 | 3300053093 | Ga0500651_0124286 | Ga0500651_0124286_943_1386 | 147 |
| 316 | 3300053104 | Ga0500556_0000174 | Ga0500556_0000174_38316_38777 | 147 |
| 317 | 3300059421 | Ga0590071_033676 | Ga0590071_033676_22_504 | 147 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1xy7-assembly1.cif.gz_B | x-ray structure of gene product from arabidopsis thaliana at5g48480 | 0.8634 | 2 | 124 |
| 1xy7-assembly1.cif.gz_B | x-ray structure of gene product from arabidopsis thaliana at5g48480 | 0.8437 | 2 | 124 |
| 4pav-assembly4.cif.gz_D | structure of hypothetical protein sa1046 from s. aureus. | 0.8379 | 1 | 127 |
| 4pav-assembly4.cif.gz_D | structure of hypothetical protein sa1046 from s. aureus. | 0.8311 | 1 | 127 |
| 1xy7-assembly1.cif.gz_A | x-ray structure of gene product from arabidopsis thaliana at5g48480 | 0.825 | 1 | 124 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WKQ3_98_165_3.30.720.110 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.9313 | 74 | 140 | 3.30.720.110 |
| af_P9WKQ3_98_165_3.30.720.110 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.9061 | 74 | 140 | 3.30.720.110 |
| af_I1N1R1_19_162_3.10.180.10 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8692 | 2 | 133 | 3.10.180.10 |
| af_Q5VMX8_15_124_3.10.180.10 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8567 | 8 | 127 | 3.10.180.10 |
| 3m2oB02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8543 | 75 | 124 | 3.30.720.110 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A430HKT6-F1-model_v4 | VOC family protein | 0.9842 | 3 | 142 |
|
| AF-A0A7W5D6L0-F1-model_v4 | Putative glyoxalase superfamily protein PhnB | 0.9813 | 34 | 144 |
|
| AF-A0A3M1P423-F1-model_v4 | VOC family protein | 0.9778 | 3 | 144 |
|
| AF-A0A495QDT8-F1-model_v4 | deleted | 0.9764 | 4 | 146 |
|
| AF-A0A1G0M996-F1-model_v4 | Glyoxalase | 0.9759 | 4 | 122 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar