F404104

General Info

Members Datasets Scaffolds Average Seq Length
317 170 634 161

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100023800|Ga0075431_1000238005
Length 195
Sequence MLRSHIAGETSAQAVVAPRFFYFCPFVWNFRIIRAMQIHVGIITISDRASKGLYDDLGGPALKKAAEGHGWKVLAETLVPDEKRDIQRAIREQVNKGCHLVLTTGGTGVALRDVTPEAVREIALRELPGFGEVMRLESMKITKNAILSRNLAVVVDKALVICLPGKPSGAVECLGFVVGAIPHCIEVLQEVPTSC

Samples

Sample ID Description Type Environment
1 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
46 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
47 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
48 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
49 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
50 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
51 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
56 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
57 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
58 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
88 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
91 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
92 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
93 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
94 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
95 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
96 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
97 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
98 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
99 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
100 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
101 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
102 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
103 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
104 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
105 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
106 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
107 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
108 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
109 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
110 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
111 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
112 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
113 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
114 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
115 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
116 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
117 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
118 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
119 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
120 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
122 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
125 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
126 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
127 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
128 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
129 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
130 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
131 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
132 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
133 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
134 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
135 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
136 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
137 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
138 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
139 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
140 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
141 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
142 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
143 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
144 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
145 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
146 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
147 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
148 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
149 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
150 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
151 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
152 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
153 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
154 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
155 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
156 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
157 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
158 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
159 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
160 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
161 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
164 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
165 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
166 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
167 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
168 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
169 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
170 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.58
Rhizosphere 97.79
Stem 0
Stem Tuber 0
Unclassified 21.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075431_100023800 3300006847 Bacteria 6269
2 Ga0065707_10010735 3300005295 Bacteria 2227
3 Ga0070683_101237573 3300005329 Unclassified 717
4 Ga0070690_100070908 3300005330 Bacteria 2263
5 Ga0070690_100499470 3300005330 Bacteria 910
6 Ga0070666_10198486 3300005335 Unclassified 1411
7 Ga0070680_100393588 3300005336 Bacteria 1181
8 Ga0070682_100655005 3300005337 Unclassified 836
9 Ga0070689_100017076 3300005340 Bacteria 5324
10 Ga0070689_100038692 3300005340 Bacteria 3650
11 Ga0070689_100038787 3300005340 Bacteria 3644
12 Ga0070689_100072916 3300005340 Bacteria 2684
13 Ga0070689_100176060 3300005340 Bacteria 1735
14 Ga0070689_100190598 3300005340 Bacteria 1669
15 Ga0070689_100421027 3300005340 Unclassified 1132
16 Ga0070687_100420883 3300005343 Bacteria 881
17 Ga0070687_100747212 3300005343 Unclassified 688
18 Ga0070668_101298305 3300005347 Unclassified 661
19 Ga0070688_100040075 3300005365 Bacteria 2869
20 Ga0070688_100253794 3300005365 Bacteria 1253
21 Ga0070688_100427002 3300005365 Unclassified 986
22 Ga0070713_100904383 3300005436 Bacteria 849
23 Ga0070701_10051780 3300005438 Bacteria 2131
24 Ga0070701_10222982 3300005438 Bacteria 1125
25 Ga0070711_100295522 3300005439 Bacteria 1286
26 Ga0070711_100451306 3300005439 Bacteria 1052
27 Ga0070705_100139533 3300005440 Bacteria 1593
28 Ga0070694_100013770 3300005444 Bacteria 5056
29 Ga0070694_100330492 3300005444 Bacteria 1176
30 Ga0070708_100022792 3300005445 Bacteria 5316
31 Ga0070681_10072386 3300005458 Bacteria 3410
32 Ga0070681_10510553 3300005458 Unclassified 1115
33 Ga0070681_10548311 3300005458 Bacteria 1070
34 Ga0070681_11268700 3300005458 Bacteria 659
35 Ga0070698_100619405 3300005471 Bacteria 1023
36 Ga0070698_101267232 3300005471 Bacteria 687
37 Ga0070679_100842120 3300005530 Bacteria 860
38 Ga0070686_100000501 3300005544 Bacteria 23585
39 Ga0070686_100016383 3300005544 Bacteria 4312
40 Ga0070686_100307148 3300005544 Unclassified 1178
41 Ga0070686_100326253 3300005544 Bacteria 1146
42 Ga0070695_100241739 3300005545 Bacteria 1310
43 Ga0070695_100507794 3300005545 Bacteria 933
44 Ga0068855_100057449 3300005563 Bacteria 4561
45 Ga0068855_100122672 3300005563 Bacteria 2973
46 Ga0068855_100632507 3300005563 Bacteria 1151
47 Ga0068855_101841338 3300005563 Unclassified 614
48 Ga0068857_100006571 3300005577 Bacteria 9981
49 Ga0068857_100888817 3300005577 Unclassified 854
50 Ga0068854_100966602 3300005578 Unclassified 752
51 Ga0068856_100101215 3300005614 Bacteria 2874
52 Ga0070702_100353914 3300005615 Bacteria 1035
53 Ga0070702_100998088 3300005615 Unclassified 662
54 Ga0068859_100057297 3300005617 Bacteria 3925
55 Ga0068859_101441427 3300005617 Unclassified 760
56 Ga0068864_100227540 3300005618 Bacteria 1723
57 Ga0068864_100280291 3300005618 Bacteria 1556
58 Ga0068864_100295965 3300005618 Bacteria 1514
59 Ga0068864_100856844 3300005618 Unclassified 896
60 Ga0068866_10525120 3300005718 Bacteria 787
61 Ga0068863_100011579 3300005841 Bacteria 8534
62 Ga0068863_100287313 3300005841 Bacteria 1594
63 Ga0068863_100505746 3300005841 Bacteria 1190
64 Ga0068863_100621457 3300005841 Unclassified 1070
65 Ga0068858_101266674 3300005842 Bacteria 725
66 Ga0068862_100531764 3300005844 Bacteria 1120
67 Ga0068862_101164932 3300005844 Bacteria 768
68 Ga0081455_10275649 3300005937 Bacteria 1217
69 Ga0070712_101068523 3300006175 Bacteria 700
70 Ga0097621_100212468 3300006237 Bacteria 1683
71 Ga0097621_100677037 3300006237 Bacteria 948
72 Ga0068871_100005953 3300006358 Bacteria 8584
73 Ga0068871_100044947 3300006358 Bacteria 3553
74 Ga0075428_100003926 3300006844 Bacteria 16330
75 Ga0075428_100485711 3300006844 Bacteria 1322
76 Ga0075430_100281487 3300006846 Bacteria 1376
77 Ga0075431_100224112 3300006847 Bacteria 1917
78 Ga0075434_100192993 3300006871 Bacteria 2057
79 Ga0075429_100484858 3300006880 Bacteria 1083
80 Ga0068865_100671250 3300006881 Bacteria 883
81 Ga0097620_100057295 3300006931 Bacteria 3925
82 Ga0097620_101441471 3300006931 Unclassified 760
83 Ga0075435_100138949 3300007076 Bacteria 2037
84 Ga0075435_100254393 3300007076 Bacteria 1496
85 Ga0075435_100827803 3300007076 Bacteria 806
86 Ga0099795_10251343 3300007788 Bacteria 763
87 Ga0105240_10031196 3300009093 Bacteria 6915
88 Ga0105240_10034099 3300009093 Bacteria 6569
89 Ga0105240_10158958 3300009093 Bacteria 2686
90 Ga0105240_10190983 3300009093 Bacteria 2408
91 Ga0105240_11270802 3300009093 Unclassified 777
92 Ga0111539_10048128 3300009094 Bacteria 5092
93 Ga0111539_10161832 3300009094 Bacteria 2617
94 Ga0111539_10313840 3300009094 Bacteria 1825
95 Ga0111539_10525194 3300009094 Bacteria 1379
96 Ga0111539_11923603 3300009094 Unclassified 686
97 Ga0111539_12096243 3300009094 Unclassified 656
98 Ga0105245_10410117 3300009098 Bacteria 1356
99 Ga0105245_10472139 3300009098 Bacteria 1266
100 Ga0114129_10659409 3300009147 Bacteria 1350
101 Ga0105241_10061533 3300009174 Bacteria 2891
102 Ga0105242_10035039 3300009176 Bacteria 4024
103 Ga0105248_11141441 3300009177 Bacteria 881
104 Ga0105248_11480839 3300009177 Unclassified 768
105 Ga0105238_10007437 3300009551 Bacteria 10970
106 Ga0105238_10635787 3300009551 Bacteria 1076
107 Ga0105249_10422560 3300009553 Bacteria 1367
108 Ga0157370_10078826 3300013104 Bacteria 3102
109 Ga0157370_10102856 3300013104 Bacteria 2674
110 Ga0157374_10114108 3300013296 Bacteria 2601
111 Ga0157374_11655187 3300013296 Unclassified 664
112 Ga0157378_10050551 3300013297 Bacteria 3699
113 Ga0163162_10256142 3300013306 Bacteria 1882
114 Ga0163162_10967641 3300013306 Bacteria 962
115 Ga0157372_10906273 3300013307 Unclassified 1023
116 Ga0157372_11677130 3300013307 Bacteria 731
117 Ga0157372_11992833 3300013307 Unclassified 667
118 Ga0157375_10000021 3300013308 Bacteria 249616
119 Ga0157375_11218595 3300013308 Bacteria 883
120 Ga0163163_10001288 3300014325 Bacteria 21171
121 Ga0163163_10076089 3300014325 Bacteria 3351
122 Ga0163163_10238135 3300014325 Bacteria 1869
123 Ga0157379_10420148 3300014968 Bacteria 1231
124 Ga0157379_11122636 3300014968 Bacteria 754
125 Ga0157376_10768696 3300014969 Bacteria 974
126 Ga0157376_11693369 3300014969 Unclassified 667
127 Ga0207707_10411611 3300025912 Bacteria 1160
128 Ga0207707_10966430 3300025912 Bacteria 701
129 Ga0207695_10016519 3300025913 Bacteria 8630
130 Ga0207695_10050903 3300025913 Bacteria 4354
131 Ga0207695_10083828 3300025913 Bacteria 3219
132 Ga0207695_10129759 3300025913 Bacteria 2479
133 Ga0207695_10923452 3300025913 Unclassified 752
134 Ga0207663_10172245 3300025916 Bacteria 1539
135 Ga0207660_10412846 3300025917 Bacteria 1088
136 Ga0207652_10406472 3300025921 Bacteria 1228
137 Ga0207694_10008573 3300025924 Bacteria 7722
138 Ga0207694_10344946 3300025924 Bacteria 1232
139 Ga0207659_11168419 3300025926 Bacteria 662
140 Ga0207687_10455018 3300025927 Bacteria 1062
141 Ga0207687_11257736 3300025927 Unclassified 636
142 Ga0207700_11555094 3300025928 Bacteria 586
143 Ga0207686_11211521 3300025934 Unclassified 618
144 Ga0207670_10007712 3300025936 Bacteria 6032
145 Ga0207670_10103253 3300025936 Unclassified 2040
146 Ga0207670_10108705 3300025936 Bacteria 1994
147 Ga0207670_10294395 3300025936 Unclassified 1269
148 Ga0207711_10706376 3300025941 Unclassified 940
149 Ga0207711_10903670 3300025941 Unclassified 821
150 Ga0207689_10244647 3300025942 Bacteria 1483
151 Ga0207661_11015284 3300025944 Bacteria 764
152 Ga0207667_10017689 3300025949 Bacteria 8020
153 Ga0207667_10050260 3300025949 Unclassified 4399
154 Ga0207712_10713539 3300025961 Unclassified 876
155 Ga0207668_10503996 3300025972 Bacteria 1042
156 Ga0207639_10229078 3300026041 Unclassified 1609
157 Ga0207702_11748968 3300026078 Unclassified 614
158 Ga0207641_10098296 3300026088 Bacteria 2574
159 Ga0207641_11031190 3300026088 Bacteria 820
160 Ga0207648_10803219 3300026089 Unclassified 876
161 Ga0207676_10278893 3300026095 Bacteria 1517
162 Ga0207676_10426252 3300026095 Bacteria 1245
163 Ga0207676_10494356 3300026095 Bacteria 1161
164 Ga0207674_10026642 3300026116 Bacteria 6133
165 Ga0207674_10790480 3300026116 Unclassified 916
166 Ga0207674_10805663 3300026116 Unclassified 906
167 Ga0207428_10762496 3300027907 Unclassified 689
168 Ga0268265_10527840 3300028380 Bacteria 1117
169 Ga0268264_11689786 3300028381 Unclassified 643
170 Ga0268264_12026494 3300028381 Unclassified 585
171 Ga0265337_1014403 3300028556 Bacteria 2621
172 Ga0265326_10080172 3300028558 Viruses 923
173 Ga0265319_1119598 3300028563 Unclassified 821
174 Ga0265334_10285711 3300028573 Unclassified 566
175 Ga0265336_10119545 3300028666 Bacteria 785
176 Ga0265338_10001925 3300028800 Bacteria 32393
177 Ga0265338_10010246 3300028800 Bacteria 11039
178 Ga0265338_10016666 3300028800 Bacteria 7968
179 Ga0265338_10050664 3300028800 Bacteria 3750
180 Ga0265338_10144433 3300028800 Bacteria 1858
181 Ga0265338_10221268 3300028800 Unclassified 1414
182 Ga0265338_10391558 3300028800 Unclassified 992
183 Ga0265324_10027818 3300029957 Bacteria 1996
184 Ga0265324_10042305 3300029957 Bacteria 1575
185 Ga0307511_10270131 3300030521 Bacteria 797
186 Ga0265332_10005792 3300031238 Bacteria 5668
187 Ga0265320_10032021 3300031240 Bacteria 2696
188 Ga0265320_10048747 3300031240 Bacteria 2065
189 Ga0265320_10136188 3300031240 Bacteria 1114
190 Ga0265320_10162555 3300031240 Bacteria 1005
191 Ga0265325_10028211 3300031241 Bacteria 3028
192 Ga0265325_10083012 3300031241 Unclassified 1590
193 Ga0265329_10001025 3300031242 Bacteria 13941
194 Ga0265339_10020097 3300031249 Bacteria 3906
195 Ga0265339_10061542 3300031249 Bacteria 2020
196 Ga0265339_10267020 3300031249 Bacteria 824
197 Ga0265327_10038937 3300031251 Bacteria 2587
198 Ga0265316_10071522 3300031344 Bacteria 2674
199 Ga0265316_10230404 3300031344 Bacteria 1364
200 Ga0265314_10000584 3300031711 Bacteria 45886
201 Ga0265314_10029192 3300031711 Bacteria 4103
202 Ga0307412_11077209 3300031911 Bacteria 714
203 Ga0373926_0031686 3300035083 Bacteria 1865
204 Ga0373923_0331207 3300035111 Unclassified 724
205 Ga0373936_0271184 3300035113 Bacteria 761
206 Ga0373954_0052125 3300035118 Bacteria 1922
207 Ga0373956_0174088 3300035119 Bacteria 1016
208 Ga0373943_0014063 3300035170 Unclassified 3619
209 Ga0373943_0027272 3300035170 Bacteria 2682
210 Ga0373946_0047697 3300035171 Bacteria 1780
211 Ga0373924_0336795 3300035410 Bacteria 672
212 Ga0373931_0218819 3300035691 Bacteria 1146
213 Ga0373931_0270400 3300035691 Bacteria 1040
214 Ga0373935_0007890 3300035692 Bacteria 6385
215 Ga0373927_0746677 3300035695 Bacteria 646
216 Ga0373927_0951499 3300035695 Bacteria 567
217 Ga0373933_0367348 3300035724 Bacteria 936
218 Ga0373947_0045964 3300035725 Bacteria 2613
219 Ga0373937_0160853 3300036401 Bacteria 2105
220 Ga0373937_0448659 3300036401 Bacteria 1225
221 Ga0373937_0605801 3300036401 Bacteria 1040
222 Ga0373925_0001486 3300037068 Bacteria 20123
223 Ga0373925_0158918 3300037068 Bacteria 1779
224 Ga0373925_1027280 3300037068 Bacteria 679
225 Ga0395905_0276009 3300037471 Bacteria 1567
226 Ga0395901_0725414 3300038443 Unclassified 989
227 Ga0451800_0183527 3300041459 Unclassified 510
228 Ga0451804_0941179 3300041463 Bacteria 641
229 Ga0451807_1999136 3300041486 Unclassified 558
230 Ga0451845_0499797 3300041501 Bacteria 598
231 Ga0451577_0011414 3300042876 Bacteria 8405
232 Ga0453684_0004340 3300044712 Bacteria 30131
233 Ga0453684_0017949 3300044712 Bacteria 10905
234 Ga0453684_0276680 3300044712 Bacteria 1916
235 Ga0453684_1636473 3300044712 Bacteria 660
236 Ga0451576_0084956 3300045051 Bacteria 3292
237 Ga0451576_0190098 3300045051 Bacteria 2144
238 Ga0451576_0266473 3300045051 Bacteria 1791
239 Ga0451576_0540393 3300045051 Bacteria 1224
240 Ga0451576_0561402 3300045051 Bacteria 1199
241 Ga0451576_0561736 3300045051 Bacteria 1199
242 Ga0451576_0861139 3300045051 Bacteria 951
243 Ga0451576_1132812 3300045051 Unclassified 818
244 Ga0451576_1420825 3300045051 Unclassified 722
245 Ga0451576_1612895 3300045051 Unclassified 673
246 Ga0495592_0000081 3300046454 Bacteria 83319
247 Ga0495592_0530500 3300046454 Bacteria 727
248 Ga0495629_0180254 3300046459 Bacteria 1464
249 Ga0495641_0006619 3300046461 Bacteria 7462
250 Ga0495582_0411122 3300046473 Unclassified 780
251 Ga0495664_0286214 3300046477 Bacteria 995
252 Ga0495618_0002728 3300046514 Bacteria 11250
253 Ga0495618_0335003 3300046514 Unclassified 935
254 Ga0495618_0395334 3300046514 Bacteria 846
255 Ga0495628_0001847 3300046516 Bacteria 19222
256 Ga0495628_1009269 3300046516 Unclassified 572
257 Ga0495630_0000055 3300046517 Bacteria 91568
258 Ga0495630_0001608 3300046517 Bacteria 15711
259 Ga0495630_0013893 3300046517 Bacteria 5857
260 Ga0495630_0034605 3300046517 Bacteria 3773
261 Ga0495630_0504878 3300046517 Bacteria 927
262 Ga0495666_0022495 3300046526 Bacteria 3122
263 Ga0495666_0035139 3300046526 Bacteria 2444
264 Ga0495666_0049288 3300046526 Bacteria 2026
265 Ga0495652_0124418 3300046529 Bacteria 2051
266 Ga0495652_0280331 3300046529 Bacteria 1221
267 Ga0495640_0130185 3300046533 Unclassified 1629
268 Ga0495640_0237535 3300046533 Bacteria 1144
269 Ga0495586_0000098 3300046535 Bacteria 53179
270 Ga0495586_0000604 3300046535 Bacteria 20799
271 Ga0495586_0000828 3300046535 Bacteria 17791
272 Ga0495586_0011577 3300046535 Bacteria 4694
273 Ga0495586_0125944 3300046535 Bacteria 1433
274 Ga0495586_0278236 3300046535 Bacteria 957
275 Ga0495587_0398432 3300046536 Unclassified 765
276 Ga0495645_0046436 3300046543 Bacteria 3165
277 Ga0495645_0828777 3300046543 Bacteria 553
278 Ga0495667_0121830 3300046559 Bacteria 1684
279 Ga0495667_0249873 3300046559 Bacteria 1129
280 Ga0495634_0037252 3300046642 Bacteria 3324
281 Ga0495634_0174044 3300046642 Unclassified 1351
282 Ga0495599_0015368 3300046678 Bacteria 4749
283 Ga0495599_0199839 3300046678 Bacteria 1228
284 Ga0495646_0337692 3300046680 Bacteria 791
285 Ga0495647_0017967 3300046681 Bacteria 2510
286 Ga0495658_0015639 3300046683 Bacteria 3894
287 Ga0495658_0074104 3300046683 Bacteria 1983
288 Ga0495613_0016724 3300046689 Bacteria 5462
289 Ga0495624_0069110 3300046690 Bacteria 2201
290 Ga0495581_0683839 3300047315 Unclassified 592
291 Ga0495674_0002350 3300047319 Bacteria 18550
292 Ga0495674_0006991 3300047319 Bacteria 10796
293 Ga0495676_0009155 3300047321 Bacteria 9028
294 Ga0495680_0422450 3300047322 Bacteria 917
295 Ga0495680_0466911 3300047322 Bacteria 861
296 Ga0495675_0021099 3300047444 Bacteria 4147
297 Ga0495675_0194832 3300047444 Unclassified 1236
298 Ga0496107_0044717 3300048910 Bacteria 3184
299 Ga0496112_0176403 3300048915 Bacteria 2102
300 Ga0501299_115184 3300049522 Unclassified 641
301 Ga0501034_0573452 3300049571 Unclassified 1036
302 Ga0501034_0667555 3300049571 Bacteria 940
303 Ga0501039_0607075 3300049575 Bacteria 857
304 Ga0501243_037924 3300049675 Bacteria 839
305 Ga0501083_0566236 3300049744 Bacteria 739
306 nmdc:mga05p37_758731_c1 3300050507 Unclassified 1068
307 nmdc:mga09592_668259_c1 3300050508 Bacteria 886
308 nmdc:mga0qj67_1366843_c1 3300050509 Bacteria 547
309 nmdc:mga06r32_12214_c1 3300050510 Bacteria 7745
310 nmdc:mga06r32_214203_c1 3300050510 Bacteria 1914
311 nmdc:mga08y16_1033952_c1 3300050511 Bacteria 800
312 nmdc:mga08y16_468358_c1 3300050511 Bacteria 1283
313 nmdc:mga08y16_541390_c1 3300050511 Bacteria 1179
314 nmdc:mga08y16_797027_c1 3300050511 Bacteria 938
315 nmdc:mga0rr50_258230_c1 3300050513 Unclassified 1449
316 nmdc:mga0rr50_370658_c1 3300050513 Bacteria 1206
317 nmdc:mga0rr50_825572_c1 3300050513 Bacteria 791
318 Ga0075431_100023800
319 Ga0065707_10010735
320 Ga0070683_101237573
321 Ga0070690_100070908
322 Ga0070690_100499470
323 Ga0070666_10198486
324 Ga0070680_100393588
325 Ga0070682_100655005
326 Ga0070689_100017076
327 Ga0070689_100038692
328 Ga0070689_100038787
329 Ga0070689_100072916
330 Ga0070689_100176060
331 Ga0070689_100190598
332 Ga0070689_100421027
333 Ga0070687_100420883
334 Ga0070687_100747212
335 Ga0070668_101298305
336 Ga0070688_100040075
337 Ga0070688_100253794
338 Ga0070688_100427002
339 Ga0070713_100904383
340 Ga0070701_10051780
341 Ga0070701_10222982
342 Ga0070711_100295522
343 Ga0070711_100451306
344 Ga0070705_100139533
345 Ga0070694_100013770
346 Ga0070694_100330492
347 Ga0070708_100022792
348 Ga0070681_10072386
349 Ga0070681_10510553
350 Ga0070681_10548311
351 Ga0070681_11268700
352 Ga0070698_100619405
353 Ga0070698_101267232
354 Ga0070679_100842120
355 Ga0070686_100000501
356 Ga0070686_100016383
357 Ga0070686_100307148
358 Ga0070686_100326253
359 Ga0070695_100241739
360 Ga0070695_100507794
361 Ga0068855_100057449
362 Ga0068855_100122672
363 Ga0068855_100632507
364 Ga0068855_101841338
365 Ga0068857_100006571
366 Ga0068857_100888817
367 Ga0068854_100966602
368 Ga0068856_100101215
369 Ga0070702_100353914
370 Ga0070702_100998088
371 Ga0068859_100057297
372 Ga0068859_101441427
373 Ga0068864_100227540
374 Ga0068864_100280291
375 Ga0068864_100295965
376 Ga0068864_100856844
377 Ga0068866_10525120
378 Ga0068863_100011579
379 Ga0068863_100287313
380 Ga0068863_100505746
381 Ga0068863_100621457
382 Ga0068858_101266674
383 Ga0068862_100531764
384 Ga0068862_101164932
385 Ga0081455_10275649
386 Ga0070712_101068523
387 Ga0097621_100212468
388 Ga0097621_100677037
389 Ga0068871_100005953
390 Ga0068871_100044947
391 Ga0075428_100003926
392 Ga0075428_100485711
393 Ga0075430_100281487
394 Ga0075431_100224112
395 Ga0075434_100192993
396 Ga0075429_100484858
397 Ga0068865_100671250
398 Ga0097620_100057295
399 Ga0097620_101441471
400 Ga0075435_100138949
401 Ga0075435_100254393
402 Ga0075435_100827803
403 Ga0099795_10251343
404 Ga0105240_10031196
405 Ga0105240_10034099
406 Ga0105240_10158958
407 Ga0105240_10190983
408 Ga0105240_11270802
409 Ga0111539_10048128
410 Ga0111539_10161832
411 Ga0111539_10313840
412 Ga0111539_10525194
413 Ga0111539_11923603
414 Ga0111539_12096243
415 Ga0105245_10410117
416 Ga0105245_10472139
417 Ga0114129_10659409
418 Ga0105241_10061533
419 Ga0105242_10035039
420 Ga0105248_11141441
421 Ga0105248_11480839
422 Ga0105238_10007437
423 Ga0105238_10635787
424 Ga0105249_10422560
425 Ga0157370_10078826
426 Ga0157370_10102856
427 Ga0157374_10114108
428 Ga0157374_11655187
429 Ga0157378_10050551
430 Ga0163162_10256142
431 Ga0163162_10967641
432 Ga0157372_10906273
433 Ga0157372_11677130
434 Ga0157372_11992833
435 Ga0157375_10000021
436 Ga0157375_11218595
437 Ga0163163_10001288
438 Ga0163163_10076089
439 Ga0163163_10238135
440 Ga0157379_10420148
441 Ga0157379_11122636
442 Ga0157376_10768696
443 Ga0157376_11693369
444 Ga0207707_10411611
445 Ga0207707_10966430
446 Ga0207695_10016519
447 Ga0207695_10050903
448 Ga0207695_10083828
449 Ga0207695_10129759
450 Ga0207695_10923452
451 Ga0207663_10172245
452 Ga0207660_10412846
453 Ga0207652_10406472
454 Ga0207694_10008573
455 Ga0207694_10344946
456 Ga0207659_11168419
457 Ga0207687_10455018
458 Ga0207687_11257736
459 Ga0207700_11555094
460 Ga0207686_11211521
461 Ga0207670_10007712
462 Ga0207670_10103253
463 Ga0207670_10108705
464 Ga0207670_10294395
465 Ga0207711_10706376
466 Ga0207711_10903670
467 Ga0207689_10244647
468 Ga0207661_11015284
469 Ga0207667_10017689
470 Ga0207667_10050260
471 Ga0207712_10713539
472 Ga0207668_10503996
473 Ga0207639_10229078
474 Ga0207702_11748968
475 Ga0207641_10098296
476 Ga0207641_11031190
477 Ga0207648_10803219
478 Ga0207676_10278893
479 Ga0207676_10426252
480 Ga0207676_10494356
481 Ga0207674_10026642
482 Ga0207674_10790480
483 Ga0207674_10805663
484 Ga0207428_10762496
485 Ga0268265_10527840
486 Ga0268264_11689786
487 Ga0268264_12026494
488 Ga0265337_1014403
489 Ga0265326_10080172
490 Ga0265319_1119598
491 Ga0265334_10285711
492 Ga0265336_10119545
493 Ga0265338_10001925
494 Ga0265338_10010246
495 Ga0265338_10016666
496 Ga0265338_10050664
497 Ga0265338_10144433
498 Ga0265338_10221268
499 Ga0265338_10391558
500 Ga0265324_10027818
501 Ga0265324_10042305
502 Ga0307511_10270131
503 Ga0265332_10005792
504 Ga0265320_10032021
505 Ga0265320_10048747
506 Ga0265320_10136188
507 Ga0265320_10162555
508 Ga0265325_10028211
509 Ga0265325_10083012
510 Ga0265329_10001025
511 Ga0265339_10020097
512 Ga0265339_10061542
513 Ga0265339_10267020
514 Ga0265327_10038937
515 Ga0265316_10071522
516 Ga0265316_10230404
517 Ga0265314_10000584
518 Ga0265314_10029192
519 Ga0307412_11077209
520 Ga0373926_0031686
521 Ga0373923_0331207
522 Ga0373936_0271184
523 Ga0373954_0052125
524 Ga0373956_0174088
525 Ga0373943_0014063
526 Ga0373943_0027272
527 Ga0373946_0047697
528 Ga0373924_0336795
529 Ga0373931_0218819
530 Ga0373931_0270400
531 Ga0373935_0007890
532 Ga0373927_0746677
533 Ga0373927_0951499
534 Ga0373933_0367348
535 Ga0373947_0045964
536 Ga0373937_0160853
537 Ga0373937_0448659
538 Ga0373937_0605801
539 Ga0373925_0001486
540 Ga0373925_0158918
541 Ga0373925_1027280
542 Ga0395905_0276009
543 Ga0395901_0725414
544 Ga0451800_0183527
545 Ga0451804_0941179
546 Ga0451807_1999136
547 Ga0451845_0499797
548 Ga0451577_0011414
549 Ga0453684_0004340
550 Ga0453684_0017949
551 Ga0453684_0276680
552 Ga0453684_1636473
553 Ga0451576_0084956
554 Ga0451576_0190098
555 Ga0451576_0266473
556 Ga0451576_0540393
557 Ga0451576_0561402
558 Ga0451576_0561736
559 Ga0451576_0861139
560 Ga0451576_1132812
561 Ga0451576_1420825
562 Ga0451576_1612895
563 Ga0495592_0000081
564 Ga0495592_0530500
565 Ga0495629_0180254
566 Ga0495641_0006619
567 Ga0495582_0411122
568 Ga0495664_0286214
569 Ga0495618_0002728
570 Ga0495618_0335003
571 Ga0495618_0395334
572 Ga0495628_0001847
573 Ga0495628_1009269
574 Ga0495630_0000055
575 Ga0495630_0001608
576 Ga0495630_0013893
577 Ga0495630_0034605
578 Ga0495630_0504878
579 Ga0495666_0022495
580 Ga0495666_0035139
581 Ga0495666_0049288
582 Ga0495652_0124418
583 Ga0495652_0280331
584 Ga0495640_0130185
585 Ga0495640_0237535
586 Ga0495586_0000098
587 Ga0495586_0000604
588 Ga0495586_0000828
589 Ga0495586_0011577
590 Ga0495586_0125944
591 Ga0495586_0278236
592 Ga0495587_0398432
593 Ga0495645_0046436
594 Ga0495645_0828777
595 Ga0495667_0121830
596 Ga0495667_0249873
597 Ga0495634_0037252
598 Ga0495634_0174044
599 Ga0495599_0015368
600 Ga0495599_0199839
601 Ga0495646_0337692
602 Ga0495647_0017967
603 Ga0495658_0015639
604 Ga0495658_0074104
605 Ga0495613_0016724
606 Ga0495624_0069110
607 Ga0495581_0683839
608 Ga0495674_0002350
609 Ga0495674_0006991
610 Ga0495676_0009155
611 Ga0495680_0422450
612 Ga0495680_0466911
613 Ga0495675_0021099
614 Ga0495675_0194832
615 Ga0496107_0044717
616 Ga0496112_0176403
617 Ga0501299_115184
618 Ga0501034_0573452
619 Ga0501034_0667555
620 Ga0501039_0607075
621 Ga0501243_037924
622 Ga0501083_0566236
623 nmdc:mga05p37_758731_c1
624 nmdc:mga09592_668259_c1
625 nmdc:mga0qj67_1366843_c1
626 nmdc:mga06r32_12214_c1
627 nmdc:mga06r32_214203_c1
628 nmdc:mga08y16_1033952_c1
629 nmdc:mga08y16_468358_c1
630 nmdc:mga08y16_541390_c1
631 nmdc:mga08y16_797027_c1
632 nmdc:mga0rr50_258230_c1
633 nmdc:mga0rr50_370658_c1
634 nmdc:mga0rr50_825572_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00994

MoCF_biosynth

Probable molybdopterin binding domain

41

183

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
1uuy-assembly1.cif.gz_A structure of a molybdopterin-bound cnx1g domain links molybdenum and copper metabolism 0.9578 3 154
1ihc-assembly1.cif.gz_A x-ray structure of gephyrin n-terminal domain 0.9524 1 155
1o8q-assembly1.cif.gz_A the active site of the molybdenum cofactor biosenthetic protein domain cnx1g 0.9393 2 154
1eav-assembly2.cif.gz_E crystal structures of human gephyrin and plant cnx1 g domains - comparative analysis and functional implications 0.9372 2 152
2g4r-assembly1.cif.gz_B anomalous substructure of moga 0.9341 4 153
ID Description Score Start End Superfamily
af_Q8BUV3_1_191_3.40.980.10 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9674 2 154 3.40.980.10
af_P39205_1_179_3.40.980.10 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9302 2 153 3.40.980.10
2pjkA00 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9288 1 155 3.40.980.10
af_O53897_20_180_3.40.980.10 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9247 4 155 3.40.980.10
af_Q8BUV3_1_191_3.40.980.10 Alpha Beta;3-Layer(aba) Sandwich;Molybdenum Cofactor Biosythetic Enzyme; Chain A;MoaB/Mog-like domain 0.9205 2 154 3.40.980.10
ID Description Score Start End GO Terms
AF-A0A2V5KDY3-F1-model_v4 Molybdenum cofactor biosynthesis protein 0.9847 1 145 GO:0006777
AF-A0A3C0R1L6-F1-model_v4 Molybdenum cofactor biosynthesis protein 0.9786 1 125 GO:0006777
AF-A0A2V5KDY3-F1-model_v4 Molybdenum cofactor biosynthesis protein 0.978 1 145 GO:0006777
AF-A0A432FH18-F1-model_v4 Bifunctional molybdenum cofactor biosynthesis protein MoaC/MoaB 0.9765 3 120 GO:0006777
GO:0061799
AF-A0A3N5MH46-F1-model_v4 MogA/MoaB family molybdenum cofactor biosynthesis protein 0.9743 2 154 GO:0006777

Map