F403979

General Info

Members Datasets Scaffolds Average Seq Length
317 163 317 353

Family's Representative Sequence

Representative Sequence 3300003322|rootL2_10136828|rootL2_101368282
Length 385
Sequence MGRVRRGCAGAAFSYWKWVRPWLAKQPPPASGAELTVRILDVGPVNGDSILISSPAGKTVLIDAGDTTKGKAVVEALKRHNVQQIDYFIATHPHPDHIGGAAEVFKAFKVLNVIDNGQEPSIPPELLPAKPAAGASTKKSAAAKPTPTPKTTKQVASITKFYDDYKAGLSASGATYALAQPGTKYDLGGGALLTILAPSEPLFTKEKMKSGGNEPNANSIVARLDYGSFSMLLAADAEDQTEHRLLTKDLNLEASVLKVSHHGSKYASSGDFLKRVKPEIAIISCGAWNRYGHPAQAVLDRLRTANPALKLYRTDLNGEITLTTRGKQGDVAVKTTKETTEDLWVGRTAQKDDSSRSGFIAYGDFGPPPKPRKPPEANEQQSEQK

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
60 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
129 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
132 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
135 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
136 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
137 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
138 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
139 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
140 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
141 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
142 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
143 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
144 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
147 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
148 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
149 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
150 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
151 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
152 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
153 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
154 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
155 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
156 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
157 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
158 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
159 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
160 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
161 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
162 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
163 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.26
Rhizosphere 98.11
Stem 0
Stem Tuber 0
Unclassified 0.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_5455348 2162886012 Eukaryota 1802
2 JGI24748J21848_1000001 3300002074 Bacteria 444271
3 JGI24034J26672_10000001 3300002239 Bacteria 1118280
4 JGI24751J29686_10000013 3300002459 Bacteria 113565
5 JGI25406J46586_10004972 3300003203 Bacteria 6176
6 rootL2_10136828 3300003322 Bacteria 2335
7 Ga0065714_10002186 3300005288 Bacteria 191932
8 Ga0065704_10001172 3300005289 Bacteria 19999
9 Ga0065712_10000113 3300005290 Bacteria 191931
10 Ga0065715_10001857 3300005293 Bacteria 6337
11 Ga0065715_10089819 3300005293 Bacteria 8424
12 Ga0065715_10091399 3300005293 Bacteria 5822
13 Ga0065715_10093814 3300005293 Bacteria 4545
14 Ga0065715_10096557 3300005293 Unclassified 3855
15 Ga0065715_10103738 3300005293 Bacteria 3011
16 Ga0065707_10084507 3300005295 Bacteria 7130
17 Ga0065707_10090849 3300005295 Unclassified 4054
18 Ga0070670_100000129 3300005331 Bacteria 71325
19 Ga0070670_100020338 3300005331 Bacteria 5705
20 Ga0070680_100028184 3300005336 Bacteria 4504
21 Ga0070682_100004638 3300005337 Bacteria 7631
22 Ga0068868_100025435 3300005338 Bacteria 4503
23 Ga0068868_100066814 3300005338 Bacteria 2860
24 Ga0070689_100000520 3300005340 Bacteria 22774
25 Ga0070687_100059394 3300005343 Bacteria 2013
26 Ga0070692_10001914 3300005345 Bacteria 7859
27 Ga0070669_100008573 3300005353 Bacteria 7297
28 Ga0070671_100041069 3300005355 Bacteria 3843
29 Ga0070671_100369755 3300005355 Unclassified 1224
30 Ga0070674_100050257 3300005356 Unclassified 2870
31 Ga0070673_100046978 3300005364 Bacteria 3357
32 Ga0070659_100113486 3300005366 Unclassified 2189
33 Ga0070703_10007602 3300005406 Bacteria 3045
34 Ga0070701_10017669 3300005438 Bacteria 3338
35 Ga0070705_100037570 3300005440 Bacteria 2733
36 Ga0070700_100000070 3300005441 Bacteria 72718
37 Ga0070700_100006960 3300005441 Bacteria 6073
38 Ga0070700_100016391 3300005441 Unclassified 4221
39 Ga0070700_100022007 3300005441 Bacteria 3712
40 Ga0070694_100002932 3300005444 Bacteria 10142
41 Ga0070694_100017680 3300005444 Unclassified 4507
42 Ga0070678_100044985 3300005456 Bacteria 3156
43 Ga0070681_10002356 3300005458 Bacteria 17256
44 Ga0070681_10033900 3300005458 Bacteria 5127
45 Ga0070685_10008200 3300005466 Bacteria 5356
46 Ga0070706_100000019 3300005467 Bacteria 166483
47 Ga0070707_100095493 3300005468 Bacteria 2879
48 Ga0070698_100028354 3300005471 Bacteria 5816
49 Ga0070698_100113035 3300005471 Bacteria 2680
50 Ga0070699_100000762 3300005518 Bacteria 29755
51 Ga0070699_100089688 3300005518 Bacteria 2687
52 Ga0070699_100196446 3300005518 Bacteria 1793
53 Ga0070684_100264025 3300005535 Unclassified 1575
54 Ga0070697_100287450 3300005536 Bacteria 1412
55 Ga0068853_100351903 3300005539 Unclassified 1370
56 Ga0070686_100023684 3300005544 Bacteria 3673
57 Ga0070686_100088717 3300005544 Bacteria 2064
58 Ga0070686_100096035 3300005544 Bacteria 1992
59 Ga0070695_100067973 3300005545 Bacteria 2326
60 Ga0070695_100068817 3300005545 Bacteria 2313
61 Ga0070696_100004687 3300005546 Bacteria 9140
62 Ga0070696_100042979 3300005546 Bacteria 3125
63 Ga0070693_100001683 3300005547 Bacteria 10023
64 Ga0070693_100037618 3300005547 Unclassified 2700
65 Ga0070704_100010883 3300005549 Bacteria 5548
66 Ga0070704_100030530 3300005549 Bacteria 3612
67 Ga0068857_100153305 3300005577 Unclassified 2089
68 Ga0068854_100059918 3300005578 Unclassified 2752
69 Ga0068854_100066753 3300005578 Bacteria 2619
70 Ga0068854_100088391 3300005578 Bacteria 2301
71 Ga0070702_100011313 3300005615 Bacteria 4434
72 Ga0068859_100016509 3300005617 Bacteria 7413
73 Ga0068859_100028738 3300005617 Bacteria 5574
74 Ga0068859_100034120 3300005617 Bacteria 5108
75 Ga0068859_100037747 3300005617 Bacteria 4848
76 Ga0068859_100051793 3300005617 Bacteria 4127
77 Ga0068859_100052167 3300005617 Bacteria 4112
78 Ga0068859_100251025 3300005617 Unclassified 1860
79 Ga0068864_100058317 3300005618 Bacteria 3336
80 Ga0068864_100075656 3300005618 Bacteria 2940
81 Ga0068864_100363140 3300005618 Unclassified 1369
82 Ga0068866_10083686 3300005718 Bacteria 1720
83 Ga0068861_100001857 3300005719 Bacteria 13605
84 Ga0068861_100007069 3300005719 Bacteria 7677
85 Ga0068861_100067902 3300005719 Bacteria 2753
86 Ga0068861_100075090 3300005719 Bacteria 2631
87 Ga0068851_10009869 3300005834 Bacteria 4446
88 Ga0068870_10042189 3300005840 Bacteria 2374
89 Ga0068863_100007143 3300005841 Bacteria 10955
90 Ga0068863_100061358 3300005841 Unclassified 3554
91 Ga0068863_100107517 3300005841 Bacteria 2655
92 Ga0068863_100171084 3300005841 Bacteria 2084
93 Ga0068858_100000051 3300005842 Bacteria 120692
94 Ga0068858_100036252 3300005842 Bacteria 4573
95 Ga0068858_100051295 3300005842 Bacteria 3817
96 Ga0068858_100113965 3300005842 Bacteria 2525
97 Ga0068858_100336526 3300005842 Unclassified 1444
98 Ga0068860_100041122 3300005843 Bacteria 4416
99 Ga0068860_100072210 3300005843 Bacteria 3279
100 Ga0068860_100162199 3300005843 Bacteria 2156
101 Ga0068862_100008314 3300005844 Bacteria 8587
102 Ga0068862_100036527 3300005844 Unclassified 4164
103 Ga0081539_10000591 3300005985 Bacteria 74056
104 Ga0081539_10000783 3300005985 Bacteria 61928
105 Ga0081539_10001629 3300005985 Bacteria 36707
106 Ga0070716_100000003 3300006173 Bacteria 312721
107 Ga0068871_100002005 3300006358 Bacteria 13780
108 Ga0068871_100012719 3300006358 Bacteria 6222
109 Ga0068871_100037902 3300006358 Bacteria 3847
110 Ga0075430_100145972 3300006846 Bacteria 1970
111 Ga0075434_100195297 3300006871 Bacteria 2044
112 Ga0075429_100008602 3300006880 Bacteria 8878
113 Ga0075429_100046987 3300006880 Bacteria 3756
114 Ga0068865_100035398 3300006881 Bacteria 3357
115 Ga0075436_100000002 3300006914 Bacteria 475522
116 Ga0097620_100016508 3300006931 Bacteria 7413
117 Ga0097620_100028740 3300006931 Bacteria 5574
118 Ga0097620_100034120 3300006931 Bacteria 5108
119 Ga0097620_100037750 3300006931 Bacteria 4848
120 Ga0097620_100051793 3300006931 Bacteria 4127
121 Ga0097620_100052166 3300006931 Bacteria 4112
122 Ga0097620_100251027 3300006931 Unclassified 1860
123 Ga0075435_100005602 3300007076 Bacteria 8793
124 Ga0105240_10069981 3300009093 Bacteria 4342
125 Ga0111539_10000931 3300009094 Bacteria 38341
126 Ga0111539_10014870 3300009094 Bacteria 9704
127 Ga0111539_10017779 3300009094 Bacteria 8802
128 Ga0111539_10033381 3300009094 Bacteria 6248
129 Ga0111539_10136688 3300009094 Bacteria 2870
130 Ga0111539_10254140 3300009094 Unclassified 2046
131 Ga0111539_10484543 3300009094 Unclassified 1440
132 Ga0105245_10088382 3300009098 Bacteria 2846
133 Ga0105247_10000004 3300009101 Bacteria 455497
134 Ga0105247_10003850 3300009101 Bacteria 9715
135 Ga0105247_10249790 3300009101 Bacteria 1212
136 Ga0114129_10007505 3300009147 Bacteria 15532
137 Ga0114129_10057619 3300009147 Bacteria 5435
138 Ga0114129_10191362 3300009147 Unclassified 2778
139 Ga0114129_10266822 3300009147 Bacteria 2292
140 Ga0114129_10860532 3300009147 Bacteria 1152
141 Ga0105243_10000446 3300009148 Bacteria 43049
142 Ga0105243_10009923 3300009148 Bacteria 7240
143 Ga0105243_10010652 3300009148 Bacteria 6973
144 Ga0105243_10058734 3300009148 Bacteria 3066
145 Ga0105243_10143334 3300009148 Bacteria 2041
146 Ga0105241_10103802 3300009174 Bacteria 2264
147 Ga0105242_10001013 3300009176 Bacteria 22070
148 Ga0105242_10023838 3300009176 Bacteria 4827
149 Ga0105242_10130043 3300009176 Bacteria 2172
150 Ga0105242_10397992 3300009176 Bacteria 1284
151 Ga0105248_10026997 3300009177 Bacteria 6387
152 Ga0105248_10119195 3300009177 Unclassified 2977
153 Ga0105248_10148578 3300009177 Bacteria 2644
154 Ga0105248_10201093 3300009177 Unclassified 2245
155 Ga0105237_10002452 3300009545 Bacteria 23028
156 Ga0105237_10067407 3300009545 Bacteria 3572
157 Ga0105238_10005750 3300009551 Bacteria 12267
158 Ga0105249_10014951 3300009553 Bacteria 6863
159 Ga0105249_10033755 3300009553 Bacteria 4634
160 Ga0105249_10084616 3300009553 Bacteria 2954
161 Ga0105249_10395635 3300009553 Bacteria 1411
162 Ga0105239_10043633 3300010375 Bacteria 4917
163 Ga0105239_10228706 3300010375 Bacteria 2087
164 Ga0105246_10077021 3300011119 Bacteria 2364
165 Ga0105246_10082510 3300011119 Bacteria 2294
166 Ga0157378_10000004 3300013297 Bacteria 201051
167 Ga0157378_10019632 3300013297 Bacteria 5941
168 Ga0163162_10000506 3300013306 Bacteria 36273
169 Ga0163162_10010975 3300013306 Bacteria 8821
170 Ga0163162_10031016 3300013306 Bacteria 5300
171 Ga0163162_10050220 3300013306 Bacteria 4183
172 Ga0163162_10091538 3300013306 Bacteria 3124
173 Ga0163162_10104275 3300013306 Bacteria 2930
174 Ga0163162_10153101 3300013306 Bacteria 2424
175 Ga0157372_10003813 3300013307 Bacteria 16192
176 Ga0157372_10376031 3300013307 Bacteria 1655
177 Ga0157375_10000479 3300013308 Bacteria 36426
178 Ga0157375_10029800 3300013308 Bacteria 5137
179 Ga0157375_10086202 3300013308 Unclassified 3191
180 Ga0157375_10168541 3300013308 Bacteria 2336
181 Ga0163163_10002475 3300014325 Bacteria 15620
182 Ga0163163_10002674 3300014325 Bacteria 15066
183 Ga0163163_10027017 3300014325 Bacteria 5493
184 Ga0163163_10132607 3300014325 Bacteria 2532
185 Ga0163163_10277760 3300014325 Bacteria 1726
186 Ga0163163_10335310 3300014325 Bacteria 1567
187 Ga0157380_10001144 3300014326 Bacteria 17148
188 Ga0157380_10001887 3300014326 Bacteria 13902
189 Ga0157380_10157022 3300014326 Unclassified 1973
190 Ga0157380_10339214 3300014326 Unclassified 1401
191 Ga0157377_10022973 3300014745 Bacteria 3300
192 Ga0157379_10069966 3300014968 Bacteria 3139
193 Ga0157379_10071489 3300014968 Bacteria 3104
194 Ga0157376_10164972 3300014969 Bacteria 2012
195 Ga0157376_10211444 3300014969 Bacteria 1791
196 Ga0163161_10103091 3300017792 Bacteria 2126
197 Ga0207672_1000002 3300025223 Bacteria 31879
198 Ga0207697_10034767 3300025315 Unclassified 2063
199 Ga0207653_10006203 3300025885 Bacteria 3726
200 Ga0207710_10000002 3300025900 Bacteria 1251998
201 Ga0207710_10001678 3300025900 Bacteria 10757
202 Ga0207643_10001513 3300025908 Bacteria 13273
203 Ga0207643_10030347 3300025908 Bacteria 3008
204 Ga0207643_10055215 3300025908 Bacteria 2259
205 Ga0207684_10000079 3300025910 Bacteria 179842
206 Ga0207684_10215320 3300025910 Bacteria 1657
207 Ga0207671_10058170 3300025914 Bacteria 2866
208 Ga0207662_10006894 3300025918 Bacteria 6158
209 Ga0207662_10041469 3300025918 Bacteria 2710
210 Ga0207662_10081291 3300025918 Bacteria 1978
211 Ga0207646_10115786 3300025922 Unclassified 2408
212 Ga0207681_10004509 3300025923 Bacteria 8578
213 Ga0207694_10029123 3300025924 Bacteria 4212
214 Ga0207650_10000001 3300025925 Bacteria 1545726
215 Ga0207687_10074109 3300025927 Bacteria 2439
216 Ga0207644_10000179 3300025931 Bacteria 45397
217 Ga0207644_10134998 3300025931 Unclassified 1893
218 Ga0207686_10014087 3300025934 Unclassified 4442
219 Ga0207686_10189973 3300025934 Bacteria 1463
220 Ga0207709_10003560 3300025935 Bacteria 9208
221 Ga0207709_10009517 3300025935 Bacteria 5347
222 Ga0207709_10116161 3300025935 Bacteria 1799
223 Ga0207670_10016298 3300025936 Bacteria 4463
224 Ga0207670_10145771 3300025936 Bacteria 1751
225 Ga0207665_10041950 3300025939 Bacteria 3057
226 Ga0207691_10000845 3300025940 Bacteria 30493
227 Ga0207711_10037324 3300025941 Bacteria 4126
228 Ga0207711_10065871 3300025941 Bacteria 3132
229 Ga0207689_10001578 3300025942 Bacteria 21602
230 Ga0207689_10091052 3300025942 Bacteria 2506
231 Ga0207679_10325957 3300025945 Bacteria 1331
232 Ga0207651_10014969 3300025960 Bacteria 4494
233 Ga0207651_10031905 3300025960 Bacteria 3375
234 Ga0207651_10062112 3300025960 Bacteria 2602
235 Ga0207712_10012801 3300025961 Bacteria 5365
236 Ga0207712_10102920 3300025961 Bacteria 2127
237 Ga0207640_10028801 3300025981 Bacteria 3401
238 Ga0207677_10084147 3300026023 Bacteria 2292
239 Ga0207703_10000114 3300026035 Bacteria 96051
240 Ga0207703_10022832 3300026035 Bacteria 4914
241 Ga0207703_10137661 3300026035 Bacteria 2116
242 Ga0207703_10305696 3300026035 Unclassified 1452
243 Ga0207639_10014244 3300026041 Bacteria 5586
244 Ga0207708_10000094 3300026075 Bacteria 67925
245 Ga0207708_10001910 3300026075 Bacteria 15394
246 Ga0207708_10005226 3300026075 Bacteria 9567
247 Ga0207708_10015991 3300026075 Bacteria 5634
248 Ga0207708_10028395 3300026075 Unclassified 4237
249 Ga0207708_10148217 3300026075 Bacteria 1845
250 Ga0207641_10079532 3300026088 Bacteria 2842
251 Ga0207641_10089631 3300026088 Bacteria 2688
252 Ga0207641_10090201 3300026088 Bacteria 2680
253 Ga0207648_10009944 3300026089 Bacteria 9064
254 Ga0207648_10063691 3300026089 Unclassified 3213
255 Ga0207676_10013972 3300026095 Bacteria 5763
256 Ga0207674_10250856 3300026116 Bacteria 1717
257 Ga0207674_10260330 3300026116 Unclassified 1682
258 Ga0207674_10270047 3300026116 Bacteria 1648
259 Ga0207675_100024330 3300026118 Bacteria 5632
260 Ga0207675_100037657 3300026118 Bacteria 4512
261 Ga0207675_100051953 3300026118 Unclassified 3825
262 Ga0207675_100219909 3300026118 Bacteria 1830
263 Ga0207675_100254964 3300026118 Unclassified 1699
264 Ga0207683_10044630 3300026121 Unclassified 3875
265 Ga0207428_10000547 3300027907 Bacteria 44826
266 Ga0207428_10001780 3300027907 Bacteria 22062
267 Ga0268264_10161839 3300028381 Unclassified 2017
268 Ga0268264_10208800 3300028381 Bacteria 1791
269 Ga0314311_1181996 3300030733 Bacteria 1892
270 Ga0307513_10008218 3300031456 Bacteria 13384
271 Ga0307408_100260499 3300031548 Bacteria 1435
272 Ga0307410_10010577 3300031852 Bacteria 5234
273 Ga0307406_10003651 3300031901 Bacteria 8381
274 Ga0307406_10088441 3300031901 Bacteria 2079
275 Ga0307416_100008990 3300032002 Bacteria 6499
276 Ga0373940_0038189 3300035088 Bacteria 1310
277 Ga0373951_0008791 3300035091 Bacteria 2277
278 Ga0242420_002616 3300038996 Unclassified 2588
279 Ga0439458_0001329 3300042157 Bacteria 6241
280 Ga0439434_0002352 3300042435 Bacteria 5499
281 Ga0453683_0094328 3300044673 Bacteria 1877
282 Ga0453684_0358317 3300044712 Unclassified 1643
283 Ga0451576_0095940 3300045051 Unclassified 3084
284 Ga0495632_0013462 3300046519 Bacteria 4668
285 Ga0496106_0001061 3300048909 Bacteria 20265
286 Ga0496106_0106509 3300048909 Bacteria 2179
287 Ga0496108_0107384 3300048911 Bacteria 2384
288 Ga0496112_0396489 3300048915 Unclassified 1320
289 Ga0501298_000232 3300049521 Bacteria 7190
290 Ga0501299_001477 3300049522 Bacteria 3041
291 Ga0501038_0014682 3300049574 Bacteria 7135
292 Ga0501048_0147024 3300049582 Bacteria 1667
293 Ga0501202_004671 3300049652 Unclassified 2401
294 Ga0501202_019439 3300049652 Bacteria 1342
295 Ga0501217_001739 3300049661 Bacteria 4158
296 Ga0501217_001950 3300049661 Bacteria 3966
297 Ga0501217_012997 3300049661 Bacteria 1863
298 Ga0501223_010731 3300049663 Bacteria 1841
299 Ga0501227_002440 3300049665 Bacteria 4104
300 Ga0501225_0006504 3300049705 Bacteria 3412
301 Ga0501225_0015285 3300049705 Bacteria 2139
302 Ga0501245_002848 3300049708 Bacteria 2328
303 nmdc:mga05p37_15372_c1 3300050507 Bacteria 9195
304 nmdc:mga05p37_200818_c1 3300050507 Bacteria 2415
305 nmdc:mga05p37_52012_c1 3300050507 Bacteria 5037
306 nmdc:mga05p37_610577_c1 3300050507 Unclassified 1229
307 nmdc:mga05p37_7696_c1 3300050507 Bacteria 12714
308 nmdc:mga09592_46698_c1 3300050508 Bacteria 3648
309 nmdc:mga08y16_177868_c1 3300050511 Unclassified 2210
310 nmdc:mga08y16_246218_c1 3300050511 Bacteria 1847
311 nmdc:mga08y16_5249_c1 3300050511 Bacteria 13531
312 nmdc:mga0n895_267263_c1 3300050512 Bacteria 1735
313 nmdc:mga0rr50_3767_c1 3300050513 Bacteria 8793
314 nmdc:mga08x19_9_c1 3300050514 Bacteria 418852
315 nmdc:mga0a205_111644_c1 3300050515 Bacteria 2633
316 nmdc:mga0a205_33665_c1 3300050515 Bacteria 4913
317 Ga0530510_0058033 3300061734 Bacteria 2798

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005841 Ga0068863_100061358 Ga0068863_1000613582 289
2 3300025908 Ga0207643_10030347 Ga0207643_100303472 289
3 3300025939 Ga0207665_10041950 Ga0207665_100419504 292
4 3300009147 Ga0114129_10860532 Ga0114129_108605322 293
5 3300009147 Ga0114129_10007505 Ga0114129_100075053 295
6 3300050507 nmdc:mga05p37_15372_c1 nmdc:mga05p37_15372_c1_1234_2184 295
7 3300046519 Ga0495632_0013462 Ga0495632_0013462_2307_3455 311
8 3300031456 Ga0307513_10008218 Ga0307513_100082187 312
9 3300049705 Ga0501225_0006504 Ga0501225_0006504_2384_3400 313
10 3300005843 Ga0068860_100162199 Ga0068860_1001621992 314
11 3300009545 Ga0105237_10067407 Ga0105237_100674073 314
12 3300025914 Ga0207671_10058170 Ga0207671_100581702 314
13 3300025960 Ga0207651_10062112 Ga0207651_100621122 314
14 3300049661 Ga0501217_012997 Ga0501217_012997_359_1405 315
15 3300049652 Ga0501202_019439 Ga0501202_019439_177_1253 316
16 3300005985 Ga0081539_10001629 Ga0081539_1000162910 320
17 3300013308 Ga0157375_10168541 Ga0157375_101685412 321
18 3300006914 Ga0075436_100000002 Ga0075436_100000002226 322
19 3300007076 Ga0075435_100005602 Ga0075435_1000056028 322
20 3300014325 Ga0163163_10277760 Ga0163163_102777602 322
21 3300005355 Ga0070671_100369755 Ga0070671_1003697551 323
22 3300005467 Ga0070706_100000019 Ga0070706_10000001983 323
23 3300009148 Ga0105243_10058734 Ga0105243_100587342 323
24 3300009148 Ga0105243_10143334 Ga0105243_101433342 323
25 3300006846 Ga0075430_100145972 Ga0075430_1001459722 324
26 3300002074 JGI24748J21848_1000001 JGI24748J21848_1000001338 326
27 3300002239 JGI24034J26672_10000001 JGI24034J26672_1000000179 326
28 3300031548 Ga0307408_100260499 Ga0307408_1002604991 326
29 3300005293 Ga0065715_10103738 Ga0065715_101037383 327
30 3300005366 Ga0070659_100113486 Ga0070659_1001134863 327
31 3300005438 Ga0070701_10017669 Ga0070701_100176692 327
32 3300009101 Ga0105247_10003850 Ga0105247_100038503 327
33 3300009147 Ga0114129_10057619 Ga0114129_100576193 327
34 3300025900 Ga0207710_10001678 Ga0207710_100016787 327
35 3300025945 Ga0207679_10325957 Ga0207679_103259571 327
36 3300031901 Ga0307406_10088441 Ga0307406_100884412 327
37 3300049661 Ga0501217_001739 Ga0501217_001739_3043_4119 327
38 3300050507 nmdc:mga05p37_52012_c1 nmdc:mga05p37_52012_c1_3161_4282 327
39 3300050513 nmdc:mga0rr50_3767_c1 nmdc:mga0rr50_3767_c1_4775_5926 327
40 3300050514 nmdc:mga08x19_9_c1 nmdc:mga08x19_9_c1_154201_155352 327
41 3300002459 JGI24751J29686_10000013 JGI24751J29686_1000001336 328
42 3300006880 Ga0075429_100046987 Ga0075429_1000469872 328
43 3300009147 Ga0114129_10191362 Ga0114129_101913622 328
44 3300013306 Ga0163162_10031016 Ga0163162_100310165 328
45 3300014325 Ga0163163_10002475 Ga0163163_1000247511 328
46 3300014325 Ga0163163_10002674 Ga0163163_100026748 328
47 3300025910 Ga0207684_10000079 Ga0207684_10000079148 328
48 3300025924 Ga0207694_10029123 Ga0207694_100291232 328
49 3300025931 Ga0207644_10134998 Ga0207644_101349982 328
50 3300049582 Ga0501048_0147024 Ga0501048_0147024_144_1265 328
51 3300050507 nmdc:mga05p37_610577_c1 nmdc:mga05p37_610577_c1_29_1159 328
52 3300061734 Ga0530510_0058033 Ga0530510_0058033_554_1702 328
53 3300005518 Ga0070699_100000762 Ga0070699_1000007629 329
54 3300005985 Ga0081539_10000591 Ga0081539_1000059136 329
55 3300026035 Ga0207703_10137661 Ga0207703_101376611 329
56 3300009147 Ga0114129_10266822 Ga0114129_102668223 330
57 3300014326 Ga0157380_10001887 Ga0157380_100018876 330
58 3300014326 Ga0157380_10339214 Ga0157380_103392141 330
59 3300014968 Ga0157379_10069966 Ga0157379_100699663 330
60 3300026116 Ga0207674_10250856 Ga0207674_102508561 330
61 3300049574 Ga0501038_0014682 Ga0501038_0014682_1538_2605 330
62 3300050507 nmdc:mga05p37_200818_c1 nmdc:mga05p37_200818_c1_200_1255 330
63 3300005549 Ga0070704_100030530 Ga0070704_1000305302 331
64 3300005842 Ga0068858_100000051 Ga0068858_10000005132 331
65 3300005842 Ga0068858_100336526 Ga0068858_1003365262 331
66 3300009101 Ga0105247_10000004 Ga0105247_10000004124 331
67 3300009148 Ga0105243_10000446 Ga0105243_100004466 331
68 3300009176 Ga0105242_10001013 Ga0105242_1000101316 331
69 3300009176 Ga0105242_10397992 Ga0105242_103979921 331
70 3300013297 Ga0157378_10000004 Ga0157378_10000004106 331
71 3300013308 Ga0157375_10000479 Ga0157375_1000047917 331
72 3300025223 Ga0207672_1000002 Ga0207672_10000028 331
73 3300025900 Ga0207710_10000002 Ga0207710_10000002890 331
74 3300025931 Ga0207644_10000179 Ga0207644_1000017929 331
75 3300025934 Ga0207686_10014087 Ga0207686_100140874 331
76 3300025935 Ga0207709_10003560 Ga0207709_100035606 331
77 3300026035 Ga0207703_10000114 Ga0207703_1000011440 331
78 3300026035 Ga0207703_10305696 Ga0207703_103056963 331
79 3300048909 Ga0496106_0001061 Ga0496106_0001061_10926_12065 331
80 3300003203 JGI25406J46586_10004972 JGI25406J46586_100049726 332
81 3300005441 Ga0070700_100000070 Ga0070700_1000000709 332
82 3300005545 Ga0070695_100067973 Ga0070695_1000679732 332
83 3300009553 Ga0105249_10084616 Ga0105249_100846163 332
84 3300014325 Ga0163163_10335310 Ga0163163_103353102 332
85 3300025961 Ga0207712_10012801 Ga0207712_100128016 332
86 3300026075 Ga0207708_10000094 Ga0207708_1000009411 332
87 3300026118 Ga0207675_100037657 Ga0207675_1000376571 332
88 3300005331 Ga0070670_100000129 Ga0070670_10000012917 333
89 3300005617 Ga0068859_100051793 Ga0068859_1000517933 333
90 3300006931 Ga0097620_100051793 Ga0097620_1000517933 333
91 3300025925 Ga0207650_10000001 Ga0207650_1000000185 333
92 3300044673 Ga0453683_0094328 Ga0453683_0094328_170_1327 333
93 3300044712 Ga0453684_0358317 Ga0453684_0358317_146_1303 333
94 3300045051 Ga0451576_0095940 Ga0451576_0095940_1710_2867 333
95 3300048909 Ga0496106_0106509 Ga0496106_0106509_456_1541 333
96 3300005295 Ga0065707_10084507 Ga0065707_100845077 334
97 3300005458 Ga0070681_10033900 Ga0070681_100339005 334
98 3300005578 Ga0068854_100088391 Ga0068854_1000883912 334
99 3300005617 Ga0068859_100028738 Ga0068859_1000287385 334
100 3300005618 Ga0068864_100363140 Ga0068864_1003631401 334
101 3300005840 Ga0068870_10042189 Ga0068870_100421892 334
102 3300005844 Ga0068862_100008314 Ga0068862_1000083147 334
103 3300006880 Ga0075429_100008602 Ga0075429_1000086026 334
104 3300006931 Ga0097620_100028740 Ga0097620_1000287405 334
105 3300009094 Ga0111539_10017779 Ga0111539_100177792 334
106 3300009177 Ga0105248_10026997 Ga0105248_100269975 334
107 3300009553 Ga0105249_10395635 Ga0105249_103956351 334
108 3300013306 Ga0163162_10000506 Ga0163162_100005066 334
109 3300014968 Ga0157379_10071489 Ga0157379_100714892 334
110 3300025981 Ga0207640_10028801 Ga0207640_100288013 334
111 3300027907 Ga0207428_10001780 Ga0207428_100017806 334
112 3300035088 Ga0373940_0038189 Ga0373940_0038189_155_1297 334
113 3300050507 nmdc:mga05p37_7696_c1 nmdc:mga05p37_7696_c1_211_1356 334
114 3300050508 nmdc:mga09592_46698_c1 nmdc:mga09592_46698_c1_18_1178 334
115 3300050511 nmdc:mga08y16_177868_c1 nmdc:mga08y16_177868_c1_533_1693 334
116 3300050512 nmdc:mga0n895_267263_c1 nmdc:mga0n895_267263_c1_458_1570 334
117 3300050515 nmdc:mga0a205_33665_c1 nmdc:mga0a205_33665_c1_3076_4188 334
118 3300005617 Ga0068859_100034120 Ga0068859_1000341206 335
119 3300005841 Ga0068863_100007143 Ga0068863_1000071435 335
120 3300006173 Ga0070716_100000003 Ga0070716_10000000339 335
121 3300006931 Ga0097620_100034120 Ga0097620_1000341206 335
122 3300009098 Ga0105245_10088382 Ga0105245_100883822 335
123 3300009177 Ga0105248_10148578 Ga0105248_101485782 335
124 3300009553 Ga0105249_10033755 Ga0105249_100337554 335
125 3300010375 Ga0105239_10043633 Ga0105239_100436334 335
126 3300013306 Ga0163162_10010975 Ga0163162_100109752 335
127 3300013306 Ga0163162_10153101 Ga0163162_101531012 335
128 3300026075 Ga0207708_10001910 Ga0207708_100019107 335
129 3300026116 Ga0207674_10270047 Ga0207674_102700472 335
130 3300026118 Ga0207675_100024330 Ga0207675_1000243304 335
131 3300038996 Ga0242420_002616 Ga0242420_002616_1308_2456 335
132 3300005444 Ga0070694_100002932 Ga0070694_1000029328 336
133 3300005468 Ga0070707_100095493 Ga0070707_1000954933 336
134 3300005471 Ga0070698_100113035 Ga0070698_1001130352 336
135 3300005518 Ga0070699_100089688 Ga0070699_1000896883 336
136 3300005545 Ga0070695_100068817 Ga0070695_1000688173 336
137 3300005546 Ga0070696_100004687 Ga0070696_1000046878 336
138 3300005547 Ga0070693_100037618 Ga0070693_1000376183 336
139 3300005719 Ga0068861_100001857 Ga0068861_10000185711 336
140 3300005843 Ga0068860_100072210 Ga0068860_1000722102 336
141 3300009176 Ga0105242_10130043 Ga0105242_101300432 336
142 3300025918 Ga0207662_10081291 Ga0207662_100812912 336
143 3300025922 Ga0207646_10115786 Ga0207646_101157862 336
144 3300025935 Ga0207709_10116161 Ga0207709_101161612 336
145 3300048911 Ga0496108_0107384 Ga0496108_0107384_451_1581 336
146 3300050515 nmdc:mga0a205_111644_c1 nmdc:mga0a205_111644_c1_1496_2590 336
147 3300005336 Ga0070680_100028184 Ga0070680_1000281842 337
148 3300005364 Ga0070673_100046978 Ga0070673_1000469782 337
149 3300005441 Ga0070700_100016391 Ga0070700_1000163913 337
150 3300005546 Ga0070696_100042979 Ga0070696_1000429792 337
151 3300005617 Ga0068859_100016509 Ga0068859_1000165095 337
152 3300005618 Ga0068864_100075656 Ga0068864_1000756562 337
153 3300006871 Ga0075434_100195297 Ga0075434_1001952972 337
154 3300006931 Ga0097620_100016508 Ga0097620_1000165085 337
155 3300009094 Ga0111539_10000931 Ga0111539_1000093111 337
156 3300009101 Ga0105247_10249790 Ga0105247_102497901 337
157 3300009148 Ga0105243_10009923 Ga0105243_100099237 337
158 3300009148 Ga0105243_10010652 Ga0105243_100106526 337
159 3300009176 Ga0105242_10023838 Ga0105242_100238383 337
160 3300010375 Ga0105239_10228706 Ga0105239_102287062 337
161 3300011119 Ga0105246_10077021 Ga0105246_100770212 337
162 3300013307 Ga0157372_10376031 Ga0157372_103760312 337
163 3300013308 Ga0157375_10029800 Ga0157375_100298002 337
164 3300014745 Ga0157377_10022973 Ga0157377_100229732 337
165 3300014969 Ga0157376_10211444 Ga0157376_102114442 337
166 3300025908 Ga0207643_10001513 Ga0207643_100015139 337
167 3300025934 Ga0207686_10189973 Ga0207686_101899731 337
168 3300025935 Ga0207709_10009517 Ga0207709_100095175 337
169 3300025960 Ga0207651_10014969 Ga0207651_100149694 337
170 3300026075 Ga0207708_10028395 Ga0207708_100283954 337
171 3300026089 Ga0207648_10063691 Ga0207648_100636912 337
172 3300026118 Ga0207675_100254964 Ga0207675_1002549642 337
173 3300035091 Ga0373951_0008791 Ga0373951_0008791_173_1288 337
174 3300050511 nmdc:mga08y16_246218_c1 nmdc:mga08y16_246218_c1_91_1206 337
175 3300050511 nmdc:mga08y16_5249_c1 nmdc:mga08y16_5249_c1_10108_11223 337
176 3300005343 Ga0070687_100059394 Ga0070687_1000593942 338
177 3300005406 Ga0070703_10007602 Ga0070703_100076022 338
178 3300005441 Ga0070700_100022007 Ga0070700_1000220074 338
179 3300005549 Ga0070704_100010883 Ga0070704_1000108835 338
180 3300005615 Ga0070702_100011313 Ga0070702_1000113133 338
181 3300005617 Ga0068859_100052167 Ga0068859_1000521675 338
182 3300005834 Ga0068851_10009869 Ga0068851_100098693 338
183 3300005842 Ga0068858_100036252 Ga0068858_1000362522 338
184 3300006881 Ga0068865_100035398 Ga0068865_1000353982 338
185 3300006931 Ga0097620_100052166 Ga0097620_1000521665 338
186 3300009545 Ga0105237_10002452 Ga0105237_1000245217 338
187 3300025885 Ga0207653_10006203 Ga0207653_100062033 338
188 3300025910 Ga0207684_10215320 Ga0207684_102153201 338
189 3300025942 Ga0207689_10091052 Ga0207689_100910521 338
190 3300026023 Ga0207677_10084147 Ga0207677_100841471 338
191 3300026118 Ga0207675_100219909 Ga0207675_1002199092 338
192 3300042157 Ga0439458_0001329 Ga0439458_0001329_4395_5555 338
193 3300049705 Ga0501225_0015285 Ga0501225_0015285_737_1888 338
194 3300005293 Ga0065715_10093814 Ga0065715_100938142 339
195 3300005337 Ga0070682_100004638 Ga0070682_1000046387 339
196 3300005544 Ga0070686_100023684 Ga0070686_1000236842 339
197 3300005841 Ga0068863_100171084 Ga0068863_1001710843 339
198 3300006358 Ga0068871_100037902 Ga0068871_1000379022 339
199 3300009094 Ga0111539_10014870 Ga0111539_100148705 339
200 3300013297 Ga0157378_10019632 Ga0157378_100196325 339
201 3300013306 Ga0163162_10091538 Ga0163162_100915383 339
202 3300014325 Ga0163163_10027017 Ga0163163_100270173 339
203 3300014969 Ga0157376_10164972 Ga0157376_101649722 339
204 3300025918 Ga0207662_10041469 Ga0207662_100414692 339
205 3300005293 Ga0065715_10089819 Ga0065715_100898197 340
206 3300005331 Ga0070670_100020338 Ga0070670_1000203385 340
207 3300005340 Ga0070689_100000520 Ga0070689_1000005202 340
208 3300005458 Ga0070681_10002356 Ga0070681_1000235610 340
209 3300005539 Ga0068853_100351903 Ga0068853_1003519031 340
210 3300005617 Ga0068859_100037747 Ga0068859_1000377473 340
211 3300005617 Ga0068859_100251025 Ga0068859_1002510252 340
212 3300006931 Ga0097620_100037750 Ga0097620_1000377503 340
213 3300006931 Ga0097620_100251027 Ga0097620_1002510272 340
214 3300009551 Ga0105238_10005750 Ga0105238_100057504 340
215 3300011119 Ga0105246_10082510 Ga0105246_100825103 340
216 3300014325 Ga0163163_10132607 Ga0163163_101326073 340
217 3300025936 Ga0207670_10016298 Ga0207670_100162981 340
218 3300025941 Ga0207711_10065871 Ga0207711_100658712 340
219 3300026041 Ga0207639_10014244 Ga0207639_100142442 340
220 3300026075 Ga0207708_10148217 Ga0207708_101482171 340
221 3300026088 Ga0207641_10089631 Ga0207641_100896312 340
222 3300049521 Ga0501298_000232 Ga0501298_000232_5211_6335 340
223 3300049522 Ga0501299_001477 Ga0501299_001477_947_2071 340
224 3300049708 Ga0501245_002848 Ga0501245_002848_429_1553 340
225 3300005293 Ga0065715_10096557 Ga0065715_100965574 341
226 3300005345 Ga0070692_10001914 Ga0070692_100019142 341
227 3300005440 Ga0070705_100037570 Ga0070705_1000375703 341
228 3300005471 Ga0070698_100028354 Ga0070698_1000283545 341
229 3300005518 Ga0070699_100196446 Ga0070699_1001964461 341
230 3300005547 Ga0070693_100001683 Ga0070693_1000016835 341
231 3300005577 Ga0068857_100153305 Ga0068857_1001533052 341
232 3300005618 Ga0068864_100058317 Ga0068864_1000583172 341
233 3300005841 Ga0068863_100107517 Ga0068863_1001075172 341
234 3300005843 Ga0068860_100041122 Ga0068860_1000411225 341
235 3300006358 Ga0068871_100002005 Ga0068871_1000020059 341
236 3300009093 Ga0105240_10069981 Ga0105240_100699814 341
237 3300009094 Ga0111539_10033381 Ga0111539_100333812 341
238 3300009174 Ga0105241_10103802 Ga0105241_101038022 341
239 3300009177 Ga0105248_10201093 Ga0105248_102010933 341
240 3300013307 Ga0157372_10003813 Ga0157372_100038136 341
241 3300025936 Ga0207670_10145771 Ga0207670_101457712 341
242 3300026075 Ga0207708_10015991 Ga0207708_100159916 341
243 3300026088 Ga0207641_10079532 Ga0207641_100795322 341
244 3300026088 Ga0207641_10090201 Ga0207641_100902012 341
245 3300026116 Ga0207674_10260330 Ga0207674_102603302 341
246 3300028381 Ga0268264_10208800 Ga0268264_102088002 341
247 3300030733 Ga0314311_1181996 Ga0314311_11819962 341
248 3300031852 Ga0307410_10010577 Ga0307410_100105773 341
249 3300031901 Ga0307406_10003651 Ga0307406_100036515 341
250 3300032002 Ga0307416_100008990 Ga0307416_1000089906 341
251 3300042435 Ga0439434_0002352 Ga0439434_0002352_2205_3347 341
252 3300048915 Ga0496112_0396489 Ga0496112_0396489_142_1281 341
253 3300049652 Ga0501202_004671 Ga0501202_004671_839_1978 341
254 3300049661 Ga0501217_001950 Ga0501217_001950_1304_2419 341
255 3300049663 Ga0501223_010731 Ga0501223_010731_436_1551 341
256 3300049665 Ga0501227_002440 Ga0501227_002440_42_1181 341
257 3300005288 Ga0065714_10002186 Ga0065714_1000218692 342
258 3300005289 Ga0065704_10001172 Ga0065704_100011726 342
259 3300005290 Ga0065712_10000113 Ga0065712_1000011392 342
260 3300005293 Ga0065715_10091399 Ga0065715_100913995 342
261 3300005338 Ga0068868_100025435 Ga0068868_1000254354 342
262 3300005355 Ga0070671_100041069 Ga0070671_1000410692 342
263 3300005356 Ga0070674_100050257 Ga0070674_1000502573 342
264 3300005456 Ga0070678_100044985 Ga0070678_1000449852 342
265 3300005466 Ga0070685_10008200 Ga0070685_100082006 342
266 3300005535 Ga0070684_100264025 Ga0070684_1002640252 342
267 3300005536 Ga0070697_100287450 Ga0070697_1002874501 342
268 3300005544 Ga0070686_100096035 Ga0070686_1000960351 342
269 3300005578 Ga0068854_100066753 Ga0068854_1000667532 342
270 3300005718 Ga0068866_10083686 Ga0068866_100836862 342
271 3300005719 Ga0068861_100067902 Ga0068861_1000679023 342
272 3300005842 Ga0068858_100113965 Ga0068858_1001139653 342
273 3300005844 Ga0068862_100036527 Ga0068862_1000365272 342
274 3300006358 Ga0068871_100012719 Ga0068871_1000127196 342
275 3300009094 Ga0111539_10136688 Ga0111539_101366882 342
276 3300009094 Ga0111539_10254140 Ga0111539_102541402 342
277 3300009094 Ga0111539_10484543 Ga0111539_104845432 342
278 3300009553 Ga0105249_10014951 Ga0105249_100149516 342
279 3300013306 Ga0163162_10050220 Ga0163162_100502203 342
280 3300013308 Ga0157375_10086202 Ga0157375_100862022 342
281 3300014326 Ga0157380_10001144 Ga0157380_1000114411 342
282 3300017792 Ga0163161_10103091 Ga0163161_101030912 342
283 3300025315 Ga0207697_10034767 Ga0207697_100347672 342
284 3300025908 Ga0207643_10055215 Ga0207643_100552153 342
285 3300025927 Ga0207687_10074109 Ga0207687_100741091 342
286 3300025940 Ga0207691_10000845 Ga0207691_1000084513 342
287 3300025941 Ga0207711_10037324 Ga0207711_100373242 342
288 3300025942 Ga0207689_10001578 Ga0207689_1000157810 342
289 3300025960 Ga0207651_10031905 Ga0207651_100319053 342
290 3300026089 Ga0207648_10009944 Ga0207648_100099448 342
291 3300026095 Ga0207676_10013972 Ga0207676_100139723 342
292 3300026121 Ga0207683_10044630 Ga0207683_100446304 342
293 3300027907 Ga0207428_10000547 Ga0207428_1000054721 342
294 3300028381 Ga0268264_10161839 Ga0268264_101618391 342
295 3300003322 rootL2_10136828 rootL2_101368282 344
296 3300005985 Ga0081539_10000783 Ga0081539_1000078343 344
297 2162886012 MBSR1b_contig_5455348 MBSR1b_0606.00003860 346
298 3300005293 Ga0065715_10001857 Ga0065715_100018576 346
299 3300005295 Ga0065707_10090849 Ga0065707_100908493 346
300 3300005338 Ga0068868_100066814 Ga0068868_1000668142 346
301 3300005353 Ga0070669_100008573 Ga0070669_1000085733 346
302 3300005441 Ga0070700_100006960 Ga0070700_1000069606 346
303 3300005444 Ga0070694_100017680 Ga0070694_1000176803 346
304 3300005544 Ga0070686_100088717 Ga0070686_1000887172 346
305 3300005578 Ga0068854_100059918 Ga0068854_1000599183 346
306 3300005719 Ga0068861_100007069 Ga0068861_1000070693 346
307 3300005719 Ga0068861_100075090 Ga0068861_1000750903 346
308 3300005842 Ga0068858_100051295 Ga0068858_1000512953 346
309 3300009177 Ga0105248_10119195 Ga0105248_101191953 346
310 3300013306 Ga0163162_10104275 Ga0163162_101042752 346
311 3300014326 Ga0157380_10157022 Ga0157380_101570222 346
312 3300025918 Ga0207662_10006894 Ga0207662_100068943 346
313 3300025923 Ga0207681_10004509 Ga0207681_100045095 346
314 3300025961 Ga0207712_10102920 Ga0207712_101029201 346
315 3300026035 Ga0207703_10022832 Ga0207703_100228323 346
316 3300026075 Ga0207708_10005226 Ga0207708_100052265 346
317 3300026118 Ga0207675_100051953 Ga0207675_1000519533 346

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

42

159

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wra-assembly1.cif.gz_A crystal structure of phosphorylcholine esterase domain of the virulence factor choline binding protein e from streptococcus pneumoniae 0.7518 30 299
2bib-assembly1.cif.gz_A crystal structure of the complete modular teichioic acid phosphorylcholine esterase pce (cbpe) from streptococcus pneumoniae 0.7189 22 302
4qlo-assembly1.cif.gz_A crystal structure of homoserine o-acetyltransferase from staphylococcus aureus 0.6858 60 109
1wra-assembly1.cif.gz_A crystal structure of phosphorylcholine esterase domain of the virulence factor choline binding protein e from streptococcus pneumoniae 0.6698 30 299
1ztc-assembly1.cif.gz_C crystal structure of a putative metallo-beta-lactamase (tm0894) from thermotoga maritima at 2.10 a resolution 0.6684 27 217
ID Description Score Start End Superfamily
af_Q2FXY4_446_708_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8402 27 303 3.60.15.10
af_P37443_498_733_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8396 29 301 3.60.15.10
af_Q2FXY4_446_708_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8313 27 303 3.60.15.10
af_P37443_498_733_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.8295 29 301 3.60.15.10
1wraB01 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.764 27 299 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A1B1Z0K4-F1-model_v4 Metallo-beta-lactamase domain-containing protein 0.9617 26 302
AF-A0A7C6Z9M5-F1-model_v4 MBL fold metallo-hydrolase 0.96 26 304 GO:0016787
AF-W2EFC0-F1-model_v4 deleted 0.959 29 304
AF-A0A7T6VPK0-F1-model_v4 MBL fold metallo-hydrolase 0.9568 26 304 GO:0016787
AF-A0A7C0WPH6-F1-model_v4 MBL fold metallo-hydrolase 0.9562 27 301

Feature Viewer

pLDDT pTM Quality
84.41 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map