F403979
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 317 | 163 | 317 | 353 |
Family's Representative Sequence
| Representative Sequence | 3300003322|rootL2_10136828|rootL2_101368282 |
| Length | 385 |
| Sequence | MGRVRRGCAGAAFSYWKWVRPWLAKQPPPASGAELTVRILDVGPVNGDSILISSPAGKTVLIDAGDTTKGKAVVEALKRHNVQQIDYFIATHPHPDHIGGAAEVFKAFKVLNVIDNGQEPSIPPELLPAKPAAGASTKKSAAAKPTPTPKTTKQVASITKFYDDYKAGLSASGATYALAQPGTKYDLGGGALLTILAPSEPLFTKEKMKSGGNEPNANSIVARLDYGSFSMLLAADAEDQTEHRLLTKDLNLEASVLKVSHHGSKYASSGDFLKRVKPEIAIISCGAWNRYGHPAQAVLDRLRTANPALKLYRTDLNGEITLTTRGKQGDVAVKTTKETTEDLWVGRTAQKDDSSRSGFIAYGDFGPPPKPRKPPEANEQQSEQK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 3 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 4 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 5 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 6 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 7 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 10 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 48 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 49 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 50 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 51 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 52 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 55 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 56 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 57 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 58 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 60 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 61 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 62 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 63 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 64 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 65 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 67 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 127 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 129 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 130 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 131 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 132 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 133 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 134 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 135 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 136 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 137 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 138 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 139 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 140 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 141 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 142 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 144 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 145 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 146 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 147 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 148 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 149 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 150 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 151 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 152 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 153 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 154 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 155 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 156 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 157 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 158 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 159 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 160 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 161 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 162 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 163 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.26 |
| Rhizosphere | 98.11 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.63 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_5455348 | 2162886012 | Eukaryota | 1802 |
| 2 | JGI24748J21848_1000001 | 3300002074 | Bacteria | 444271 |
| 3 | JGI24034J26672_10000001 | 3300002239 | Bacteria | 1118280 |
| 4 | JGI24751J29686_10000013 | 3300002459 | Bacteria | 113565 |
| 5 | JGI25406J46586_10004972 | 3300003203 | Bacteria | 6176 |
| 6 | rootL2_10136828 | 3300003322 | Bacteria | 2335 |
| 7 | Ga0065714_10002186 | 3300005288 | Bacteria | 191932 |
| 8 | Ga0065704_10001172 | 3300005289 | Bacteria | 19999 |
| 9 | Ga0065712_10000113 | 3300005290 | Bacteria | 191931 |
| 10 | Ga0065715_10001857 | 3300005293 | Bacteria | 6337 |
| 11 | Ga0065715_10089819 | 3300005293 | Bacteria | 8424 |
| 12 | Ga0065715_10091399 | 3300005293 | Bacteria | 5822 |
| 13 | Ga0065715_10093814 | 3300005293 | Bacteria | 4545 |
| 14 | Ga0065715_10096557 | 3300005293 | Unclassified | 3855 |
| 15 | Ga0065715_10103738 | 3300005293 | Bacteria | 3011 |
| 16 | Ga0065707_10084507 | 3300005295 | Bacteria | 7130 |
| 17 | Ga0065707_10090849 | 3300005295 | Unclassified | 4054 |
| 18 | Ga0070670_100000129 | 3300005331 | Bacteria | 71325 |
| 19 | Ga0070670_100020338 | 3300005331 | Bacteria | 5705 |
| 20 | Ga0070680_100028184 | 3300005336 | Bacteria | 4504 |
| 21 | Ga0070682_100004638 | 3300005337 | Bacteria | 7631 |
| 22 | Ga0068868_100025435 | 3300005338 | Bacteria | 4503 |
| 23 | Ga0068868_100066814 | 3300005338 | Bacteria | 2860 |
| 24 | Ga0070689_100000520 | 3300005340 | Bacteria | 22774 |
| 25 | Ga0070687_100059394 | 3300005343 | Bacteria | 2013 |
| 26 | Ga0070692_10001914 | 3300005345 | Bacteria | 7859 |
| 27 | Ga0070669_100008573 | 3300005353 | Bacteria | 7297 |
| 28 | Ga0070671_100041069 | 3300005355 | Bacteria | 3843 |
| 29 | Ga0070671_100369755 | 3300005355 | Unclassified | 1224 |
| 30 | Ga0070674_100050257 | 3300005356 | Unclassified | 2870 |
| 31 | Ga0070673_100046978 | 3300005364 | Bacteria | 3357 |
| 32 | Ga0070659_100113486 | 3300005366 | Unclassified | 2189 |
| 33 | Ga0070703_10007602 | 3300005406 | Bacteria | 3045 |
| 34 | Ga0070701_10017669 | 3300005438 | Bacteria | 3338 |
| 35 | Ga0070705_100037570 | 3300005440 | Bacteria | 2733 |
| 36 | Ga0070700_100000070 | 3300005441 | Bacteria | 72718 |
| 37 | Ga0070700_100006960 | 3300005441 | Bacteria | 6073 |
| 38 | Ga0070700_100016391 | 3300005441 | Unclassified | 4221 |
| 39 | Ga0070700_100022007 | 3300005441 | Bacteria | 3712 |
| 40 | Ga0070694_100002932 | 3300005444 | Bacteria | 10142 |
| 41 | Ga0070694_100017680 | 3300005444 | Unclassified | 4507 |
| 42 | Ga0070678_100044985 | 3300005456 | Bacteria | 3156 |
| 43 | Ga0070681_10002356 | 3300005458 | Bacteria | 17256 |
| 44 | Ga0070681_10033900 | 3300005458 | Bacteria | 5127 |
| 45 | Ga0070685_10008200 | 3300005466 | Bacteria | 5356 |
| 46 | Ga0070706_100000019 | 3300005467 | Bacteria | 166483 |
| 47 | Ga0070707_100095493 | 3300005468 | Bacteria | 2879 |
| 48 | Ga0070698_100028354 | 3300005471 | Bacteria | 5816 |
| 49 | Ga0070698_100113035 | 3300005471 | Bacteria | 2680 |
| 50 | Ga0070699_100000762 | 3300005518 | Bacteria | 29755 |
| 51 | Ga0070699_100089688 | 3300005518 | Bacteria | 2687 |
| 52 | Ga0070699_100196446 | 3300005518 | Bacteria | 1793 |
| 53 | Ga0070684_100264025 | 3300005535 | Unclassified | 1575 |
| 54 | Ga0070697_100287450 | 3300005536 | Bacteria | 1412 |
| 55 | Ga0068853_100351903 | 3300005539 | Unclassified | 1370 |
| 56 | Ga0070686_100023684 | 3300005544 | Bacteria | 3673 |
| 57 | Ga0070686_100088717 | 3300005544 | Bacteria | 2064 |
| 58 | Ga0070686_100096035 | 3300005544 | Bacteria | 1992 |
| 59 | Ga0070695_100067973 | 3300005545 | Bacteria | 2326 |
| 60 | Ga0070695_100068817 | 3300005545 | Bacteria | 2313 |
| 61 | Ga0070696_100004687 | 3300005546 | Bacteria | 9140 |
| 62 | Ga0070696_100042979 | 3300005546 | Bacteria | 3125 |
| 63 | Ga0070693_100001683 | 3300005547 | Bacteria | 10023 |
| 64 | Ga0070693_100037618 | 3300005547 | Unclassified | 2700 |
| 65 | Ga0070704_100010883 | 3300005549 | Bacteria | 5548 |
| 66 | Ga0070704_100030530 | 3300005549 | Bacteria | 3612 |
| 67 | Ga0068857_100153305 | 3300005577 | Unclassified | 2089 |
| 68 | Ga0068854_100059918 | 3300005578 | Unclassified | 2752 |
| 69 | Ga0068854_100066753 | 3300005578 | Bacteria | 2619 |
| 70 | Ga0068854_100088391 | 3300005578 | Bacteria | 2301 |
| 71 | Ga0070702_100011313 | 3300005615 | Bacteria | 4434 |
| 72 | Ga0068859_100016509 | 3300005617 | Bacteria | 7413 |
| 73 | Ga0068859_100028738 | 3300005617 | Bacteria | 5574 |
| 74 | Ga0068859_100034120 | 3300005617 | Bacteria | 5108 |
| 75 | Ga0068859_100037747 | 3300005617 | Bacteria | 4848 |
| 76 | Ga0068859_100051793 | 3300005617 | Bacteria | 4127 |
| 77 | Ga0068859_100052167 | 3300005617 | Bacteria | 4112 |
| 78 | Ga0068859_100251025 | 3300005617 | Unclassified | 1860 |
| 79 | Ga0068864_100058317 | 3300005618 | Bacteria | 3336 |
| 80 | Ga0068864_100075656 | 3300005618 | Bacteria | 2940 |
| 81 | Ga0068864_100363140 | 3300005618 | Unclassified | 1369 |
| 82 | Ga0068866_10083686 | 3300005718 | Bacteria | 1720 |
| 83 | Ga0068861_100001857 | 3300005719 | Bacteria | 13605 |
| 84 | Ga0068861_100007069 | 3300005719 | Bacteria | 7677 |
| 85 | Ga0068861_100067902 | 3300005719 | Bacteria | 2753 |
| 86 | Ga0068861_100075090 | 3300005719 | Bacteria | 2631 |
| 87 | Ga0068851_10009869 | 3300005834 | Bacteria | 4446 |
| 88 | Ga0068870_10042189 | 3300005840 | Bacteria | 2374 |
| 89 | Ga0068863_100007143 | 3300005841 | Bacteria | 10955 |
| 90 | Ga0068863_100061358 | 3300005841 | Unclassified | 3554 |
| 91 | Ga0068863_100107517 | 3300005841 | Bacteria | 2655 |
| 92 | Ga0068863_100171084 | 3300005841 | Bacteria | 2084 |
| 93 | Ga0068858_100000051 | 3300005842 | Bacteria | 120692 |
| 94 | Ga0068858_100036252 | 3300005842 | Bacteria | 4573 |
| 95 | Ga0068858_100051295 | 3300005842 | Bacteria | 3817 |
| 96 | Ga0068858_100113965 | 3300005842 | Bacteria | 2525 |
| 97 | Ga0068858_100336526 | 3300005842 | Unclassified | 1444 |
| 98 | Ga0068860_100041122 | 3300005843 | Bacteria | 4416 |
| 99 | Ga0068860_100072210 | 3300005843 | Bacteria | 3279 |
| 100 | Ga0068860_100162199 | 3300005843 | Bacteria | 2156 |
| 101 | Ga0068862_100008314 | 3300005844 | Bacteria | 8587 |
| 102 | Ga0068862_100036527 | 3300005844 | Unclassified | 4164 |
| 103 | Ga0081539_10000591 | 3300005985 | Bacteria | 74056 |
| 104 | Ga0081539_10000783 | 3300005985 | Bacteria | 61928 |
| 105 | Ga0081539_10001629 | 3300005985 | Bacteria | 36707 |
| 106 | Ga0070716_100000003 | 3300006173 | Bacteria | 312721 |
| 107 | Ga0068871_100002005 | 3300006358 | Bacteria | 13780 |
| 108 | Ga0068871_100012719 | 3300006358 | Bacteria | 6222 |
| 109 | Ga0068871_100037902 | 3300006358 | Bacteria | 3847 |
| 110 | Ga0075430_100145972 | 3300006846 | Bacteria | 1970 |
| 111 | Ga0075434_100195297 | 3300006871 | Bacteria | 2044 |
| 112 | Ga0075429_100008602 | 3300006880 | Bacteria | 8878 |
| 113 | Ga0075429_100046987 | 3300006880 | Bacteria | 3756 |
| 114 | Ga0068865_100035398 | 3300006881 | Bacteria | 3357 |
| 115 | Ga0075436_100000002 | 3300006914 | Bacteria | 475522 |
| 116 | Ga0097620_100016508 | 3300006931 | Bacteria | 7413 |
| 117 | Ga0097620_100028740 | 3300006931 | Bacteria | 5574 |
| 118 | Ga0097620_100034120 | 3300006931 | Bacteria | 5108 |
| 119 | Ga0097620_100037750 | 3300006931 | Bacteria | 4848 |
| 120 | Ga0097620_100051793 | 3300006931 | Bacteria | 4127 |
| 121 | Ga0097620_100052166 | 3300006931 | Bacteria | 4112 |
| 122 | Ga0097620_100251027 | 3300006931 | Unclassified | 1860 |
| 123 | Ga0075435_100005602 | 3300007076 | Bacteria | 8793 |
| 124 | Ga0105240_10069981 | 3300009093 | Bacteria | 4342 |
| 125 | Ga0111539_10000931 | 3300009094 | Bacteria | 38341 |
| 126 | Ga0111539_10014870 | 3300009094 | Bacteria | 9704 |
| 127 | Ga0111539_10017779 | 3300009094 | Bacteria | 8802 |
| 128 | Ga0111539_10033381 | 3300009094 | Bacteria | 6248 |
| 129 | Ga0111539_10136688 | 3300009094 | Bacteria | 2870 |
| 130 | Ga0111539_10254140 | 3300009094 | Unclassified | 2046 |
| 131 | Ga0111539_10484543 | 3300009094 | Unclassified | 1440 |
| 132 | Ga0105245_10088382 | 3300009098 | Bacteria | 2846 |
| 133 | Ga0105247_10000004 | 3300009101 | Bacteria | 455497 |
| 134 | Ga0105247_10003850 | 3300009101 | Bacteria | 9715 |
| 135 | Ga0105247_10249790 | 3300009101 | Bacteria | 1212 |
| 136 | Ga0114129_10007505 | 3300009147 | Bacteria | 15532 |
| 137 | Ga0114129_10057619 | 3300009147 | Bacteria | 5435 |
| 138 | Ga0114129_10191362 | 3300009147 | Unclassified | 2778 |
| 139 | Ga0114129_10266822 | 3300009147 | Bacteria | 2292 |
| 140 | Ga0114129_10860532 | 3300009147 | Bacteria | 1152 |
| 141 | Ga0105243_10000446 | 3300009148 | Bacteria | 43049 |
| 142 | Ga0105243_10009923 | 3300009148 | Bacteria | 7240 |
| 143 | Ga0105243_10010652 | 3300009148 | Bacteria | 6973 |
| 144 | Ga0105243_10058734 | 3300009148 | Bacteria | 3066 |
| 145 | Ga0105243_10143334 | 3300009148 | Bacteria | 2041 |
| 146 | Ga0105241_10103802 | 3300009174 | Bacteria | 2264 |
| 147 | Ga0105242_10001013 | 3300009176 | Bacteria | 22070 |
| 148 | Ga0105242_10023838 | 3300009176 | Bacteria | 4827 |
| 149 | Ga0105242_10130043 | 3300009176 | Bacteria | 2172 |
| 150 | Ga0105242_10397992 | 3300009176 | Bacteria | 1284 |
| 151 | Ga0105248_10026997 | 3300009177 | Bacteria | 6387 |
| 152 | Ga0105248_10119195 | 3300009177 | Unclassified | 2977 |
| 153 | Ga0105248_10148578 | 3300009177 | Bacteria | 2644 |
| 154 | Ga0105248_10201093 | 3300009177 | Unclassified | 2245 |
| 155 | Ga0105237_10002452 | 3300009545 | Bacteria | 23028 |
| 156 | Ga0105237_10067407 | 3300009545 | Bacteria | 3572 |
| 157 | Ga0105238_10005750 | 3300009551 | Bacteria | 12267 |
| 158 | Ga0105249_10014951 | 3300009553 | Bacteria | 6863 |
| 159 | Ga0105249_10033755 | 3300009553 | Bacteria | 4634 |
| 160 | Ga0105249_10084616 | 3300009553 | Bacteria | 2954 |
| 161 | Ga0105249_10395635 | 3300009553 | Bacteria | 1411 |
| 162 | Ga0105239_10043633 | 3300010375 | Bacteria | 4917 |
| 163 | Ga0105239_10228706 | 3300010375 | Bacteria | 2087 |
| 164 | Ga0105246_10077021 | 3300011119 | Bacteria | 2364 |
| 165 | Ga0105246_10082510 | 3300011119 | Bacteria | 2294 |
| 166 | Ga0157378_10000004 | 3300013297 | Bacteria | 201051 |
| 167 | Ga0157378_10019632 | 3300013297 | Bacteria | 5941 |
| 168 | Ga0163162_10000506 | 3300013306 | Bacteria | 36273 |
| 169 | Ga0163162_10010975 | 3300013306 | Bacteria | 8821 |
| 170 | Ga0163162_10031016 | 3300013306 | Bacteria | 5300 |
| 171 | Ga0163162_10050220 | 3300013306 | Bacteria | 4183 |
| 172 | Ga0163162_10091538 | 3300013306 | Bacteria | 3124 |
| 173 | Ga0163162_10104275 | 3300013306 | Bacteria | 2930 |
| 174 | Ga0163162_10153101 | 3300013306 | Bacteria | 2424 |
| 175 | Ga0157372_10003813 | 3300013307 | Bacteria | 16192 |
| 176 | Ga0157372_10376031 | 3300013307 | Bacteria | 1655 |
| 177 | Ga0157375_10000479 | 3300013308 | Bacteria | 36426 |
| 178 | Ga0157375_10029800 | 3300013308 | Bacteria | 5137 |
| 179 | Ga0157375_10086202 | 3300013308 | Unclassified | 3191 |
| 180 | Ga0157375_10168541 | 3300013308 | Bacteria | 2336 |
| 181 | Ga0163163_10002475 | 3300014325 | Bacteria | 15620 |
| 182 | Ga0163163_10002674 | 3300014325 | Bacteria | 15066 |
| 183 | Ga0163163_10027017 | 3300014325 | Bacteria | 5493 |
| 184 | Ga0163163_10132607 | 3300014325 | Bacteria | 2532 |
| 185 | Ga0163163_10277760 | 3300014325 | Bacteria | 1726 |
| 186 | Ga0163163_10335310 | 3300014325 | Bacteria | 1567 |
| 187 | Ga0157380_10001144 | 3300014326 | Bacteria | 17148 |
| 188 | Ga0157380_10001887 | 3300014326 | Bacteria | 13902 |
| 189 | Ga0157380_10157022 | 3300014326 | Unclassified | 1973 |
| 190 | Ga0157380_10339214 | 3300014326 | Unclassified | 1401 |
| 191 | Ga0157377_10022973 | 3300014745 | Bacteria | 3300 |
| 192 | Ga0157379_10069966 | 3300014968 | Bacteria | 3139 |
| 193 | Ga0157379_10071489 | 3300014968 | Bacteria | 3104 |
| 194 | Ga0157376_10164972 | 3300014969 | Bacteria | 2012 |
| 195 | Ga0157376_10211444 | 3300014969 | Bacteria | 1791 |
| 196 | Ga0163161_10103091 | 3300017792 | Bacteria | 2126 |
| 197 | Ga0207672_1000002 | 3300025223 | Bacteria | 31879 |
| 198 | Ga0207697_10034767 | 3300025315 | Unclassified | 2063 |
| 199 | Ga0207653_10006203 | 3300025885 | Bacteria | 3726 |
| 200 | Ga0207710_10000002 | 3300025900 | Bacteria | 1251998 |
| 201 | Ga0207710_10001678 | 3300025900 | Bacteria | 10757 |
| 202 | Ga0207643_10001513 | 3300025908 | Bacteria | 13273 |
| 203 | Ga0207643_10030347 | 3300025908 | Bacteria | 3008 |
| 204 | Ga0207643_10055215 | 3300025908 | Bacteria | 2259 |
| 205 | Ga0207684_10000079 | 3300025910 | Bacteria | 179842 |
| 206 | Ga0207684_10215320 | 3300025910 | Bacteria | 1657 |
| 207 | Ga0207671_10058170 | 3300025914 | Bacteria | 2866 |
| 208 | Ga0207662_10006894 | 3300025918 | Bacteria | 6158 |
| 209 | Ga0207662_10041469 | 3300025918 | Bacteria | 2710 |
| 210 | Ga0207662_10081291 | 3300025918 | Bacteria | 1978 |
| 211 | Ga0207646_10115786 | 3300025922 | Unclassified | 2408 |
| 212 | Ga0207681_10004509 | 3300025923 | Bacteria | 8578 |
| 213 | Ga0207694_10029123 | 3300025924 | Bacteria | 4212 |
| 214 | Ga0207650_10000001 | 3300025925 | Bacteria | 1545726 |
| 215 | Ga0207687_10074109 | 3300025927 | Bacteria | 2439 |
| 216 | Ga0207644_10000179 | 3300025931 | Bacteria | 45397 |
| 217 | Ga0207644_10134998 | 3300025931 | Unclassified | 1893 |
| 218 | Ga0207686_10014087 | 3300025934 | Unclassified | 4442 |
| 219 | Ga0207686_10189973 | 3300025934 | Bacteria | 1463 |
| 220 | Ga0207709_10003560 | 3300025935 | Bacteria | 9208 |
| 221 | Ga0207709_10009517 | 3300025935 | Bacteria | 5347 |
| 222 | Ga0207709_10116161 | 3300025935 | Bacteria | 1799 |
| 223 | Ga0207670_10016298 | 3300025936 | Bacteria | 4463 |
| 224 | Ga0207670_10145771 | 3300025936 | Bacteria | 1751 |
| 225 | Ga0207665_10041950 | 3300025939 | Bacteria | 3057 |
| 226 | Ga0207691_10000845 | 3300025940 | Bacteria | 30493 |
| 227 | Ga0207711_10037324 | 3300025941 | Bacteria | 4126 |
| 228 | Ga0207711_10065871 | 3300025941 | Bacteria | 3132 |
| 229 | Ga0207689_10001578 | 3300025942 | Bacteria | 21602 |
| 230 | Ga0207689_10091052 | 3300025942 | Bacteria | 2506 |
| 231 | Ga0207679_10325957 | 3300025945 | Bacteria | 1331 |
| 232 | Ga0207651_10014969 | 3300025960 | Bacteria | 4494 |
| 233 | Ga0207651_10031905 | 3300025960 | Bacteria | 3375 |
| 234 | Ga0207651_10062112 | 3300025960 | Bacteria | 2602 |
| 235 | Ga0207712_10012801 | 3300025961 | Bacteria | 5365 |
| 236 | Ga0207712_10102920 | 3300025961 | Bacteria | 2127 |
| 237 | Ga0207640_10028801 | 3300025981 | Bacteria | 3401 |
| 238 | Ga0207677_10084147 | 3300026023 | Bacteria | 2292 |
| 239 | Ga0207703_10000114 | 3300026035 | Bacteria | 96051 |
| 240 | Ga0207703_10022832 | 3300026035 | Bacteria | 4914 |
| 241 | Ga0207703_10137661 | 3300026035 | Bacteria | 2116 |
| 242 | Ga0207703_10305696 | 3300026035 | Unclassified | 1452 |
| 243 | Ga0207639_10014244 | 3300026041 | Bacteria | 5586 |
| 244 | Ga0207708_10000094 | 3300026075 | Bacteria | 67925 |
| 245 | Ga0207708_10001910 | 3300026075 | Bacteria | 15394 |
| 246 | Ga0207708_10005226 | 3300026075 | Bacteria | 9567 |
| 247 | Ga0207708_10015991 | 3300026075 | Bacteria | 5634 |
| 248 | Ga0207708_10028395 | 3300026075 | Unclassified | 4237 |
| 249 | Ga0207708_10148217 | 3300026075 | Bacteria | 1845 |
| 250 | Ga0207641_10079532 | 3300026088 | Bacteria | 2842 |
| 251 | Ga0207641_10089631 | 3300026088 | Bacteria | 2688 |
| 252 | Ga0207641_10090201 | 3300026088 | Bacteria | 2680 |
| 253 | Ga0207648_10009944 | 3300026089 | Bacteria | 9064 |
| 254 | Ga0207648_10063691 | 3300026089 | Unclassified | 3213 |
| 255 | Ga0207676_10013972 | 3300026095 | Bacteria | 5763 |
| 256 | Ga0207674_10250856 | 3300026116 | Bacteria | 1717 |
| 257 | Ga0207674_10260330 | 3300026116 | Unclassified | 1682 |
| 258 | Ga0207674_10270047 | 3300026116 | Bacteria | 1648 |
| 259 | Ga0207675_100024330 | 3300026118 | Bacteria | 5632 |
| 260 | Ga0207675_100037657 | 3300026118 | Bacteria | 4512 |
| 261 | Ga0207675_100051953 | 3300026118 | Unclassified | 3825 |
| 262 | Ga0207675_100219909 | 3300026118 | Bacteria | 1830 |
| 263 | Ga0207675_100254964 | 3300026118 | Unclassified | 1699 |
| 264 | Ga0207683_10044630 | 3300026121 | Unclassified | 3875 |
| 265 | Ga0207428_10000547 | 3300027907 | Bacteria | 44826 |
| 266 | Ga0207428_10001780 | 3300027907 | Bacteria | 22062 |
| 267 | Ga0268264_10161839 | 3300028381 | Unclassified | 2017 |
| 268 | Ga0268264_10208800 | 3300028381 | Bacteria | 1791 |
| 269 | Ga0314311_1181996 | 3300030733 | Bacteria | 1892 |
| 270 | Ga0307513_10008218 | 3300031456 | Bacteria | 13384 |
| 271 | Ga0307408_100260499 | 3300031548 | Bacteria | 1435 |
| 272 | Ga0307410_10010577 | 3300031852 | Bacteria | 5234 |
| 273 | Ga0307406_10003651 | 3300031901 | Bacteria | 8381 |
| 274 | Ga0307406_10088441 | 3300031901 | Bacteria | 2079 |
| 275 | Ga0307416_100008990 | 3300032002 | Bacteria | 6499 |
| 276 | Ga0373940_0038189 | 3300035088 | Bacteria | 1310 |
| 277 | Ga0373951_0008791 | 3300035091 | Bacteria | 2277 |
| 278 | Ga0242420_002616 | 3300038996 | Unclassified | 2588 |
| 279 | Ga0439458_0001329 | 3300042157 | Bacteria | 6241 |
| 280 | Ga0439434_0002352 | 3300042435 | Bacteria | 5499 |
| 281 | Ga0453683_0094328 | 3300044673 | Bacteria | 1877 |
| 282 | Ga0453684_0358317 | 3300044712 | Unclassified | 1643 |
| 283 | Ga0451576_0095940 | 3300045051 | Unclassified | 3084 |
| 284 | Ga0495632_0013462 | 3300046519 | Bacteria | 4668 |
| 285 | Ga0496106_0001061 | 3300048909 | Bacteria | 20265 |
| 286 | Ga0496106_0106509 | 3300048909 | Bacteria | 2179 |
| 287 | Ga0496108_0107384 | 3300048911 | Bacteria | 2384 |
| 288 | Ga0496112_0396489 | 3300048915 | Unclassified | 1320 |
| 289 | Ga0501298_000232 | 3300049521 | Bacteria | 7190 |
| 290 | Ga0501299_001477 | 3300049522 | Bacteria | 3041 |
| 291 | Ga0501038_0014682 | 3300049574 | Bacteria | 7135 |
| 292 | Ga0501048_0147024 | 3300049582 | Bacteria | 1667 |
| 293 | Ga0501202_004671 | 3300049652 | Unclassified | 2401 |
| 294 | Ga0501202_019439 | 3300049652 | Bacteria | 1342 |
| 295 | Ga0501217_001739 | 3300049661 | Bacteria | 4158 |
| 296 | Ga0501217_001950 | 3300049661 | Bacteria | 3966 |
| 297 | Ga0501217_012997 | 3300049661 | Bacteria | 1863 |
| 298 | Ga0501223_010731 | 3300049663 | Bacteria | 1841 |
| 299 | Ga0501227_002440 | 3300049665 | Bacteria | 4104 |
| 300 | Ga0501225_0006504 | 3300049705 | Bacteria | 3412 |
| 301 | Ga0501225_0015285 | 3300049705 | Bacteria | 2139 |
| 302 | Ga0501245_002848 | 3300049708 | Bacteria | 2328 |
| 303 | nmdc:mga05p37_15372_c1 | 3300050507 | Bacteria | 9195 |
| 304 | nmdc:mga05p37_200818_c1 | 3300050507 | Bacteria | 2415 |
| 305 | nmdc:mga05p37_52012_c1 | 3300050507 | Bacteria | 5037 |
| 306 | nmdc:mga05p37_610577_c1 | 3300050507 | Unclassified | 1229 |
| 307 | nmdc:mga05p37_7696_c1 | 3300050507 | Bacteria | 12714 |
| 308 | nmdc:mga09592_46698_c1 | 3300050508 | Bacteria | 3648 |
| 309 | nmdc:mga08y16_177868_c1 | 3300050511 | Unclassified | 2210 |
| 310 | nmdc:mga08y16_246218_c1 | 3300050511 | Bacteria | 1847 |
| 311 | nmdc:mga08y16_5249_c1 | 3300050511 | Bacteria | 13531 |
| 312 | nmdc:mga0n895_267263_c1 | 3300050512 | Bacteria | 1735 |
| 313 | nmdc:mga0rr50_3767_c1 | 3300050513 | Bacteria | 8793 |
| 314 | nmdc:mga08x19_9_c1 | 3300050514 | Bacteria | 418852 |
| 315 | nmdc:mga0a205_111644_c1 | 3300050515 | Bacteria | 2633 |
| 316 | nmdc:mga0a205_33665_c1 | 3300050515 | Bacteria | 4913 |
| 317 | Ga0530510_0058033 | 3300061734 | Bacteria | 2798 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005841 | Ga0068863_100061358 | Ga0068863_1000613582 | 289 |
| 2 | 3300025908 | Ga0207643_10030347 | Ga0207643_100303472 | 289 |
| 3 | 3300025939 | Ga0207665_10041950 | Ga0207665_100419504 | 292 |
| 4 | 3300009147 | Ga0114129_10860532 | Ga0114129_108605322 | 293 |
| 5 | 3300009147 | Ga0114129_10007505 | Ga0114129_100075053 | 295 |
| 6 | 3300050507 | nmdc:mga05p37_15372_c1 | nmdc:mga05p37_15372_c1_1234_2184 | 295 |
| 7 | 3300046519 | Ga0495632_0013462 | Ga0495632_0013462_2307_3455 | 311 |
| 8 | 3300031456 | Ga0307513_10008218 | Ga0307513_100082187 | 312 |
| 9 | 3300049705 | Ga0501225_0006504 | Ga0501225_0006504_2384_3400 | 313 |
| 10 | 3300005843 | Ga0068860_100162199 | Ga0068860_1001621992 | 314 |
| 11 | 3300009545 | Ga0105237_10067407 | Ga0105237_100674073 | 314 |
| 12 | 3300025914 | Ga0207671_10058170 | Ga0207671_100581702 | 314 |
| 13 | 3300025960 | Ga0207651_10062112 | Ga0207651_100621122 | 314 |
| 14 | 3300049661 | Ga0501217_012997 | Ga0501217_012997_359_1405 | 315 |
| 15 | 3300049652 | Ga0501202_019439 | Ga0501202_019439_177_1253 | 316 |
| 16 | 3300005985 | Ga0081539_10001629 | Ga0081539_1000162910 | 320 |
| 17 | 3300013308 | Ga0157375_10168541 | Ga0157375_101685412 | 321 |
| 18 | 3300006914 | Ga0075436_100000002 | Ga0075436_100000002226 | 322 |
| 19 | 3300007076 | Ga0075435_100005602 | Ga0075435_1000056028 | 322 |
| 20 | 3300014325 | Ga0163163_10277760 | Ga0163163_102777602 | 322 |
| 21 | 3300005355 | Ga0070671_100369755 | Ga0070671_1003697551 | 323 |
| 22 | 3300005467 | Ga0070706_100000019 | Ga0070706_10000001983 | 323 |
| 23 | 3300009148 | Ga0105243_10058734 | Ga0105243_100587342 | 323 |
| 24 | 3300009148 | Ga0105243_10143334 | Ga0105243_101433342 | 323 |
| 25 | 3300006846 | Ga0075430_100145972 | Ga0075430_1001459722 | 324 |
| 26 | 3300002074 | JGI24748J21848_1000001 | JGI24748J21848_1000001338 | 326 |
| 27 | 3300002239 | JGI24034J26672_10000001 | JGI24034J26672_1000000179 | 326 |
| 28 | 3300031548 | Ga0307408_100260499 | Ga0307408_1002604991 | 326 |
| 29 | 3300005293 | Ga0065715_10103738 | Ga0065715_101037383 | 327 |
| 30 | 3300005366 | Ga0070659_100113486 | Ga0070659_1001134863 | 327 |
| 31 | 3300005438 | Ga0070701_10017669 | Ga0070701_100176692 | 327 |
| 32 | 3300009101 | Ga0105247_10003850 | Ga0105247_100038503 | 327 |
| 33 | 3300009147 | Ga0114129_10057619 | Ga0114129_100576193 | 327 |
| 34 | 3300025900 | Ga0207710_10001678 | Ga0207710_100016787 | 327 |
| 35 | 3300025945 | Ga0207679_10325957 | Ga0207679_103259571 | 327 |
| 36 | 3300031901 | Ga0307406_10088441 | Ga0307406_100884412 | 327 |
| 37 | 3300049661 | Ga0501217_001739 | Ga0501217_001739_3043_4119 | 327 |
| 38 | 3300050507 | nmdc:mga05p37_52012_c1 | nmdc:mga05p37_52012_c1_3161_4282 | 327 |
| 39 | 3300050513 | nmdc:mga0rr50_3767_c1 | nmdc:mga0rr50_3767_c1_4775_5926 | 327 |
| 40 | 3300050514 | nmdc:mga08x19_9_c1 | nmdc:mga08x19_9_c1_154201_155352 | 327 |
| 41 | 3300002459 | JGI24751J29686_10000013 | JGI24751J29686_1000001336 | 328 |
| 42 | 3300006880 | Ga0075429_100046987 | Ga0075429_1000469872 | 328 |
| 43 | 3300009147 | Ga0114129_10191362 | Ga0114129_101913622 | 328 |
| 44 | 3300013306 | Ga0163162_10031016 | Ga0163162_100310165 | 328 |
| 45 | 3300014325 | Ga0163163_10002475 | Ga0163163_1000247511 | 328 |
| 46 | 3300014325 | Ga0163163_10002674 | Ga0163163_100026748 | 328 |
| 47 | 3300025910 | Ga0207684_10000079 | Ga0207684_10000079148 | 328 |
| 48 | 3300025924 | Ga0207694_10029123 | Ga0207694_100291232 | 328 |
| 49 | 3300025931 | Ga0207644_10134998 | Ga0207644_101349982 | 328 |
| 50 | 3300049582 | Ga0501048_0147024 | Ga0501048_0147024_144_1265 | 328 |
| 51 | 3300050507 | nmdc:mga05p37_610577_c1 | nmdc:mga05p37_610577_c1_29_1159 | 328 |
| 52 | 3300061734 | Ga0530510_0058033 | Ga0530510_0058033_554_1702 | 328 |
| 53 | 3300005518 | Ga0070699_100000762 | Ga0070699_1000007629 | 329 |
| 54 | 3300005985 | Ga0081539_10000591 | Ga0081539_1000059136 | 329 |
| 55 | 3300026035 | Ga0207703_10137661 | Ga0207703_101376611 | 329 |
| 56 | 3300009147 | Ga0114129_10266822 | Ga0114129_102668223 | 330 |
| 57 | 3300014326 | Ga0157380_10001887 | Ga0157380_100018876 | 330 |
| 58 | 3300014326 | Ga0157380_10339214 | Ga0157380_103392141 | 330 |
| 59 | 3300014968 | Ga0157379_10069966 | Ga0157379_100699663 | 330 |
| 60 | 3300026116 | Ga0207674_10250856 | Ga0207674_102508561 | 330 |
| 61 | 3300049574 | Ga0501038_0014682 | Ga0501038_0014682_1538_2605 | 330 |
| 62 | 3300050507 | nmdc:mga05p37_200818_c1 | nmdc:mga05p37_200818_c1_200_1255 | 330 |
| 63 | 3300005549 | Ga0070704_100030530 | Ga0070704_1000305302 | 331 |
| 64 | 3300005842 | Ga0068858_100000051 | Ga0068858_10000005132 | 331 |
| 65 | 3300005842 | Ga0068858_100336526 | Ga0068858_1003365262 | 331 |
| 66 | 3300009101 | Ga0105247_10000004 | Ga0105247_10000004124 | 331 |
| 67 | 3300009148 | Ga0105243_10000446 | Ga0105243_100004466 | 331 |
| 68 | 3300009176 | Ga0105242_10001013 | Ga0105242_1000101316 | 331 |
| 69 | 3300009176 | Ga0105242_10397992 | Ga0105242_103979921 | 331 |
| 70 | 3300013297 | Ga0157378_10000004 | Ga0157378_10000004106 | 331 |
| 71 | 3300013308 | Ga0157375_10000479 | Ga0157375_1000047917 | 331 |
| 72 | 3300025223 | Ga0207672_1000002 | Ga0207672_10000028 | 331 |
| 73 | 3300025900 | Ga0207710_10000002 | Ga0207710_10000002890 | 331 |
| 74 | 3300025931 | Ga0207644_10000179 | Ga0207644_1000017929 | 331 |
| 75 | 3300025934 | Ga0207686_10014087 | Ga0207686_100140874 | 331 |
| 76 | 3300025935 | Ga0207709_10003560 | Ga0207709_100035606 | 331 |
| 77 | 3300026035 | Ga0207703_10000114 | Ga0207703_1000011440 | 331 |
| 78 | 3300026035 | Ga0207703_10305696 | Ga0207703_103056963 | 331 |
| 79 | 3300048909 | Ga0496106_0001061 | Ga0496106_0001061_10926_12065 | 331 |
| 80 | 3300003203 | JGI25406J46586_10004972 | JGI25406J46586_100049726 | 332 |
| 81 | 3300005441 | Ga0070700_100000070 | Ga0070700_1000000709 | 332 |
| 82 | 3300005545 | Ga0070695_100067973 | Ga0070695_1000679732 | 332 |
| 83 | 3300009553 | Ga0105249_10084616 | Ga0105249_100846163 | 332 |
| 84 | 3300014325 | Ga0163163_10335310 | Ga0163163_103353102 | 332 |
| 85 | 3300025961 | Ga0207712_10012801 | Ga0207712_100128016 | 332 |
| 86 | 3300026075 | Ga0207708_10000094 | Ga0207708_1000009411 | 332 |
| 87 | 3300026118 | Ga0207675_100037657 | Ga0207675_1000376571 | 332 |
| 88 | 3300005331 | Ga0070670_100000129 | Ga0070670_10000012917 | 333 |
| 89 | 3300005617 | Ga0068859_100051793 | Ga0068859_1000517933 | 333 |
| 90 | 3300006931 | Ga0097620_100051793 | Ga0097620_1000517933 | 333 |
| 91 | 3300025925 | Ga0207650_10000001 | Ga0207650_1000000185 | 333 |
| 92 | 3300044673 | Ga0453683_0094328 | Ga0453683_0094328_170_1327 | 333 |
| 93 | 3300044712 | Ga0453684_0358317 | Ga0453684_0358317_146_1303 | 333 |
| 94 | 3300045051 | Ga0451576_0095940 | Ga0451576_0095940_1710_2867 | 333 |
| 95 | 3300048909 | Ga0496106_0106509 | Ga0496106_0106509_456_1541 | 333 |
| 96 | 3300005295 | Ga0065707_10084507 | Ga0065707_100845077 | 334 |
| 97 | 3300005458 | Ga0070681_10033900 | Ga0070681_100339005 | 334 |
| 98 | 3300005578 | Ga0068854_100088391 | Ga0068854_1000883912 | 334 |
| 99 | 3300005617 | Ga0068859_100028738 | Ga0068859_1000287385 | 334 |
| 100 | 3300005618 | Ga0068864_100363140 | Ga0068864_1003631401 | 334 |
| 101 | 3300005840 | Ga0068870_10042189 | Ga0068870_100421892 | 334 |
| 102 | 3300005844 | Ga0068862_100008314 | Ga0068862_1000083147 | 334 |
| 103 | 3300006880 | Ga0075429_100008602 | Ga0075429_1000086026 | 334 |
| 104 | 3300006931 | Ga0097620_100028740 | Ga0097620_1000287405 | 334 |
| 105 | 3300009094 | Ga0111539_10017779 | Ga0111539_100177792 | 334 |
| 106 | 3300009177 | Ga0105248_10026997 | Ga0105248_100269975 | 334 |
| 107 | 3300009553 | Ga0105249_10395635 | Ga0105249_103956351 | 334 |
| 108 | 3300013306 | Ga0163162_10000506 | Ga0163162_100005066 | 334 |
| 109 | 3300014968 | Ga0157379_10071489 | Ga0157379_100714892 | 334 |
| 110 | 3300025981 | Ga0207640_10028801 | Ga0207640_100288013 | 334 |
| 111 | 3300027907 | Ga0207428_10001780 | Ga0207428_100017806 | 334 |
| 112 | 3300035088 | Ga0373940_0038189 | Ga0373940_0038189_155_1297 | 334 |
| 113 | 3300050507 | nmdc:mga05p37_7696_c1 | nmdc:mga05p37_7696_c1_211_1356 | 334 |
| 114 | 3300050508 | nmdc:mga09592_46698_c1 | nmdc:mga09592_46698_c1_18_1178 | 334 |
| 115 | 3300050511 | nmdc:mga08y16_177868_c1 | nmdc:mga08y16_177868_c1_533_1693 | 334 |
| 116 | 3300050512 | nmdc:mga0n895_267263_c1 | nmdc:mga0n895_267263_c1_458_1570 | 334 |
| 117 | 3300050515 | nmdc:mga0a205_33665_c1 | nmdc:mga0a205_33665_c1_3076_4188 | 334 |
| 118 | 3300005617 | Ga0068859_100034120 | Ga0068859_1000341206 | 335 |
| 119 | 3300005841 | Ga0068863_100007143 | Ga0068863_1000071435 | 335 |
| 120 | 3300006173 | Ga0070716_100000003 | Ga0070716_10000000339 | 335 |
| 121 | 3300006931 | Ga0097620_100034120 | Ga0097620_1000341206 | 335 |
| 122 | 3300009098 | Ga0105245_10088382 | Ga0105245_100883822 | 335 |
| 123 | 3300009177 | Ga0105248_10148578 | Ga0105248_101485782 | 335 |
| 124 | 3300009553 | Ga0105249_10033755 | Ga0105249_100337554 | 335 |
| 125 | 3300010375 | Ga0105239_10043633 | Ga0105239_100436334 | 335 |
| 126 | 3300013306 | Ga0163162_10010975 | Ga0163162_100109752 | 335 |
| 127 | 3300013306 | Ga0163162_10153101 | Ga0163162_101531012 | 335 |
| 128 | 3300026075 | Ga0207708_10001910 | Ga0207708_100019107 | 335 |
| 129 | 3300026116 | Ga0207674_10270047 | Ga0207674_102700472 | 335 |
| 130 | 3300026118 | Ga0207675_100024330 | Ga0207675_1000243304 | 335 |
| 131 | 3300038996 | Ga0242420_002616 | Ga0242420_002616_1308_2456 | 335 |
| 132 | 3300005444 | Ga0070694_100002932 | Ga0070694_1000029328 | 336 |
| 133 | 3300005468 | Ga0070707_100095493 | Ga0070707_1000954933 | 336 |
| 134 | 3300005471 | Ga0070698_100113035 | Ga0070698_1001130352 | 336 |
| 135 | 3300005518 | Ga0070699_100089688 | Ga0070699_1000896883 | 336 |
| 136 | 3300005545 | Ga0070695_100068817 | Ga0070695_1000688173 | 336 |
| 137 | 3300005546 | Ga0070696_100004687 | Ga0070696_1000046878 | 336 |
| 138 | 3300005547 | Ga0070693_100037618 | Ga0070693_1000376183 | 336 |
| 139 | 3300005719 | Ga0068861_100001857 | Ga0068861_10000185711 | 336 |
| 140 | 3300005843 | Ga0068860_100072210 | Ga0068860_1000722102 | 336 |
| 141 | 3300009176 | Ga0105242_10130043 | Ga0105242_101300432 | 336 |
| 142 | 3300025918 | Ga0207662_10081291 | Ga0207662_100812912 | 336 |
| 143 | 3300025922 | Ga0207646_10115786 | Ga0207646_101157862 | 336 |
| 144 | 3300025935 | Ga0207709_10116161 | Ga0207709_101161612 | 336 |
| 145 | 3300048911 | Ga0496108_0107384 | Ga0496108_0107384_451_1581 | 336 |
| 146 | 3300050515 | nmdc:mga0a205_111644_c1 | nmdc:mga0a205_111644_c1_1496_2590 | 336 |
| 147 | 3300005336 | Ga0070680_100028184 | Ga0070680_1000281842 | 337 |
| 148 | 3300005364 | Ga0070673_100046978 | Ga0070673_1000469782 | 337 |
| 149 | 3300005441 | Ga0070700_100016391 | Ga0070700_1000163913 | 337 |
| 150 | 3300005546 | Ga0070696_100042979 | Ga0070696_1000429792 | 337 |
| 151 | 3300005617 | Ga0068859_100016509 | Ga0068859_1000165095 | 337 |
| 152 | 3300005618 | Ga0068864_100075656 | Ga0068864_1000756562 | 337 |
| 153 | 3300006871 | Ga0075434_100195297 | Ga0075434_1001952972 | 337 |
| 154 | 3300006931 | Ga0097620_100016508 | Ga0097620_1000165085 | 337 |
| 155 | 3300009094 | Ga0111539_10000931 | Ga0111539_1000093111 | 337 |
| 156 | 3300009101 | Ga0105247_10249790 | Ga0105247_102497901 | 337 |
| 157 | 3300009148 | Ga0105243_10009923 | Ga0105243_100099237 | 337 |
| 158 | 3300009148 | Ga0105243_10010652 | Ga0105243_100106526 | 337 |
| 159 | 3300009176 | Ga0105242_10023838 | Ga0105242_100238383 | 337 |
| 160 | 3300010375 | Ga0105239_10228706 | Ga0105239_102287062 | 337 |
| 161 | 3300011119 | Ga0105246_10077021 | Ga0105246_100770212 | 337 |
| 162 | 3300013307 | Ga0157372_10376031 | Ga0157372_103760312 | 337 |
| 163 | 3300013308 | Ga0157375_10029800 | Ga0157375_100298002 | 337 |
| 164 | 3300014745 | Ga0157377_10022973 | Ga0157377_100229732 | 337 |
| 165 | 3300014969 | Ga0157376_10211444 | Ga0157376_102114442 | 337 |
| 166 | 3300025908 | Ga0207643_10001513 | Ga0207643_100015139 | 337 |
| 167 | 3300025934 | Ga0207686_10189973 | Ga0207686_101899731 | 337 |
| 168 | 3300025935 | Ga0207709_10009517 | Ga0207709_100095175 | 337 |
| 169 | 3300025960 | Ga0207651_10014969 | Ga0207651_100149694 | 337 |
| 170 | 3300026075 | Ga0207708_10028395 | Ga0207708_100283954 | 337 |
| 171 | 3300026089 | Ga0207648_10063691 | Ga0207648_100636912 | 337 |
| 172 | 3300026118 | Ga0207675_100254964 | Ga0207675_1002549642 | 337 |
| 173 | 3300035091 | Ga0373951_0008791 | Ga0373951_0008791_173_1288 | 337 |
| 174 | 3300050511 | nmdc:mga08y16_246218_c1 | nmdc:mga08y16_246218_c1_91_1206 | 337 |
| 175 | 3300050511 | nmdc:mga08y16_5249_c1 | nmdc:mga08y16_5249_c1_10108_11223 | 337 |
| 176 | 3300005343 | Ga0070687_100059394 | Ga0070687_1000593942 | 338 |
| 177 | 3300005406 | Ga0070703_10007602 | Ga0070703_100076022 | 338 |
| 178 | 3300005441 | Ga0070700_100022007 | Ga0070700_1000220074 | 338 |
| 179 | 3300005549 | Ga0070704_100010883 | Ga0070704_1000108835 | 338 |
| 180 | 3300005615 | Ga0070702_100011313 | Ga0070702_1000113133 | 338 |
| 181 | 3300005617 | Ga0068859_100052167 | Ga0068859_1000521675 | 338 |
| 182 | 3300005834 | Ga0068851_10009869 | Ga0068851_100098693 | 338 |
| 183 | 3300005842 | Ga0068858_100036252 | Ga0068858_1000362522 | 338 |
| 184 | 3300006881 | Ga0068865_100035398 | Ga0068865_1000353982 | 338 |
| 185 | 3300006931 | Ga0097620_100052166 | Ga0097620_1000521665 | 338 |
| 186 | 3300009545 | Ga0105237_10002452 | Ga0105237_1000245217 | 338 |
| 187 | 3300025885 | Ga0207653_10006203 | Ga0207653_100062033 | 338 |
| 188 | 3300025910 | Ga0207684_10215320 | Ga0207684_102153201 | 338 |
| 189 | 3300025942 | Ga0207689_10091052 | Ga0207689_100910521 | 338 |
| 190 | 3300026023 | Ga0207677_10084147 | Ga0207677_100841471 | 338 |
| 191 | 3300026118 | Ga0207675_100219909 | Ga0207675_1002199092 | 338 |
| 192 | 3300042157 | Ga0439458_0001329 | Ga0439458_0001329_4395_5555 | 338 |
| 193 | 3300049705 | Ga0501225_0015285 | Ga0501225_0015285_737_1888 | 338 |
| 194 | 3300005293 | Ga0065715_10093814 | Ga0065715_100938142 | 339 |
| 195 | 3300005337 | Ga0070682_100004638 | Ga0070682_1000046387 | 339 |
| 196 | 3300005544 | Ga0070686_100023684 | Ga0070686_1000236842 | 339 |
| 197 | 3300005841 | Ga0068863_100171084 | Ga0068863_1001710843 | 339 |
| 198 | 3300006358 | Ga0068871_100037902 | Ga0068871_1000379022 | 339 |
| 199 | 3300009094 | Ga0111539_10014870 | Ga0111539_100148705 | 339 |
| 200 | 3300013297 | Ga0157378_10019632 | Ga0157378_100196325 | 339 |
| 201 | 3300013306 | Ga0163162_10091538 | Ga0163162_100915383 | 339 |
| 202 | 3300014325 | Ga0163163_10027017 | Ga0163163_100270173 | 339 |
| 203 | 3300014969 | Ga0157376_10164972 | Ga0157376_101649722 | 339 |
| 204 | 3300025918 | Ga0207662_10041469 | Ga0207662_100414692 | 339 |
| 205 | 3300005293 | Ga0065715_10089819 | Ga0065715_100898197 | 340 |
| 206 | 3300005331 | Ga0070670_100020338 | Ga0070670_1000203385 | 340 |
| 207 | 3300005340 | Ga0070689_100000520 | Ga0070689_1000005202 | 340 |
| 208 | 3300005458 | Ga0070681_10002356 | Ga0070681_1000235610 | 340 |
| 209 | 3300005539 | Ga0068853_100351903 | Ga0068853_1003519031 | 340 |
| 210 | 3300005617 | Ga0068859_100037747 | Ga0068859_1000377473 | 340 |
| 211 | 3300005617 | Ga0068859_100251025 | Ga0068859_1002510252 | 340 |
| 212 | 3300006931 | Ga0097620_100037750 | Ga0097620_1000377503 | 340 |
| 213 | 3300006931 | Ga0097620_100251027 | Ga0097620_1002510272 | 340 |
| 214 | 3300009551 | Ga0105238_10005750 | Ga0105238_100057504 | 340 |
| 215 | 3300011119 | Ga0105246_10082510 | Ga0105246_100825103 | 340 |
| 216 | 3300014325 | Ga0163163_10132607 | Ga0163163_101326073 | 340 |
| 217 | 3300025936 | Ga0207670_10016298 | Ga0207670_100162981 | 340 |
| 218 | 3300025941 | Ga0207711_10065871 | Ga0207711_100658712 | 340 |
| 219 | 3300026041 | Ga0207639_10014244 | Ga0207639_100142442 | 340 |
| 220 | 3300026075 | Ga0207708_10148217 | Ga0207708_101482171 | 340 |
| 221 | 3300026088 | Ga0207641_10089631 | Ga0207641_100896312 | 340 |
| 222 | 3300049521 | Ga0501298_000232 | Ga0501298_000232_5211_6335 | 340 |
| 223 | 3300049522 | Ga0501299_001477 | Ga0501299_001477_947_2071 | 340 |
| 224 | 3300049708 | Ga0501245_002848 | Ga0501245_002848_429_1553 | 340 |
| 225 | 3300005293 | Ga0065715_10096557 | Ga0065715_100965574 | 341 |
| 226 | 3300005345 | Ga0070692_10001914 | Ga0070692_100019142 | 341 |
| 227 | 3300005440 | Ga0070705_100037570 | Ga0070705_1000375703 | 341 |
| 228 | 3300005471 | Ga0070698_100028354 | Ga0070698_1000283545 | 341 |
| 229 | 3300005518 | Ga0070699_100196446 | Ga0070699_1001964461 | 341 |
| 230 | 3300005547 | Ga0070693_100001683 | Ga0070693_1000016835 | 341 |
| 231 | 3300005577 | Ga0068857_100153305 | Ga0068857_1001533052 | 341 |
| 232 | 3300005618 | Ga0068864_100058317 | Ga0068864_1000583172 | 341 |
| 233 | 3300005841 | Ga0068863_100107517 | Ga0068863_1001075172 | 341 |
| 234 | 3300005843 | Ga0068860_100041122 | Ga0068860_1000411225 | 341 |
| 235 | 3300006358 | Ga0068871_100002005 | Ga0068871_1000020059 | 341 |
| 236 | 3300009093 | Ga0105240_10069981 | Ga0105240_100699814 | 341 |
| 237 | 3300009094 | Ga0111539_10033381 | Ga0111539_100333812 | 341 |
| 238 | 3300009174 | Ga0105241_10103802 | Ga0105241_101038022 | 341 |
| 239 | 3300009177 | Ga0105248_10201093 | Ga0105248_102010933 | 341 |
| 240 | 3300013307 | Ga0157372_10003813 | Ga0157372_100038136 | 341 |
| 241 | 3300025936 | Ga0207670_10145771 | Ga0207670_101457712 | 341 |
| 242 | 3300026075 | Ga0207708_10015991 | Ga0207708_100159916 | 341 |
| 243 | 3300026088 | Ga0207641_10079532 | Ga0207641_100795322 | 341 |
| 244 | 3300026088 | Ga0207641_10090201 | Ga0207641_100902012 | 341 |
| 245 | 3300026116 | Ga0207674_10260330 | Ga0207674_102603302 | 341 |
| 246 | 3300028381 | Ga0268264_10208800 | Ga0268264_102088002 | 341 |
| 247 | 3300030733 | Ga0314311_1181996 | Ga0314311_11819962 | 341 |
| 248 | 3300031852 | Ga0307410_10010577 | Ga0307410_100105773 | 341 |
| 249 | 3300031901 | Ga0307406_10003651 | Ga0307406_100036515 | 341 |
| 250 | 3300032002 | Ga0307416_100008990 | Ga0307416_1000089906 | 341 |
| 251 | 3300042435 | Ga0439434_0002352 | Ga0439434_0002352_2205_3347 | 341 |
| 252 | 3300048915 | Ga0496112_0396489 | Ga0496112_0396489_142_1281 | 341 |
| 253 | 3300049652 | Ga0501202_004671 | Ga0501202_004671_839_1978 | 341 |
| 254 | 3300049661 | Ga0501217_001950 | Ga0501217_001950_1304_2419 | 341 |
| 255 | 3300049663 | Ga0501223_010731 | Ga0501223_010731_436_1551 | 341 |
| 256 | 3300049665 | Ga0501227_002440 | Ga0501227_002440_42_1181 | 341 |
| 257 | 3300005288 | Ga0065714_10002186 | Ga0065714_1000218692 | 342 |
| 258 | 3300005289 | Ga0065704_10001172 | Ga0065704_100011726 | 342 |
| 259 | 3300005290 | Ga0065712_10000113 | Ga0065712_1000011392 | 342 |
| 260 | 3300005293 | Ga0065715_10091399 | Ga0065715_100913995 | 342 |
| 261 | 3300005338 | Ga0068868_100025435 | Ga0068868_1000254354 | 342 |
| 262 | 3300005355 | Ga0070671_100041069 | Ga0070671_1000410692 | 342 |
| 263 | 3300005356 | Ga0070674_100050257 | Ga0070674_1000502573 | 342 |
| 264 | 3300005456 | Ga0070678_100044985 | Ga0070678_1000449852 | 342 |
| 265 | 3300005466 | Ga0070685_10008200 | Ga0070685_100082006 | 342 |
| 266 | 3300005535 | Ga0070684_100264025 | Ga0070684_1002640252 | 342 |
| 267 | 3300005536 | Ga0070697_100287450 | Ga0070697_1002874501 | 342 |
| 268 | 3300005544 | Ga0070686_100096035 | Ga0070686_1000960351 | 342 |
| 269 | 3300005578 | Ga0068854_100066753 | Ga0068854_1000667532 | 342 |
| 270 | 3300005718 | Ga0068866_10083686 | Ga0068866_100836862 | 342 |
| 271 | 3300005719 | Ga0068861_100067902 | Ga0068861_1000679023 | 342 |
| 272 | 3300005842 | Ga0068858_100113965 | Ga0068858_1001139653 | 342 |
| 273 | 3300005844 | Ga0068862_100036527 | Ga0068862_1000365272 | 342 |
| 274 | 3300006358 | Ga0068871_100012719 | Ga0068871_1000127196 | 342 |
| 275 | 3300009094 | Ga0111539_10136688 | Ga0111539_101366882 | 342 |
| 276 | 3300009094 | Ga0111539_10254140 | Ga0111539_102541402 | 342 |
| 277 | 3300009094 | Ga0111539_10484543 | Ga0111539_104845432 | 342 |
| 278 | 3300009553 | Ga0105249_10014951 | Ga0105249_100149516 | 342 |
| 279 | 3300013306 | Ga0163162_10050220 | Ga0163162_100502203 | 342 |
| 280 | 3300013308 | Ga0157375_10086202 | Ga0157375_100862022 | 342 |
| 281 | 3300014326 | Ga0157380_10001144 | Ga0157380_1000114411 | 342 |
| 282 | 3300017792 | Ga0163161_10103091 | Ga0163161_101030912 | 342 |
| 283 | 3300025315 | Ga0207697_10034767 | Ga0207697_100347672 | 342 |
| 284 | 3300025908 | Ga0207643_10055215 | Ga0207643_100552153 | 342 |
| 285 | 3300025927 | Ga0207687_10074109 | Ga0207687_100741091 | 342 |
| 286 | 3300025940 | Ga0207691_10000845 | Ga0207691_1000084513 | 342 |
| 287 | 3300025941 | Ga0207711_10037324 | Ga0207711_100373242 | 342 |
| 288 | 3300025942 | Ga0207689_10001578 | Ga0207689_1000157810 | 342 |
| 289 | 3300025960 | Ga0207651_10031905 | Ga0207651_100319053 | 342 |
| 290 | 3300026089 | Ga0207648_10009944 | Ga0207648_100099448 | 342 |
| 291 | 3300026095 | Ga0207676_10013972 | Ga0207676_100139723 | 342 |
| 292 | 3300026121 | Ga0207683_10044630 | Ga0207683_100446304 | 342 |
| 293 | 3300027907 | Ga0207428_10000547 | Ga0207428_1000054721 | 342 |
| 294 | 3300028381 | Ga0268264_10161839 | Ga0268264_101618391 | 342 |
| 295 | 3300003322 | rootL2_10136828 | rootL2_101368282 | 344 |
| 296 | 3300005985 | Ga0081539_10000783 | Ga0081539_1000078343 | 344 |
| 297 | 2162886012 | MBSR1b_contig_5455348 | MBSR1b_0606.00003860 | 346 |
| 298 | 3300005293 | Ga0065715_10001857 | Ga0065715_100018576 | 346 |
| 299 | 3300005295 | Ga0065707_10090849 | Ga0065707_100908493 | 346 |
| 300 | 3300005338 | Ga0068868_100066814 | Ga0068868_1000668142 | 346 |
| 301 | 3300005353 | Ga0070669_100008573 | Ga0070669_1000085733 | 346 |
| 302 | 3300005441 | Ga0070700_100006960 | Ga0070700_1000069606 | 346 |
| 303 | 3300005444 | Ga0070694_100017680 | Ga0070694_1000176803 | 346 |
| 304 | 3300005544 | Ga0070686_100088717 | Ga0070686_1000887172 | 346 |
| 305 | 3300005578 | Ga0068854_100059918 | Ga0068854_1000599183 | 346 |
| 306 | 3300005719 | Ga0068861_100007069 | Ga0068861_1000070693 | 346 |
| 307 | 3300005719 | Ga0068861_100075090 | Ga0068861_1000750903 | 346 |
| 308 | 3300005842 | Ga0068858_100051295 | Ga0068858_1000512953 | 346 |
| 309 | 3300009177 | Ga0105248_10119195 | Ga0105248_101191953 | 346 |
| 310 | 3300013306 | Ga0163162_10104275 | Ga0163162_101042752 | 346 |
| 311 | 3300014326 | Ga0157380_10157022 | Ga0157380_101570222 | 346 |
| 312 | 3300025918 | Ga0207662_10006894 | Ga0207662_100068943 | 346 |
| 313 | 3300025923 | Ga0207681_10004509 | Ga0207681_100045095 | 346 |
| 314 | 3300025961 | Ga0207712_10102920 | Ga0207712_101029201 | 346 |
| 315 | 3300026035 | Ga0207703_10022832 | Ga0207703_100228323 | 346 |
| 316 | 3300026075 | Ga0207708_10005226 | Ga0207708_100052265 | 346 |
| 317 | 3300026118 | Ga0207675_100051953 | Ga0207675_1000519533 | 346 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1wra-assembly1.cif.gz_A | crystal structure of phosphorylcholine esterase domain of the virulence factor choline binding protein e from streptococcus pneumoniae | 0.7518 | 30 | 299 |
| 2bib-assembly1.cif.gz_A | crystal structure of the complete modular teichioic acid phosphorylcholine esterase pce (cbpe) from streptococcus pneumoniae | 0.7189 | 22 | 302 |
| 4qlo-assembly1.cif.gz_A | crystal structure of homoserine o-acetyltransferase from staphylococcus aureus | 0.6858 | 60 | 109 |
| 1wra-assembly1.cif.gz_A | crystal structure of phosphorylcholine esterase domain of the virulence factor choline binding protein e from streptococcus pneumoniae | 0.6698 | 30 | 299 |
| 1ztc-assembly1.cif.gz_C | crystal structure of a putative metallo-beta-lactamase (tm0894) from thermotoga maritima at 2.10 a resolution | 0.6684 | 27 | 217 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FXY4_446_708_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.8402 | 27 | 303 | 3.60.15.10 |
| af_P37443_498_733_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.8396 | 29 | 301 | 3.60.15.10 |
| af_Q2FXY4_446_708_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.8313 | 27 | 303 | 3.60.15.10 |
| af_P37443_498_733_3.60.15.10 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.8295 | 29 | 301 | 3.60.15.10 |
| 1wraB01 | Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like | 0.764 | 27 | 299 | 3.60.15.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1B1Z0K4-F1-model_v4 | Metallo-beta-lactamase domain-containing protein | 0.9617 | 26 | 302 |
|
| AF-A0A7C6Z9M5-F1-model_v4 | MBL fold metallo-hydrolase | 0.96 | 26 | 304 |
GO:0016787
|
| AF-W2EFC0-F1-model_v4 | deleted | 0.959 | 29 | 304 |
|
| AF-A0A7T6VPK0-F1-model_v4 | MBL fold metallo-hydrolase | 0.9568 | 26 | 304 |
GO:0016787
|
| AF-A0A7C0WPH6-F1-model_v4 | MBL fold metallo-hydrolase | 0.9562 | 27 | 301 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar