F403657

General Info

Members Datasets Scaffolds Average Seq Length
316 208 632 109

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_10807965|Ga0105243_108079652
Length 126
Sequence MDTTQLLKGVLDLAVLAVVRDEDGYGYDIVRRLRDAGIGDVGDASVYGTLRRLYSGGALSSYVVPSDGGPHRKYYAITAQGKHMLDEQIATWSHFAVAMSGLLAPHVPSFHPPAEPTGSLSEGAQR

Samples

Sample ID Description Type Environment
1 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
50 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
51 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
54 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
110 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
111 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
112 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
113 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
114 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
115 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
116 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
117 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
118 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
119 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
120 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
121 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
122 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
123 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
124 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
125 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
126 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
127 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
128 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
129 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
130 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
131 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
132 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
133 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
134 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
135 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
136 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
137 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
138 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
139 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
140 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
141 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
142 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
143 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
144 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
145 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
146 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
147 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
148 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
149 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
150 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
151 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
152 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
153 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
154 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
155 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
156 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
157 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
158 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
159 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
160 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
161 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
162 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
163 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
164 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
165 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
166 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
167 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
168 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
170 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
171 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
172 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
173 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
174 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
175 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
176 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
177 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
178 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
179 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
180 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
181 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
182 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
183 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
184 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
185 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
186 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
187 2558860280 Kutzneria sp. 744 Isolate Unclassified
188 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
189 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
190 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
191 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
192 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
193 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
194 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
195 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
196 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
197 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
198 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
199 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
200 2891562705 Microbispora tritici MT50 Isolate Unclassified
201 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
202 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
203 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
204 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
205 2946024296 Arthrobacter woluwensis W4I2 Isolate Rhizosphere
206 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere
207 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
208 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.72
Metatranscriptomes 0
Isolates 7.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.01
Nodule 0
Rhizoplane 3.8
Rhizosphere 79.11
Stem 0
Stem Tuber 0
Unclassified 1.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105243_10807965 3300009148 Bacteria 925
2 JGI24737J22298_10246738 3300001990 Bacteria 527
3 JGI25406J46586_10054909 3300003203 Bacteria 1315
4 Ga0070683_100004823 3300005329 Bacteria 11169
5 Ga0070683_100004975 3300005329 Bacteria 11030
6 Ga0068869_100015266 3300005334 Bacteria 5148
7 Ga0068869_100026817 3300005334 Bacteria 4013
8 Ga0068869_101675922 3300005334 Bacteria 567
9 Ga0070682_100167034 3300005337 Bacteria 1526
10 Ga0070682_100263763 3300005337 Bacteria 1248
11 Ga0070682_100457927 3300005337 Bacteria 978
12 Ga0070682_100609917 3300005337 Bacteria 863
13 Ga0070682_100916741 3300005337 Bacteria 721
14 Ga0068868_100001404 3300005338 Bacteria 16594
15 Ga0068868_102002584 3300005338 Bacteria 550
16 Ga0070687_100063611 3300005343 Bacteria 1957
17 Ga0070661_100459413 3300005344 Bacteria 1014
18 Ga0070692_10076139 3300005345 Bacteria 1798
19 Ga0070668_100000472 3300005347 Bacteria 26659
20 Ga0070668_100018685 3300005347 Bacteria 5204
21 Ga0070669_100460666 3300005353 Bacteria 1049
22 Ga0070669_100910765 3300005353 Bacteria 751
23 Ga0070675_100016163 3300005354 Bacteria 5917
24 Ga0070671_100620134 3300005355 Bacteria 935
25 Ga0070688_100921781 3300005365 Bacteria 690
26 Ga0070659_100056090 3300005366 Bacteria 3106
27 Ga0070659_100251533 3300005366 Bacteria 1465
28 Ga0070667_100073403 3300005367 Bacteria 2917
29 Ga0070667_100098777 3300005367 Bacteria 2519
30 Ga0070667_101527515 3300005367 Bacteria 627
31 Ga0070710_10252917 3300005437 Bacteria 1133
32 Ga0070700_100150131 3300005441 Bacteria 1593
33 Ga0070694_100840703 3300005444 Unclassified 755
34 Ga0070708_100012083 3300005445 Bacteria 7038
35 Ga0070663_101210605 3300005455 Bacteria 664
36 Ga0070678_100139287 3300005456 Bacteria 1939
37 Ga0070678_100965088 3300005456 Bacteria 782
38 Ga0070681_11619392 3300005458 Bacteria 573
39 Ga0068867_100969874 3300005459 Bacteria 769
40 Ga0070706_100317463 3300005467 Bacteria 1453
41 Ga0070707_100028597 3300005468 Bacteria 5306
42 Ga0070707_100265775 3300005468 Bacteria 1668
43 Ga0070707_100380309 3300005468 Bacteria 1371
44 Ga0070707_100523164 3300005468 Bacteria 1148
45 Ga0070707_101588338 3300005468 Unclassified 621
46 Ga0070698_100174403 3300005471 Bacteria 2090
47 Ga0070698_102207708 3300005471 Bacteria 504
48 Ga0070699_100445619 3300005518 Bacteria 1173
49 Ga0070679_100175252 3300005530 Bacteria 2117
50 Ga0070679_100283364 3300005530 Bacteria 1609
51 Ga0070684_100002851 3300005535 Bacteria 12851
52 Ga0070684_100100518 3300005535 Bacteria 2583
53 Ga0070697_100032458 3300005536 Unclassified 4202
54 Ga0070697_100237667 3300005536 Bacteria 1555
55 Ga0070697_100940082 3300005536 Unclassified 767
56 Ga0068853_100348163 3300005539 Bacteria 1378
57 Ga0068853_100773826 3300005539 Bacteria 918
58 Ga0070695_100011725 3300005545 Bacteria 5248
59 Ga0070693_101001704 3300005547 Bacteria 632
60 Ga0070665_100042265 3300005548 Bacteria 4582
61 Ga0070665_100240118 3300005548 Bacteria 1813
62 Ga0070664_100000989 3300005564 Bacteria 22235
63 Ga0070664_100164319 3300005564 Bacteria 1966
64 Ga0070664_101161650 3300005564 Bacteria 728
65 Ga0068857_100222266 3300005577 Bacteria 1725
66 Ga0068857_100627597 3300005577 Bacteria 1017
67 Ga0068857_101027795 3300005577 Bacteria 794
68 Ga0068854_100175782 3300005578 Bacteria 1669
69 Ga0068852_100065955 3300005616 Bacteria 3160
70 Ga0068859_100567235 3300005617 Bacteria 1229
71 Ga0068861_100101725 3300005719 Bacteria 2286
72 Ga0068861_101123800 3300005719 Bacteria 756
73 Ga0068870_10554969 3300005840 Bacteria 774
74 Ga0068863_100015200 3300005841 Bacteria 7396
75 Ga0068858_100829995 3300005842 Bacteria 902
76 Ga0068860_100414005 3300005843 Bacteria 1335
77 Ga0068860_100550773 3300005843 Bacteria 1155
78 Ga0068862_100010507 3300005844 Bacteria 7647
79 Ga0068862_100026556 3300005844 Bacteria 4868
80 Ga0068862_101196553 3300005844 Bacteria 758
81 Ga0081539_10002057 3300005985 Bacteria 30168
82 Ga0081539_10010087 3300005985 Bacteria 7758
83 Ga0081539_10025064 3300005985 Bacteria 3853
84 Ga0081539_10133616 3300005985 Bacteria 1215
85 Ga0081539_10372611 3300005985 Bacteria 597
86 Ga0070717_12062818 3300006028 Bacteria 513
87 Ga0075365_10033969 3300006038 Bacteria 3291
88 Ga0075365_10038004 3300006038 Bacteria 3126
89 Ga0075365_10676879 3300006038 Bacteria 729
90 Ga0075365_10919400 3300006038 Bacteria 617
91 Ga0075432_10159941 3300006058 Bacteria 870
92 Ga0070716_100127332 3300006173 Bacteria 1604
93 Ga0075369_10028790 3300006186 Bacteria 2330
94 Ga0075370_10084129 3300006353 Bacteria 1831
95 Ga0075428_100501554 3300006844 Bacteria 1299
96 Ga0075428_101314493 3300006844 Bacteria 760
97 Ga0075431_100256833 3300006847 Bacteria 1774
98 Ga0075434_101481679 3300006871 Bacteria 688
99 Ga0075429_100155157 3300006880 Bacteria 2005
100 Ga0075429_100272488 3300006880 Bacteria 1482
101 Ga0075429_100772972 3300006880 Bacteria 841
102 Ga0097620_100567281 3300006931 Bacteria 1229
103 Ga0111539_10305263 3300009094 Bacteria 1852
104 Ga0111539_13508995 3300009094 Bacteria 503
105 Ga0105245_10871714 3300009098 Bacteria 941
106 Ga0105245_12692178 3300009098 Bacteria 550
107 Ga0114129_10085194 3300009147 Bacteria 4384
108 Ga0114129_11068045 3300009147 Bacteria 1013
109 Ga0105243_12133969 3300009148 Bacteria 596
110 Ga0105243_12771977 3300009148 Bacteria 531
111 Ga0105242_11748347 3300009176 Bacteria 659
112 Ga0105248_11880107 3300009177 Bacteria 679
113 Ga0105239_10768331 3300010375 Bacteria 1103
114 Ga0105239_11886282 3300010375 Bacteria 693
115 Ga0105239_12401535 3300010375 Bacteria 614
116 Ga0105246_10570260 3300011119 Bacteria 973
117 Ga0105246_11462840 3300011119 Bacteria 640
118 Ga0157371_10475212 3300013102 Bacteria 921
119 Ga0157372_10096027 3300013307 Bacteria 3377
120 Ga0157372_10363049 3300013307 Bacteria 1688
121 Ga0157375_10825608 3300013308 Bacteria 1075
122 Ga0163163_10053857 3300014325 Bacteria 3973
123 Ga0157377_10002592 3300014745 Bacteria 8031
124 Ga0157376_10504837 3300014969 Bacteria 1189
125 Ga0207656_10275532 3300025321 Bacteria 829
126 Ga0207692_10518430 3300025898 Bacteria 758
127 Ga0207710_10057333 3300025900 Bacteria 1759
128 Ga0207688_10366192 3300025901 Bacteria 890
129 Ga0207647_10326697 3300025904 Bacteria 870
130 Ga0207645_10299125 3300025907 Bacteria 1071
131 Ga0207684_10019785 3300025910 Bacteria 5758
132 Ga0207662_10078761 3300025918 Bacteria 2006
133 Ga0207652_10146038 3300025921 Bacteria 2117
134 Ga0207646_10015894 3300025922 Bacteria 7079
135 Ga0207646_10116371 3300025922 Bacteria 2401
136 Ga0207646_10386926 3300025922 Bacteria 1263
137 Ga0207646_10387853 3300025922 Unclassified 1262
138 Ga0207681_10510963 3300025923 Bacteria 985
139 Ga0207650_10100115 3300025925 Bacteria 2229
140 Ga0207659_10005894 3300025926 Bacteria 7479
141 Ga0207690_10037656 3300025932 Bacteria 3142
142 Ga0207706_10008964 3300025933 Bacteria 9207
143 Ga0207709_10601771 3300025935 Bacteria 870
144 Ga0207669_10839272 3300025937 Bacteria 764
145 Ga0207665_10046022 3300025939 Bacteria 2923
146 Ga0207689_10020700 3300025942 Bacteria 5530
147 Ga0207689_10066929 3300025942 Bacteria 2953
148 Ga0207661_10001661 3300025944 Bacteria 15167
149 Ga0207661_10071672 3300025944 Bacteria 2832
150 Ga0207679_10023058 3300025945 Bacteria 4249
151 Ga0207679_10128391 3300025945 Bacteria 2030
152 Ga0207712_10248254 3300025961 Bacteria 1437
153 Ga0207668_10052674 3300025972 Bacteria 2816
154 Ga0207658_10027105 3300025986 Bacteria 4024
155 Ga0207658_10107875 3300025986 Bacteria 2195
156 Ga0207658_10156841 3300025986 Bacteria 1861
157 Ga0207658_10433103 3300025986 Bacteria 1162
158 Ga0207677_10005587 3300026023 Bacteria 6830
159 Ga0207639_10173670 3300026041 Bacteria 1827
160 Ga0207639_11415390 3300026041 Bacteria 653
161 Ga0207678_10133424 3300026067 Bacteria 2119
162 Ga0207708_11065923 3300026075 Bacteria 704
163 Ga0207674_10259967 3300026116 Bacteria 1683
164 Ga0207674_10563816 3300026116 Bacteria 1100
165 Ga0207674_11187949 3300026116 Bacteria 732
166 Ga0207675_100115610 3300026118 Bacteria 2535
167 Ga0207683_10626105 3300026121 Bacteria 996
168 Ga0207683_11282297 3300026121 Bacteria 678
169 Ga0207698_10049509 3300026142 Bacteria 3199
170 Ga0209588_1000097 3300027671 Bacteria 27582
171 Ga0268266_10263802 3300028379 Bacteria 1597
172 Ga0268265_10181996 3300028380 Bacteria 1806
173 Ga0268265_10325229 3300028380 Bacteria 1394
174 Ga0268265_11557050 3300028380 Bacteria 665
175 Ga0268264_10121803 3300028381 Bacteria 2300
176 Ga0268264_10844540 3300028381 Bacteria 917
177 Ga0268264_12042745 3300028381 Bacteria 582
178 Ga0307515_10084822 3300028794 Bacteria 4062
179 Ga0307515_10315367 3300028794 Bacteria 1235
180 Ga0307515_10517627 3300028794 Bacteria 803
181 Ga0307515_10537208 3300028794 Bacteria 779
182 Ga0307512_10002888 3300030522 Bacteria 20863
183 Ga0307512_10142601 3300030522 Bacteria 1461
184 Ga0316176_1041716 3300030732 Bacteria 519
185 Ga0307513_10033956 3300031456 Bacteria 5729
186 Ga0307513_10089334 3300031456 Bacteria 3146
187 Ga0307513_10122021 3300031456 Bacteria 2570
188 Ga0307513_10710186 3300031456 Bacteria 711
189 Ga0307513_10746813 3300031456 Bacteria 684
190 Ga0307408_100704926 3300031548 Bacteria 908
191 Ga0307408_101336720 3300031548 Bacteria 673
192 Ga0307408_101344232 3300031548 Bacteria 671
193 Ga0307508_10000927 3300031616 Bacteria 34076
194 Ga0307508_10173295 3300031616 Bacteria 1761
195 Ga0307516_10042794 3300031730 Bacteria 4490
196 Ga0307405_10131510 3300031731 Bacteria 1730
197 Ga0307405_10963348 3300031731 Bacteria 726
198 Ga0307405_11345408 3300031731 Bacteria 623
199 Ga0307405_11580603 3300031731 Bacteria 578
200 Ga0307413_10097301 3300031824 Bacteria 1935
201 Ga0326468_10011882 3300031889 Bacteria 907
202 Ga0307406_10013419 3300031901 Bacteria 4693
203 Ga0307406_10056349 3300031901 Bacteria 2517
204 Ga0307406_11472870 3300031901 Bacteria 598
205 Ga0307407_10083143 3300031903 Bacteria 1942
206 Ga0307412_10997271 3300031911 Bacteria 740
207 Ga0307412_11559263 3300031911 Bacteria 602
208 Ga0307409_100253403 3300031995 Bacteria 1611
209 Ga0307409_100778638 3300031995 Bacteria 963
210 Ga0307409_100932993 3300031995 Bacteria 883
211 Ga0307416_100987699 3300032002 Bacteria 945
212 Ga0307416_101317579 3300032002 Bacteria 828
213 Ga0307416_101948941 3300032002 Bacteria 690
214 Ga0307416_102533134 3300032002 Bacteria 611
215 Ga0307414_11291838 3300032004 Bacteria 677
216 Ga0307411_10071893 3300032005 Bacteria 2347
217 Ga0307415_100093978 3300032126 Bacteria 2179
218 Ga0307415_100111891 3300032126 Bacteria 2028
219 Ga0307415_100196928 3300032126 Bacteria 1595
220 Ga0307415_101921256 3300032126 Bacteria 575
221 Ga0307415_102413155 3300032126 Bacteria 517
222 Ga0307507_10015298 3300033179 Bacteria 9040
223 Ga0307510_10266484 3300033180 Bacteria 1191
224 Ga0307510_10441776 3300033180 Bacteria 742
225 Ga0373948_0019793 3300034817 Bacteria 1276
226 Ga0373928_0030502 3300035084 Bacteria 1192
227 Ga0373951_0000018 3300035091 Bacteria 65924
228 Ga0373941_0029729 3300035115 Bacteria 1614
229 Ga0373942_0001200 3300035207 Bacteria 6831
230 Ga0373931_0326881 3300035691 Bacteria 954
231 Ga0395898_0623277 3300037466 Bacteria 1021
232 Ga0395901_1020206 3300038443 Bacteria 802
233 Ga0451789_0818633 3300041443 Bacteria 551
234 Ga0451791_0223188 3300041451 Bacteria 904
235 Ga0451800_1194498 3300041459 Bacteria 586
236 Ga0451802_0539878 3300041460 Bacteria 549
237 Ga0451841_0064743 3300041498 Bacteria 549
238 Ga0451849_1504121 3300041505 Bacteria 717
239 Ga0439449_0007416 3300042007 Bacteria 4170
240 Ga0439463_066373 3300042016 Bacteria 923
241 Ga0439459_0024619 3300042438 Bacteria 1182
242 Ga0466969_0013367 3300044656 Bacteria 4322
243 Ga0466965_0373212 3300044683 Bacteria 784
244 Ga0466966_0006242 3300044684 Bacteria 7882
245 Ga0466966_0154705 3300044684 Bacteria 1397
246 Ga0466961_0036724 3300044693 Bacteria 3144
247 Ga0466961_0175306 3300044693 Bacteria 1332
248 Ga0466971_0281872 3300044719 Bacteria 795
249 Ga0466970_0002626 3300044765 Bacteria 8667
250 Ga0466970_0763842 3300044765 Bacteria 565
251 Ga0466959_0007610 3300045049 Bacteria 7610
252 Ga0495585_0186047 3300046492 Bacteria 1065
253 Ga0495596_0141665 3300046500 Bacteria 934
254 Ga0495606_0000885 3300046507 Bacteria 44794
255 Ga0495587_0556610 3300046536 Bacteria 633
256 Ga0495668_0000620 3300046616 Bacteria 42969
257 Ga0495625_0000968 3300046660 Bacteria 38150
258 Ga0495626_0000113 3300048091 Bacteria 105218
259 Ga0496104_0340422 3300048907 Bacteria 1413
260 Ga0496108_0532067 3300048911 Bacteria 1026
261 Ga0496108_0717607 3300048911 Bacteria 866
262 Ga0496109_0491241 3300048912 Bacteria 1159
263 Ga0496109_1363671 3300048912 Bacteria 645
264 Ga0496110_0531315 3300048913 Bacteria 1070
265 Ga0496112_0056300 3300048915 Bacteria 3869
266 Ga0496113_0360914 3300048916 Bacteria 1166
267 Ga0496124_0451980 3300048927 Bacteria 876
268 Ga0501036_0455489 3300049572 Bacteria 1066
269 Ga0501043_0142035 3300049579 Bacteria 1880
270 Ga0501048_0722603 3300049582 Bacteria 715
271 nmdc:mga00v17_246408_c1 3300050491 Bacteria 1159
272 nmdc:mga0yw44_18481_c1 3300050492 Bacteria 3820
273 nmdc:mga0yw44_60366_c1 3300050492 Bacteria 2323
274 nmdc:mga07m45_147406_c1 3300050496 Bacteria 1364
275 nmdc:mga07m45_746777_c1 3300050496 Bacteria 562
276 nmdc:mga05p37_1018225_c1 3300050507 Bacteria 878
277 nmdc:mga05p37_10954_c1 3300050507 Bacteria 10767
278 nmdc:mga09592_1209402_c1 3300050508 Bacteria 624
279 nmdc:mga09592_143953_c1 3300050508 Bacteria 2055
280 nmdc:mga09592_464936_c1 3300050508 Bacteria 1091
281 nmdc:mga06r32_203930_c1 3300050510 Bacteria 1965
282 nmdc:mga08y16_1421787_c1 3300050511 Bacteria 656
283 nmdc:mga08y16_1543_c1 3300050511 Bacteria 23189
284 nmdc:mga0sz30_129225_c1 3300050516 Bacteria 1113
285 Ga0495619_0356153 3300053085 Bacteria 1012
286 Ga0500644_0540326 3300053088 Bacteria 514
287 Ga0500641_0017713 3300053096 Bacteria 2669
288 Ga0500562_160322 3300053108 Bacteria 612
289 Ga0500573_0000011 3300053140 Bacteria 209484
290 Ga0500573_0004309 3300053140 Bacteria 7469
291 Ga0500600_0044790 3300053149 Bacteria 2535
292 Ga0500630_138514 3300053159 Bacteria 1051
293 Ga0466962_0090896 3300061719 Bacteria 1462
294 2515856710 2515154155 Bacteria 7985436
295 2559429589 2558860280 Bacteria 11429938
296 2586059156 2585427649 Bacteria 9053857
297 2588107511 2585428157 Bacteria 3018951
298 2676492988 2675903060 Bacteria 10051191
299 2774393505 2773857762 Bacteria 5971770
300 2795794541 2795385472 Bacteria 6627535
301 2809195603 2808606439 Bacteria 5952208
302 2809592090 2808606522 Bacteria 9488490
303 2812350501 2811994878 Bacteria 5992952
304 2816422603 2816332119 Bacteria 8120218
305 2816504669 2816332139 Bacteria 9138787
306 2856741728 2856741275 Bacteria 8096094
307 2887485857 2887478801 Bacteria 8972725
308 2891566243 2891562705 Bacteria 8039471
309 2891971897 2891968417 Bacteria 5821697
310 2899364062 2899359706 Bacteria 10940472
311 2915769548 2915768154 Bacteria 8424322
312 2917743330 2917736166 Bacteria 9690793
313 2946026612 2946024296 Bacteria 3508095
314 8001785005 8001781756 Bacteria 9586736
315 8003322665 8003314358 Bacteria 10575343
316 8047715590 8047710418 Bacteria 11023148
317 Ga0105243_10807965
318 JGI24737J22298_10246738
319 JGI25406J46586_10054909
320 Ga0070683_100004823
321 Ga0070683_100004975
322 Ga0068869_100015266
323 Ga0068869_100026817
324 Ga0068869_101675922
325 Ga0070682_100167034
326 Ga0070682_100263763
327 Ga0070682_100457927
328 Ga0070682_100609917
329 Ga0070682_100916741
330 Ga0068868_100001404
331 Ga0068868_102002584
332 Ga0070687_100063611
333 Ga0070661_100459413
334 Ga0070692_10076139
335 Ga0070668_100000472
336 Ga0070668_100018685
337 Ga0070669_100460666
338 Ga0070669_100910765
339 Ga0070675_100016163
340 Ga0070671_100620134
341 Ga0070688_100921781
342 Ga0070659_100056090
343 Ga0070659_100251533
344 Ga0070667_100073403
345 Ga0070667_100098777
346 Ga0070667_101527515
347 Ga0070710_10252917
348 Ga0070700_100150131
349 Ga0070694_100840703
350 Ga0070708_100012083
351 Ga0070663_101210605
352 Ga0070678_100139287
353 Ga0070678_100965088
354 Ga0070681_11619392
355 Ga0068867_100969874
356 Ga0070706_100317463
357 Ga0070707_100028597
358 Ga0070707_100265775
359 Ga0070707_100380309
360 Ga0070707_100523164
361 Ga0070707_101588338
362 Ga0070698_100174403
363 Ga0070698_102207708
364 Ga0070699_100445619
365 Ga0070679_100175252
366 Ga0070679_100283364
367 Ga0070684_100002851
368 Ga0070684_100100518
369 Ga0070697_100032458
370 Ga0070697_100237667
371 Ga0070697_100940082
372 Ga0068853_100348163
373 Ga0068853_100773826
374 Ga0070695_100011725
375 Ga0070693_101001704
376 Ga0070665_100042265
377 Ga0070665_100240118
378 Ga0070664_100000989
379 Ga0070664_100164319
380 Ga0070664_101161650
381 Ga0068857_100222266
382 Ga0068857_100627597
383 Ga0068857_101027795
384 Ga0068854_100175782
385 Ga0068852_100065955
386 Ga0068859_100567235
387 Ga0068861_100101725
388 Ga0068861_101123800
389 Ga0068870_10554969
390 Ga0068863_100015200
391 Ga0068858_100829995
392 Ga0068860_100414005
393 Ga0068860_100550773
394 Ga0068862_100010507
395 Ga0068862_100026556
396 Ga0068862_101196553
397 Ga0081539_10002057
398 Ga0081539_10010087
399 Ga0081539_10025064
400 Ga0081539_10133616
401 Ga0081539_10372611
402 Ga0070717_12062818
403 Ga0075365_10033969
404 Ga0075365_10038004
405 Ga0075365_10676879
406 Ga0075365_10919400
407 Ga0075432_10159941
408 Ga0070716_100127332
409 Ga0075369_10028790
410 Ga0075370_10084129
411 Ga0075428_100501554
412 Ga0075428_101314493
413 Ga0075431_100256833
414 Ga0075434_101481679
415 Ga0075429_100155157
416 Ga0075429_100272488
417 Ga0075429_100772972
418 Ga0097620_100567281
419 Ga0111539_10305263
420 Ga0111539_13508995
421 Ga0105245_10871714
422 Ga0105245_12692178
423 Ga0114129_10085194
424 Ga0114129_11068045
425 Ga0105243_12133969
426 Ga0105243_12771977
427 Ga0105242_11748347
428 Ga0105248_11880107
429 Ga0105239_10768331
430 Ga0105239_11886282
431 Ga0105239_12401535
432 Ga0105246_10570260
433 Ga0105246_11462840
434 Ga0157371_10475212
435 Ga0157372_10096027
436 Ga0157372_10363049
437 Ga0157375_10825608
438 Ga0163163_10053857
439 Ga0157377_10002592
440 Ga0157376_10504837
441 Ga0207656_10275532
442 Ga0207692_10518430
443 Ga0207710_10057333
444 Ga0207688_10366192
445 Ga0207647_10326697
446 Ga0207645_10299125
447 Ga0207684_10019785
448 Ga0207662_10078761
449 Ga0207652_10146038
450 Ga0207646_10015894
451 Ga0207646_10116371
452 Ga0207646_10386926
453 Ga0207646_10387853
454 Ga0207681_10510963
455 Ga0207650_10100115
456 Ga0207659_10005894
457 Ga0207690_10037656
458 Ga0207706_10008964
459 Ga0207709_10601771
460 Ga0207669_10839272
461 Ga0207665_10046022
462 Ga0207689_10020700
463 Ga0207689_10066929
464 Ga0207661_10001661
465 Ga0207661_10071672
466 Ga0207679_10023058
467 Ga0207679_10128391
468 Ga0207712_10248254
469 Ga0207668_10052674
470 Ga0207658_10027105
471 Ga0207658_10107875
472 Ga0207658_10156841
473 Ga0207658_10433103
474 Ga0207677_10005587
475 Ga0207639_10173670
476 Ga0207639_11415390
477 Ga0207678_10133424
478 Ga0207708_11065923
479 Ga0207674_10259967
480 Ga0207674_10563816
481 Ga0207674_11187949
482 Ga0207675_100115610
483 Ga0207683_10626105
484 Ga0207683_11282297
485 Ga0207698_10049509
486 Ga0209588_1000097
487 Ga0268266_10263802
488 Ga0268265_10181996
489 Ga0268265_10325229
490 Ga0268265_11557050
491 Ga0268264_10121803
492 Ga0268264_10844540
493 Ga0268264_12042745
494 Ga0307515_10084822
495 Ga0307515_10315367
496 Ga0307515_10517627
497 Ga0307515_10537208
498 Ga0307512_10002888
499 Ga0307512_10142601
500 Ga0316176_1041716
501 Ga0307513_10033956
502 Ga0307513_10089334
503 Ga0307513_10122021
504 Ga0307513_10710186
505 Ga0307513_10746813
506 Ga0307408_100704926
507 Ga0307408_101336720
508 Ga0307408_101344232
509 Ga0307508_10000927
510 Ga0307508_10173295
511 Ga0307516_10042794
512 Ga0307405_10131510
513 Ga0307405_10963348
514 Ga0307405_11345408
515 Ga0307405_11580603
516 Ga0307413_10097301
517 Ga0326468_10011882
518 Ga0307406_10013419
519 Ga0307406_10056349
520 Ga0307406_11472870
521 Ga0307407_10083143
522 Ga0307412_10997271
523 Ga0307412_11559263
524 Ga0307409_100253403
525 Ga0307409_100778638
526 Ga0307409_100932993
527 Ga0307416_100987699
528 Ga0307416_101317579
529 Ga0307416_101948941
530 Ga0307416_102533134
531 Ga0307414_11291838
532 Ga0307411_10071893
533 Ga0307415_100093978
534 Ga0307415_100111891
535 Ga0307415_100196928
536 Ga0307415_101921256
537 Ga0307415_102413155
538 Ga0307507_10015298
539 Ga0307510_10266484
540 Ga0307510_10441776
541 Ga0373948_0019793
542 Ga0373928_0030502
543 Ga0373951_0000018
544 Ga0373941_0029729
545 Ga0373942_0001200
546 Ga0373931_0326881
547 Ga0395898_0623277
548 Ga0395901_1020206
549 Ga0451789_0818633
550 Ga0451791_0223188
551 Ga0451800_1194498
552 Ga0451802_0539878
553 Ga0451841_0064743
554 Ga0451849_1504121
555 Ga0439449_0007416
556 Ga0439463_066373
557 Ga0439459_0024619
558 Ga0466969_0013367
559 Ga0466965_0373212
560 Ga0466966_0006242
561 Ga0466966_0154705
562 Ga0466961_0036724
563 Ga0466961_0175306
564 Ga0466971_0281872
565 Ga0466970_0002626
566 Ga0466970_0763842
567 Ga0466959_0007610
568 Ga0495585_0186047
569 Ga0495596_0141665
570 Ga0495606_0000885
571 Ga0495587_0556610
572 Ga0495668_0000620
573 Ga0495625_0000968
574 Ga0495626_0000113
575 Ga0496104_0340422
576 Ga0496108_0532067
577 Ga0496108_0717607
578 Ga0496109_0491241
579 Ga0496109_1363671
580 Ga0496110_0531315
581 Ga0496112_0056300
582 Ga0496113_0360914
583 Ga0496124_0451980
584 Ga0501036_0455489
585 Ga0501043_0142035
586 Ga0501048_0722603
587 nmdc:mga00v17_246408_c1
588 nmdc:mga0yw44_18481_c1
589 nmdc:mga0yw44_60366_c1
590 nmdc:mga07m45_147406_c1
591 nmdc:mga07m45_746777_c1
592 nmdc:mga05p37_1018225_c1
593 nmdc:mga05p37_10954_c1
594 nmdc:mga09592_1209402_c1
595 nmdc:mga09592_143953_c1
596 nmdc:mga09592_464936_c1
597 nmdc:mga06r32_203930_c1
598 nmdc:mga08y16_1421787_c1
599 nmdc:mga08y16_1543_c1
600 nmdc:mga0sz30_129225_c1
601 Ga0495619_0356153
602 Ga0500644_0540326
603 Ga0500641_0017713
604 Ga0500562_160322
605 Ga0500573_0000011
606 Ga0500573_0004309
607 Ga0500600_0044790
608 Ga0500630_138514
609 Ga0466962_0090896
610 2515856710
611 2559429589
612 2586059156
613 2588107511
614 2676492988
615 2774393505
616 2795794541
617 2809195603
618 2809592090
619 2812350501
620 2816422603
621 2816504669
622 2856741728
623 2887485857
624 2891566243
625 2891971897
626 2899364062
627 2915769548
628 2917743330
629 2946026612
630 8001785005
631 8003322665
632 8047715590

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

15

87

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3elk-assembly1.cif.gz_B crystal structure of putative transcriptional regulator ta0346 from thermoplasma acidophilum 0.843 5 96
6abt-assembly1.cif.gz_A crystal structure of transcription factor from listeria monocytogenes 0.8398 7 95
5zqh-assembly1.cif.gz_A-2 crystal structure of streptococcus transcriptional regulator 0.8378 5 95
3hhh-assembly1.cif.gz_B crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.826 2 95
5zhv-assembly1.cif.gz_B crystal structure of the padr-family transcriptional regulator rv3488 of mycobacterium tuberculosis h37rv in complex with zinc ion 0.826 3 91
ID Description Score Start End Superfamily
5zqhA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8378 5 95 1.10.10.10
4esbA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8213 5 96 1.10.10.10
af_Q2FUS4_1_110_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8183 1 96 1.10.10.10
5dymA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8178 11 96 1.10.10.10
5h20A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8149 3 95 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7X5R319-F1-model_v4 PadR family transcriptional regulator PadR 0.8478 1 101
AF-A0A7X1LV20-F1-model_v4 deleted 0.847 1 96
AF-A0A150L7R7-F1-model_v4 PadR family transcriptional regulator 0.8392 1 98
AF-A0A523AMN2-F1-model_v4 Transcription regulator PadR N-terminal domain-containing protein 0.8366 8 96
AF-A0A7J2TCF3-F1-model_v4 PadR family transcriptional regulator 0.8327 9 102

Map