F403643

General Info

Members Datasets Scaffolds Average Seq Length
316 143 632 67

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10556747|Ga0111539_105567472
Length 77
Sequence MILPQGGQSMRFPRVLVSMLALLAXXXXAAPIAALEVGDKAPAFALNGPDGKPVKLEDLTAKGPIVLYTFVAAFTPT

Samples

Sample ID Description Type Environment
1 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
7 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
15 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
24 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
33 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
36 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
37 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
38 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
39 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
40 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
41 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
42 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
50 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
51 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
67 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
69 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
71 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
72 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
73 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
74 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
75 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
76 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
77 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
78 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
79 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
80 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
81 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
82 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
83 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
84 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
85 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
86 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
87 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
88 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
89 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
90 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
91 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
92 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
93 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
94 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
95 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
96 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
97 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
98 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
99 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
100 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
101 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
102 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
103 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
104 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
105 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
106 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
107 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
109 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
110 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
111 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
112 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
113 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
114 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
115 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
116 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
117 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
118 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
119 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
120 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
121 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
122 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
123 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
124 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
125 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
126 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
127 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
128 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
129 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
130 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
131 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
132 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
133 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
134 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
135 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
136 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
137 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
138 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
139 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
140 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
141 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
142 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
143 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.42
Metatranscriptomes 1.58
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.27
Rhizosphere 98.1
Stem 0
Stem Tuber 0
Unclassified 24.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0111539_10556747 3300009094 Bacteria 1335
2 JGI25406J46586_10025243 3300003203 Unclassified 2310
3 Ga0058859_11401456 3300004798 Unclassified 851
4 Ga0058863_11697093 3300004799 Unclassified 593
5 Ga0058861_11649704 3300004800 Unclassified 608
6 Ga0058860_11463633 3300004801 Unclassified 624
7 Ga0058862_12575548 3300004803 Bacteria 1357
8 Ga0065712_10574038 3300005290 Unclassified 605
9 Ga0065707_10817523 3300005295 Bacteria 593
10 Ga0070680_100107633 3300005336 Bacteria 2319
11 Ga0070660_101717980 3300005339 Unclassified 534
12 Ga0070689_100091848 3300005340 Bacteria 2394
13 Ga0070689_100615708 3300005340 Bacteria 942
14 Ga0070701_10084605 3300005438 Bacteria 1725
15 Ga0070705_100601004 3300005440 Unclassified 851
16 Ga0070705_100657330 3300005440 Bacteria 818
17 Ga0070700_100264836 3300005441 Bacteria 1239
18 Ga0070694_100064642 3300005444 Bacteria 2505
19 Ga0070694_100768112 3300005444 Bacteria 788
20 Ga0070708_100108164 3300005445 Bacteria 2553
21 Ga0070708_100120473 3300005445 Unclassified 2420
22 Ga0070708_100300784 3300005445 Bacteria 1511
23 Ga0070681_10161622 3300005458 Bacteria 2164
24 Ga0070706_100126290 3300005467 Unclassified 2385
25 Ga0070706_100242845 3300005467 Bacteria 1681
26 Ga0070706_100346172 3300005467 Bacteria 1386
27 Ga0070706_100829429 3300005467 Unclassified 855
28 Ga0070706_101174302 3300005467 Bacteria 706
29 Ga0070707_100001672 3300005468 Bacteria 21429
30 Ga0070707_100121381 3300005468 Bacteria 2537
31 Ga0070707_100186884 3300005468 Unclassified 2020
32 Ga0070707_100337068 3300005468 Unclassified 1465
33 Ga0070707_100365081 3300005468 Bacteria 1403
34 Ga0070707_100445944 3300005468 Unclassified 1255
35 Ga0070698_100058520 3300005471 Bacteria 3896
36 Ga0070698_100096011 3300005471 Bacteria 2941
37 Ga0070698_100107386 3300005471 Bacteria 2759
38 Ga0070698_100135785 3300005471 Unclassified 2414
39 Ga0070698_100871784 3300005471 Unclassified 845
40 Ga0070699_100007156 3300005518 Bacteria 9695
41 Ga0070699_100051526 3300005518 Plasmid 3563
42 Ga0070699_100076318 3300005518 Bacteria 2917
43 Ga0070699_100491314 3300005518 Unclassified 1114
44 Ga0070699_100665704 3300005518 Bacteria 950
45 Ga0070699_100688952 3300005518 Bacteria 933
46 Ga0070679_100154294 3300005530 Bacteria 2272
47 Ga0070697_100003610 3300005536 Bacteria 11886
48 Ga0070697_100017821 3300005536 Bacteria 5592
49 Ga0070697_100088409 3300005536 Bacteria 2558
50 Ga0070697_100161891 3300005536 Unclassified 1891
51 Ga0070697_101757659 3300005536 Unclassified 555
52 Ga0070695_100050654 3300005545 Bacteria 2662
53 Ga0070695_100647358 3300005545 Unclassified 834
54 Ga0070696_100850999 3300005546 Bacteria 754
55 Ga0070696_101036698 3300005546 Unclassified 687
56 Ga0070696_101157943 3300005546 Unclassified 652
57 Ga0070704_100022237 3300005549 Bacteria 4124
58 Ga0068859_101236723 3300005617 Unclassified 823
59 Ga0068861_100129209 3300005719 Bacteria 2049
60 Ga0068862_100677874 3300005844 Bacteria 997
61 Ga0081455_10260373 3300005937 Bacteria 1263
62 Ga0081540_1138020 3300005983 Unclassified 984
63 Ga0081539_10000396 3300005985 Bacteria 93686
64 Ga0075428_100000318 3300006844 Bacteria 47610
65 Ga0075428_100010250 3300006844 Bacteria 10404
66 Ga0075428_100015075 3300006844 Bacteria 8586
67 Ga0075428_100023993 3300006844 Bacteria 6750
68 Ga0075428_100751109 3300006844 Bacteria 1038
69 Ga0075428_101145436 3300006844 Unclassified 821
70 Ga0075428_101242332 3300006844 Unclassified 785
71 Ga0075430_100000843 3300006846 Bacteria 24035
72 Ga0075430_100004302 3300006846 Bacteria 12023
73 Ga0075430_100088601 3300006846 Bacteria 2590
74 Ga0075430_100102207 3300006846 Bacteria 2393
75 Ga0075430_100106183 3300006846 Bacteria 2343
76 Ga0075430_100113545 3300006846 Bacteria 2258
77 Ga0075431_100000385 3300006847 Bacteria 35359
78 Ga0075431_100001083 3300006847 Bacteria 24362
79 Ga0075431_100001929 3300006847 Bacteria 19745
80 Ga0075431_100001931 3300006847 Bacteria 19743
81 Ga0075431_100032237 3300006847 Bacteria 5400
82 Ga0075431_100049431 3300006847 Bacteria 4335
83 Ga0075431_100238142 3300006847 Bacteria 1852
84 Ga0075431_100343811 3300006847 Bacteria 1501
85 Ga0075431_100490958 3300006847 Bacteria 1220
86 Ga0075433_10002891 3300006852 Bacteria 13167
87 Ga0075433_10005006 3300006852 Bacteria 10378
88 Ga0075433_10433255 3300006852 Unclassified 1159
89 Ga0075433_11164828 3300006852 Bacteria 669
90 Ga0075433_11396726 3300006852 Bacteria 606
91 Ga0075434_100005379 3300006871 Bacteria 11648
92 Ga0075434_100031750 3300006871 Bacteria 5208
93 Ga0075434_100167504 3300006871 Bacteria 2217
94 Ga0075434_100215658 3300006871 Bacteria 1939
95 Ga0075429_100000112 3300006880 Bacteria 46825
96 Ga0075429_100002159 3300006880 Bacteria 16411
97 Ga0075429_100009971 3300006880 Bacteria 8234
98 Ga0075429_100016668 3300006880 Bacteria 6363
99 Ga0075429_100047883 3300006880 Bacteria 3718
100 Ga0075429_100285641 3300006880 Unclassified 1445
101 Ga0068865_100462566 3300006881 Bacteria 1051
102 Ga0075436_100000973 3300006914 Bacteria 19213
103 Ga0075436_100230465 3300006914 Unclassified 1316
104 Ga0075436_100726510 3300006914 Bacteria 737
105 Ga0097620_101236687 3300006931 Unclassified 823
106 Ga0075435_100011575 3300007076 Bacteria 6499
107 Ga0075435_100024937 3300007076 Bacteria 4649
108 Ga0099794_10304646 3300007265 Bacteria 825
109 Ga0099794_10450255 3300007265 Unclassified 675
110 Ga0099794_10647370 3300007265 Bacteria 561
111 Ga0111539_12129197 3300009094 Bacteria 651
112 Ga0114129_10001083 3300009147 Bacteria 35717
113 Ga0114129_10003512 3300009147 Bacteria 22054
114 Ga0114129_10006020 3300009147 Bacteria 17192
115 Ga0114129_10006303 3300009147 Bacteria 16822
116 Ga0114129_10030161 3300009147 Bacteria 7681
117 Ga0114129_10030519 3300009147 Bacteria 7627
118 Ga0114129_10089569 3300009147 Bacteria 4265
119 Ga0114129_10134922 3300009147 Bacteria 3387
120 Ga0114129_10155118 3300009147 Bacteria 3132
121 Ga0114129_10235064 3300009147 Bacteria 2466
122 Ga0114129_11591695 3300009147 Bacteria 800
123 Ga0114129_11763064 3300009147 Unclassified 754
124 Ga0114129_12983603 3300009147 Bacteria 557
125 Ga0105241_12152053 3300009174 Unclassified 552
126 Ga0105242_10831985 3300009176 Bacteria 917
127 Ga0163162_11754107 3300013306 Bacteria 709
128 Ga0163162_12689410 3300013306 Bacteria 573
129 Ga0157380_11152131 3300014326 Unclassified 817
130 Ga0157377_11610537 3300014745 Unclassified 520
131 Ga0207688_10855048 3300025901 Unclassified 576
132 Ga0207684_10012928 3300025910 Bacteria 7229
133 Ga0207684_10036623 3300025910 Bacteria 4164
134 Ga0207684_10062068 3300025910 Bacteria 3173
135 Ga0207684_10177738 3300025910 Bacteria 1835
136 Ga0207684_10265128 3300025910 Bacteria 1482
137 Ga0207684_10805523 3300025910 Bacteria 794
138 Ga0207707_10161541 3300025912 Bacteria 1958
139 Ga0207660_10008444 3300025917 Bacteria 6661
140 Ga0207652_11256689 3300025921 Unclassified 643
141 Ga0207646_10001883 3300025922 Bacteria 25291
142 Ga0207646_10005294 3300025922 Bacteria 13598
143 Ga0207646_10023523 3300025922 Bacteria 5659
144 Ga0207646_10078974 3300025922 Bacteria 2942
145 Ga0207646_10182535 3300025922 Unclassified 1895
146 Ga0207646_10190681 3300025922 Unclassified 1851
147 Ga0207646_10489712 3300025922 Bacteria 1108
148 Ga0207681_10946738 3300025923 Bacteria 722
149 Ga0207650_11207001 3300025925 Unclassified 644
150 Ga0207709_10145565 3300025935 Bacteria 1634
151 Ga0207670_10033481 3300025936 Bacteria 3312
152 Ga0207704_10388106 3300025938 Bacteria 1098
153 Ga0207665_10665814 3300025939 Unclassified 817
154 Ga0207639_12035831 3300026041 Unclassified 535
155 Ga0207708_10174817 3300026075 Bacteria 1702
156 Ga0207675_100381262 3300026118 Unclassified 1386
157 Ga0209999_1047161 3300027543 Unclassified 811
158 Ga0209588_1033477 3300027671 Bacteria 1648
159 Ga0209588_1208713 3300027671 Bacteria 607
160 Ga0209971_1159642 3300027682 Bacteria 556
161 Ga0209966_1006522 3300027695 Unclassified 2028
162 Ga0209998_10023298 3300027717 Unclassified 1338
163 Ga0209974_10078703 3300027876 Unclassified 1131
164 Ga0307408_100598345 3300031548 Bacteria 979
165 Ga0307408_100608332 3300031548 Bacteria 972
166 Ga0307408_101157323 3300031548 Bacteria 720
167 Ga0307405_10068590 3300031731 Bacteria 2270
168 Ga0307407_10384325 3300031903 Unclassified 1003
169 Ga0307412_10079111 3300031911 Bacteria 2267
170 Ga0307409_100201694 3300031995 Bacteria 1780
171 Ga0307409_101384829 3300031995 Bacteria 729
172 Ga0307416_101194811 3300032002 Bacteria 866
173 Ga0307411_12250729 3300032005 Bacteria 511
174 Ga0307415_101029429 3300032126 Bacteria 767
175 Ga0373930_0093288 3300034816 Unclassified 708
176 Ga0373959_0132812 3300034820 Unclassified 617
177 Ga0373940_0064400 3300035088 Bacteria 1055
178 Ga0373952_0086664 3300035092 Unclassified 807
179 Ga0373932_0024625 3300035112 Bacteria 1622
180 Ga0373941_0008250 3300035115 Bacteria 2581
181 Ga0373960_0257290 3300035121 Bacteria 636
182 Ga0373961_0148288 3300035241 Unclassified 797
183 Ga0373931_0002121 3300035691 Bacteria 8739
184 Ga0395899_0354011 3300037312 Bacteria 981
185 Ga0395900_0202934 3300037418 Bacteria 2005
186 Ga0395905_0059393 3300037471 Bacteria 3575
187 Ga0395901_0151255 3300038443 Bacteria 2439
188 Ga0439456_127199 3300042013 Unclassified 586
189 Ga0451577_1165076 3300042876 Bacteria 688
190 Ga0451576_2193745 3300045051 Unclassified 567
191 Ga0496102_0007314 3300048905 Bacteria 9425
192 Ga0496106_0481310 3300048909 Bacteria 997
193 Ga0496108_0275925 3300048911 Unclassified 1464
194 Ga0496109_1488172 3300048912 Unclassified 612
195 Ga0501299_086718 3300049522 Unclassified 705
196 Ga0501299_174364 3300049522 Unclassified 558
197 Ga0501299_188100 3300049522 Bacteria 543
198 Ga0501031_0284217 3300049568 Bacteria 1073
199 Ga0501033_0030492 3300049570 Bacteria 4053
200 Ga0501033_0167569 3300049570 Unclassified 1579
201 Ga0501036_0113302 3300049572 Bacteria 2292
202 Ga0501036_1034505 3300049572 Bacteria 672
203 Ga0501037_0657838 3300049573 Unclassified 700
204 Ga0501038_0147601 3300049574 Bacteria 1919
205 Ga0501039_0023016 3300049575 Bacteria 4779
206 Ga0501040_0302770 3300049576 Unclassified 1143
207 Ga0501040_0445804 3300049576 Bacteria 932
208 Ga0501040_0713305 3300049576 Unclassified 725
209 Ga0501041_0063921 3300049577 Bacteria 2253
210 Ga0501041_0541696 3300049577 Bacteria 741
211 Ga0501042_0171073 3300049578 Bacteria 1567
212 Ga0501043_0219013 3300049579 Unclassified 1473
213 Ga0501043_1025776 3300049579 Bacteria 586
214 Ga0501046_0192364 3300049580 Bacteria 1521
215 Ga0501046_0265576 3300049580 Bacteria 1260
216 Ga0501046_0450100 3300049580 Unclassified 926
217 Ga0501046_0534665 3300049580 Bacteria 837
218 Ga0501046_1060099 3300049580 Bacteria 561
219 Ga0501048_0054789 3300049582 Bacteria 2833
220 Ga0501048_0062307 3300049582 Bacteria 2640
221 Ga0501068_0712639 3300049584 Bacteria 656
222 Ga0501069_0668095 3300049585 Bacteria 626
223 Ga0501071_0642467 3300049587 Bacteria 816
224 Ga0501071_0705631 3300049587 Bacteria 777
225 Ga0501071_0781023 3300049587 Bacteria 736
226 Ga0501072_0010133 3300049588 Bacteria 7175
227 Ga0501072_0040873 3300049588 Bacteria 3642
228 Ga0501072_0604123 3300049588 Bacteria 865
229 Ga0501073_0252740 3300049589 Unclassified 1217
230 Ga0501074_0201736 3300049590 Bacteria 1417
231 Ga0501075_0028685 3300049591 Bacteria 4109
232 Ga0501075_0061567 3300049591 Bacteria 2828
233 Ga0501075_0173362 3300049591 Bacteria 1646
234 Ga0501075_0455684 3300049591 Bacteria 975
235 Ga0501076_0003170 3300049592 Bacteria 11469
236 Ga0501076_0552962 3300049592 Bacteria 949
237 Ga0501076_1665646 3300049592 Bacteria 523
238 Ga0501077_0016753 3300049593 Bacteria 4621
239 Ga0501077_0020563 3300049593 Bacteria 4178
240 Ga0501229_075070 3300049706 Bacteria 534
241 Ga0501234_057341 3300049707 Bacteria 656
242 Ga0501079_0010907 3300049741 Bacteria 6922
243 Ga0501079_0015441 3300049741 Bacteria 5827
244 Ga0501079_0669256 3300049741 Unclassified 817
245 Ga0501080_0132422 3300049742 Bacteria 2308
246 Ga0501080_1754674 3300049742 Bacteria 522
247 Ga0501081_0009667 3300049743 Bacteria 6285
248 Ga0501081_0026034 3300049743 Bacteria 3941
249 Ga0501081_0224295 3300049743 Bacteria 1367
250 Ga0501081_0476190 3300049743 Bacteria 929
251 Ga0501081_1012234 3300049743 Bacteria 628
252 Ga0501083_0139766 3300049744 Unclassified 1586
253 Ga0501083_0330712 3300049744 Unclassified 991
254 Ga0501035_0930877 3300049822 Bacteria 687
255 Ga0501035_1465293 3300049822 Bacteria 521
256 Ga0501044_0675926 3300049823 Unclassified 920
257 Ga0501045_0001069 3300049824 Bacteria 18104
258 Ga0501045_0147033 3300049824 Bacteria 1753
259 nmdc:mga05p37_1184325_c1 3300050507 Bacteria 791
260 nmdc:mga05p37_1400776_c1 3300050507 Bacteria 704
261 nmdc:mga05p37_145625_c1 3300050507 Bacteria 2901
262 nmdc:mga05p37_1956012_c1 3300050507 Bacteria 557
263 nmdc:mga05p37_21250_c1 3300050507 Bacteria 7857
264 nmdc:mga05p37_2389_c1 3300050507 Bacteria 21838
265 nmdc:mga05p37_34777_c1 3300050507 Bacteria 6173
266 nmdc:mga05p37_3478_c1 3300050507 Bacteria 18403
267 nmdc:mga05p37_41578_c1 3300050507 Bacteria 5644
268 nmdc:mga05p37_5088_c2 3300050507 Bacteria 8719
269 nmdc:mga05p37_515013_c1 3300050507 Bacteria 1370
270 nmdc:mga05p37_70808_c1 3300050507 Bacteria 4290
271 nmdc:mga05p37_819933_c1 3300050507 Bacteria 1015
272 nmdc:mga09592_11866_c1 3300050508 Bacteria 7088
273 nmdc:mga09592_26832_c1 3300050508 Bacteria 4775
274 nmdc:mga09592_384929_c1 3300050508 Bacteria 1213
275 nmdc:mga09592_4526_c1 3300050508 Bacteria 11246
276 nmdc:mga09592_4918_c1 3300050508 Bacteria 10833
277 nmdc:mga09592_760234_c1 3300050508 Bacteria 822
278 nmdc:mga09592_8159_c1 3300050508 Bacteria 8516
279 nmdc:mga0qj67_183231_c1 3300050509 Bacteria 1701
280 nmdc:mga0qj67_2033_c1 3300050509 Bacteria 14434
281 nmdc:mga0qj67_347150_c1 3300050509 Unclassified 1200
282 nmdc:mga0qj67_61589_c1 3300050509 Bacteria 2979
283 nmdc:mga0qj67_881685_c1 3300050509 Unclassified 706
284 nmdc:mga0qj67_962_c1 3300050509 Bacteria 19827
285 nmdc:mga06r32_1046680_c1 3300050510 Bacteria 767
286 nmdc:mga06r32_12040_c1 3300050510 Bacteria 7795
287 nmdc:mga06r32_163181_c1 3300050510 Bacteria 2211
288 nmdc:mga06r32_164137_c1 3300050510 Bacteria 2204
289 nmdc:mga06r32_2181_c1 3300050510 Bacteria 17541
290 nmdc:mga06r32_23934_c1 3300050510 Bacteria 5660
291 nmdc:mga06r32_63577_c1 3300050510 Bacteria 3558
292 nmdc:mga06r32_825_c1 3300050510 Bacteria 27452
293 nmdc:mga08y16_1259175_c1 3300050511 Bacteria 708
294 nmdc:mga08y16_355489_c1 3300050511 Bacteria 1504
295 nmdc:mga0n895_15263_c1 3300050512 Bacteria 6999
296 nmdc:mga0n895_159981_c1 3300050512 Bacteria 2283
297 nmdc:mga0n895_50850_c1 3300050512 Bacteria 4064
298 nmdc:mga0n895_803_c1 3300050512 Bacteria 22459
299 nmdc:mga0rr50_1123378_c1 3300050513 Unclassified 668
300 nmdc:mga0rr50_115068_c1 3300050513 Bacteria 2134
301 nmdc:mga08x19_219852_c1 3300050514 Unclassified 1305
302 nmdc:mga08x19_538_c1 3300050514 Bacteria 25060
303 nmdc:mga0a205_317_c1 3300050515 Bacteria 35903
304 nmdc:mga0a205_756_c1 3300050515 Bacteria 26070
305 nmdc:mga0a205_805658_c1 3300050515 Unclassified 787
306 nmdc:mga0a205_88958_c1 3300050515 Bacteria 2985
307 nmdc:mga0a205_977170_c1 3300050515 Bacteria 694
308 Ga0501084_0018019 3300054114 Bacteria 5880
309 Ga0501084_0064252 3300054114 Bacteria 3072
310 Ga0501084_0173190 3300054114 Bacteria 1821
311 Ga0590075_022606 3300059424 Bacteria 1574
312 Ga0501082_0059866 3300060353 Bacteria 3281
313 Ga0501082_0134953 3300060353 Bacteria 2141
314 Ga0530510_0043068 3300061734 Bacteria 3260
315 Ga0530510_0175289 3300061734 Unclassified 1589
316 Ga0530510_1458496 3300061734 Unclassified 525
317 Ga0111539_10556747
318 JGI25406J46586_10025243
319 Ga0058859_11401456
320 Ga0058863_11697093
321 Ga0058861_11649704
322 Ga0058860_11463633
323 Ga0058862_12575548
324 Ga0065712_10574038
325 Ga0065707_10817523
326 Ga0070680_100107633
327 Ga0070660_101717980
328 Ga0070689_100091848
329 Ga0070689_100615708
330 Ga0070701_10084605
331 Ga0070705_100601004
332 Ga0070705_100657330
333 Ga0070700_100264836
334 Ga0070694_100064642
335 Ga0070694_100768112
336 Ga0070708_100108164
337 Ga0070708_100120473
338 Ga0070708_100300784
339 Ga0070681_10161622
340 Ga0070706_100126290
341 Ga0070706_100242845
342 Ga0070706_100346172
343 Ga0070706_100829429
344 Ga0070706_101174302
345 Ga0070707_100001672
346 Ga0070707_100121381
347 Ga0070707_100186884
348 Ga0070707_100337068
349 Ga0070707_100365081
350 Ga0070707_100445944
351 Ga0070698_100058520
352 Ga0070698_100096011
353 Ga0070698_100107386
354 Ga0070698_100135785
355 Ga0070698_100871784
356 Ga0070699_100007156
357 Ga0070699_100051526
358 Ga0070699_100076318
359 Ga0070699_100491314
360 Ga0070699_100665704
361 Ga0070699_100688952
362 Ga0070679_100154294
363 Ga0070697_100003610
364 Ga0070697_100017821
365 Ga0070697_100088409
366 Ga0070697_100161891
367 Ga0070697_101757659
368 Ga0070695_100050654
369 Ga0070695_100647358
370 Ga0070696_100850999
371 Ga0070696_101036698
372 Ga0070696_101157943
373 Ga0070704_100022237
374 Ga0068859_101236723
375 Ga0068861_100129209
376 Ga0068862_100677874
377 Ga0081455_10260373
378 Ga0081540_1138020
379 Ga0081539_10000396
380 Ga0075428_100000318
381 Ga0075428_100010250
382 Ga0075428_100015075
383 Ga0075428_100023993
384 Ga0075428_100751109
385 Ga0075428_101145436
386 Ga0075428_101242332
387 Ga0075430_100000843
388 Ga0075430_100004302
389 Ga0075430_100088601
390 Ga0075430_100102207
391 Ga0075430_100106183
392 Ga0075430_100113545
393 Ga0075431_100000385
394 Ga0075431_100001083
395 Ga0075431_100001929
396 Ga0075431_100001931
397 Ga0075431_100032237
398 Ga0075431_100049431
399 Ga0075431_100238142
400 Ga0075431_100343811
401 Ga0075431_100490958
402 Ga0075433_10002891
403 Ga0075433_10005006
404 Ga0075433_10433255
405 Ga0075433_11164828
406 Ga0075433_11396726
407 Ga0075434_100005379
408 Ga0075434_100031750
409 Ga0075434_100167504
410 Ga0075434_100215658
411 Ga0075429_100000112
412 Ga0075429_100002159
413 Ga0075429_100009971
414 Ga0075429_100016668
415 Ga0075429_100047883
416 Ga0075429_100285641
417 Ga0068865_100462566
418 Ga0075436_100000973
419 Ga0075436_100230465
420 Ga0075436_100726510
421 Ga0097620_101236687
422 Ga0075435_100011575
423 Ga0075435_100024937
424 Ga0099794_10304646
425 Ga0099794_10450255
426 Ga0099794_10647370
427 Ga0111539_12129197
428 Ga0114129_10001083
429 Ga0114129_10003512
430 Ga0114129_10006020
431 Ga0114129_10006303
432 Ga0114129_10030161
433 Ga0114129_10030519
434 Ga0114129_10089569
435 Ga0114129_10134922
436 Ga0114129_10155118
437 Ga0114129_10235064
438 Ga0114129_11591695
439 Ga0114129_11763064
440 Ga0114129_12983603
441 Ga0105241_12152053
442 Ga0105242_10831985
443 Ga0163162_11754107
444 Ga0163162_12689410
445 Ga0157380_11152131
446 Ga0157377_11610537
447 Ga0207688_10855048
448 Ga0207684_10012928
449 Ga0207684_10036623
450 Ga0207684_10062068
451 Ga0207684_10177738
452 Ga0207684_10265128
453 Ga0207684_10805523
454 Ga0207707_10161541
455 Ga0207660_10008444
456 Ga0207652_11256689
457 Ga0207646_10001883
458 Ga0207646_10005294
459 Ga0207646_10023523
460 Ga0207646_10078974
461 Ga0207646_10182535
462 Ga0207646_10190681
463 Ga0207646_10489712
464 Ga0207681_10946738
465 Ga0207650_11207001
466 Ga0207709_10145565
467 Ga0207670_10033481
468 Ga0207704_10388106
469 Ga0207665_10665814
470 Ga0207639_12035831
471 Ga0207708_10174817
472 Ga0207675_100381262
473 Ga0209999_1047161
474 Ga0209588_1033477
475 Ga0209588_1208713
476 Ga0209971_1159642
477 Ga0209966_1006522
478 Ga0209998_10023298
479 Ga0209974_10078703
480 Ga0307408_100598345
481 Ga0307408_100608332
482 Ga0307408_101157323
483 Ga0307405_10068590
484 Ga0307407_10384325
485 Ga0307412_10079111
486 Ga0307409_100201694
487 Ga0307409_101384829
488 Ga0307416_101194811
489 Ga0307411_12250729
490 Ga0307415_101029429
491 Ga0373930_0093288
492 Ga0373959_0132812
493 Ga0373940_0064400
494 Ga0373952_0086664
495 Ga0373932_0024625
496 Ga0373941_0008250
497 Ga0373960_0257290
498 Ga0373961_0148288
499 Ga0373931_0002121
500 Ga0395899_0354011
501 Ga0395900_0202934
502 Ga0395905_0059393
503 Ga0395901_0151255
504 Ga0439456_127199
505 Ga0451577_1165076
506 Ga0451576_2193745
507 Ga0496102_0007314
508 Ga0496106_0481310
509 Ga0496108_0275925
510 Ga0496109_1488172
511 Ga0501299_086718
512 Ga0501299_174364
513 Ga0501299_188100
514 Ga0501031_0284217
515 Ga0501033_0030492
516 Ga0501033_0167569
517 Ga0501036_0113302
518 Ga0501036_1034505
519 Ga0501037_0657838
520 Ga0501038_0147601
521 Ga0501039_0023016
522 Ga0501040_0302770
523 Ga0501040_0445804
524 Ga0501040_0713305
525 Ga0501041_0063921
526 Ga0501041_0541696
527 Ga0501042_0171073
528 Ga0501043_0219013
529 Ga0501043_1025776
530 Ga0501046_0192364
531 Ga0501046_0265576
532 Ga0501046_0450100
533 Ga0501046_0534665
534 Ga0501046_1060099
535 Ga0501048_0054789
536 Ga0501048_0062307
537 Ga0501068_0712639
538 Ga0501069_0668095
539 Ga0501071_0642467
540 Ga0501071_0705631
541 Ga0501071_0781023
542 Ga0501072_0010133
543 Ga0501072_0040873
544 Ga0501072_0604123
545 Ga0501073_0252740
546 Ga0501074_0201736
547 Ga0501075_0028685
548 Ga0501075_0061567
549 Ga0501075_0173362
550 Ga0501075_0455684
551 Ga0501076_0003170
552 Ga0501076_0552962
553 Ga0501076_1665646
554 Ga0501077_0016753
555 Ga0501077_0020563
556 Ga0501229_075070
557 Ga0501234_057341
558 Ga0501079_0010907
559 Ga0501079_0015441
560 Ga0501079_0669256
561 Ga0501080_0132422
562 Ga0501080_1754674
563 Ga0501081_0009667
564 Ga0501081_0026034
565 Ga0501081_0224295
566 Ga0501081_0476190
567 Ga0501081_1012234
568 Ga0501083_0139766
569 Ga0501083_0330712
570 Ga0501035_0930877
571 Ga0501035_1465293
572 Ga0501044_0675926
573 Ga0501045_0001069
574 Ga0501045_0147033
575 nmdc:mga05p37_1184325_c1
576 nmdc:mga05p37_1400776_c1
577 nmdc:mga05p37_145625_c1
578 nmdc:mga05p37_1956012_c1
579 nmdc:mga05p37_21250_c1
580 nmdc:mga05p37_2389_c1
581 nmdc:mga05p37_34777_c1
582 nmdc:mga05p37_3478_c1
583 nmdc:mga05p37_41578_c1
584 nmdc:mga05p37_5088_c2
585 nmdc:mga05p37_515013_c1
586 nmdc:mga05p37_70808_c1
587 nmdc:mga05p37_819933_c1
588 nmdc:mga09592_11866_c1
589 nmdc:mga09592_26832_c1
590 nmdc:mga09592_384929_c1
591 nmdc:mga09592_4526_c1
592 nmdc:mga09592_4918_c1
593 nmdc:mga09592_760234_c1
594 nmdc:mga09592_8159_c1
595 nmdc:mga0qj67_183231_c1
596 nmdc:mga0qj67_2033_c1
597 nmdc:mga0qj67_347150_c1
598 nmdc:mga0qj67_61589_c1
599 nmdc:mga0qj67_881685_c1
600 nmdc:mga0qj67_962_c1
601 nmdc:mga06r32_1046680_c1
602 nmdc:mga06r32_12040_c1
603 nmdc:mga06r32_163181_c1
604 nmdc:mga06r32_164137_c1
605 nmdc:mga06r32_2181_c1
606 nmdc:mga06r32_23934_c1
607 nmdc:mga06r32_63577_c1
608 nmdc:mga06r32_825_c1
609 nmdc:mga08y16_1259175_c1
610 nmdc:mga08y16_355489_c1
611 nmdc:mga0n895_15263_c1
612 nmdc:mga0n895_159981_c1
613 nmdc:mga0n895_50850_c1
614 nmdc:mga0n895_803_c1
615 nmdc:mga0rr50_1123378_c1
616 nmdc:mga0rr50_115068_c1
617 nmdc:mga08x19_219852_c1
618 nmdc:mga08x19_538_c1
619 nmdc:mga0a205_317_c1
620 nmdc:mga0a205_756_c1
621 nmdc:mga0a205_805658_c1
622 nmdc:mga0a205_88958_c1
623 nmdc:mga0a205_977170_c1
624 Ga0501084_0018019
625 Ga0501084_0064252
626 Ga0501084_0173190
627 Ga0590075_022606
628 Ga0501082_0059866
629 Ga0501082_0134953
630 Ga0530510_0043068
631 Ga0530510_0175289
632 Ga0530510_1458496

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

37

77

0.93

Map