F403419
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 315 | 209 | 300 | 178 |
Family's Representative Sequence
| Representative Sequence | 3300053146|Ga0500588_0003571|Ga0500588_0003571_1673_2275 |
| Length | 200 |
| Sequence | MHVRIDDKRRVRSYLSSERRRDDMAKEVAIFAGGCFWCTEAVFKSLAGVEEVESGYIGGAVPHPSYKQVCGGDTGHAEAIRVTFDPETISYGDLLDVNFATHDPTTLNRQGNDVGTQYRSAIFPLSDEQRKEAEAGIMRANADYDGRVVTTIEGPAEWYPAENYHQDYWQNEGQRNPYCMAVIPPKLAKLRKGFAERLKA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 2 | 2643221588 | Altererythrobacter sp. Root672 | Isolate | Unclassified |
| 3 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 4 | 2739367664 | Novosphingobium sp. GV002 | Isolate | Unclassified |
| 5 | 2739367865 | Novosphingobium sp. GV013 | Isolate | Unclassified |
| 6 | 2773857759 | Microbacterium sp. 1294 | Isolate | Unclassified |
| 7 | 2818991438 | Novosphingobium barchaimii 1192 | Isolate | Unclassified |
| 8 | 2848297114 | Croceibacterium ferulae EGI 63111 | Isolate | Unclassified |
| 9 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 10 | 2895880812 | Frankia sp. BMG5.11 | Isolate | Unclassified |
| 11 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 12 | 2977251589 | Microbacterium sp. SORGH_AS 505 | Isolate | Unclassified |
| 13 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 14 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 15 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 16 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 17 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 18 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 20 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 21 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 40 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 42 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 43 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 44 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 45 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 46 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 47 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 48 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 49 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 50 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 51 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 52 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 53 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 54 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 55 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 56 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 57 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 58 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 59 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 60 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 61 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 63 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 78 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 109 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 116 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 117 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 118 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 119 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 120 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 121 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 122 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 123 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 124 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 125 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 126 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 127 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 128 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 129 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 130 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 131 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 132 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 133 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 134 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 135 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 143 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 144 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 145 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 146 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 147 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 148 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 149 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 150 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 151 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 152 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 153 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 154 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 155 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 156 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 157 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 158 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 159 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 160 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 161 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 162 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 163 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 164 | 3300049523 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control | Metagenome | Rhizosphere |
| 165 | 3300049551 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 166 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 167 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 168 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 169 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 170 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 171 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 172 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 173 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 174 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 175 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 176 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 177 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 178 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 179 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 180 | 3300049778 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control | Metagenome | Rhizosphere |
| 181 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 182 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 183 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 184 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 185 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 186 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 187 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 188 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 189 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 190 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 191 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 192 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 193 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 194 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 195 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 196 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 197 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 198 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 199 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 200 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 201 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 202 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 203 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 204 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 205 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 206 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 207 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 208 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 209 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.92 |
| Metatranscriptomes | 0.32 |
| Isolates | 4.76 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.95 |
| Bulb | 0 |
| Endosphere | 23.81 |
| Nodule | 0.95 |
| Rhizoplane | 3.17 |
| Rhizosphere | 61.27 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.84 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25165J46597_1000065 | 3300003214 | Bacteria | 199761 |
| 2 | Ga0055536_1000909 | 3300003781 | Bacteria | 19129 |
| 3 | Ga0055536_1005009 | 3300003781 | Bacteria | 6584 |
| 4 | Ga0055530_10000439 | 3300003791 | Bacteria | 36986 |
| 5 | Ga0055530_10053082 | 3300003791 | Bacteria | 932 |
| 6 | Ga0055531_10002007 | 3300003794 | Bacteria | 14133 |
| 7 | Ga0065707_10545170 | 3300005295 | Bacteria | 725 |
| 8 | Ga0070658_10000083 | 3300005327 | Bacteria | 89189 |
| 9 | Ga0070670_100012280 | 3300005331 | Bacteria | 7330 |
| 10 | Ga0070666_10003496 | 3300005335 | Bacteria | 9517 |
| 11 | Ga0070666_10050123 | 3300005335 | Bacteria | 2808 |
| 12 | Ga0070666_10110889 | 3300005335 | Bacteria | 1897 |
| 13 | Ga0070682_100285593 | 3300005337 | Bacteria | 1205 |
| 14 | Ga0070661_100743240 | 3300005344 | Bacteria | 802 |
| 15 | Ga0070668_100004778 | 3300005347 | Bacteria | 10049 |
| 16 | Ga0070668_100032482 | 3300005347 | Bacteria | 3972 |
| 17 | Ga0070668_100712524 | 3300005347 | Bacteria | 886 |
| 18 | Ga0070669_100000110 | 3300005353 | Bacteria | 79144 |
| 19 | Ga0070675_100691412 | 3300005354 | Bacteria | 929 |
| 20 | Ga0070671_100000004 | 3300005355 | Bacteria | 262155 |
| 21 | Ga0070671_100000160 | 3300005355 | Bacteria | 44240 |
| 22 | Ga0070673_100039610 | 3300005364 | Bacteria | 3608 |
| 23 | Ga0070667_100007392 | 3300005367 | Bacteria | 9123 |
| 24 | Ga0070705_100158058 | 3300005440 | Bacteria | 1512 |
| 25 | Ga0070708_100695751 | 3300005445 | Bacteria | 957 |
| 26 | Ga0070663_100578358 | 3300005455 | Bacteria | 942 |
| 27 | Ga0070685_10603206 | 3300005466 | Bacteria | 790 |
| 28 | Ga0070707_100430414 | 3300005468 | Bacteria | 1280 |
| 29 | Ga0070679_100077369 | 3300005530 | Bacteria | 3316 |
| 30 | Ga0070665_100015817 | 3300005548 | Bacteria | 7576 |
| 31 | Ga0070665_100641292 | 3300005548 | Bacteria | 1075 |
| 32 | Ga0068855_100108157 | 3300005563 | Bacteria | 3194 |
| 33 | Ga0070664_100425929 | 3300005564 | Bacteria | 1216 |
| 34 | Ga0068854_100001258 | 3300005578 | Bacteria | 15222 |
| 35 | Ga0068856_100004828 | 3300005614 | Bacteria | 13365 |
| 36 | Ga0068852_100000365 | 3300005616 | Bacteria | 30503 |
| 37 | Ga0068852_100310456 | 3300005616 | Bacteria | 1529 |
| 38 | Ga0068859_100000746 | 3300005617 | Bacteria | 32794 |
| 39 | Ga0068859_100126561 | 3300005617 | Bacteria | 2624 |
| 40 | Ga0068859_100546392 | 3300005617 | Bacteria | 1253 |
| 41 | Ga0068864_100001835 | 3300005618 | Bacteria | 17465 |
| 42 | Ga0068864_100013873 | 3300005618 | Bacteria | 6679 |
| 43 | Ga0068861_100020160 | 3300005719 | Bacteria | 4770 |
| 44 | Ga0068863_100000020 | 3300005841 | Bacteria | 198519 |
| 45 | Ga0068863_100000052 | 3300005841 | Bacteria | 125430 |
| 46 | Ga0068863_100015887 | 3300005841 | Bacteria | 7221 |
| 47 | Ga0068858_100001524 | 3300005842 | Bacteria | 23805 |
| 48 | Ga0068858_100111470 | 3300005842 | Bacteria | 2555 |
| 49 | Ga0068860_100000007 | 3300005843 | Bacteria | 429329 |
| 50 | Ga0068860_100050186 | 3300005843 | Bacteria | 3972 |
| 51 | Ga0068860_100063402 | 3300005843 | Bacteria | 3511 |
| 52 | Ga0068862_100000137 | 3300005844 | Bacteria | 82832 |
| 53 | Ga0068862_100003499 | 3300005844 | Bacteria | 13482 |
| 54 | Ga0068862_100005361 | 3300005844 | Bacteria | 10741 |
| 55 | Ga0068862_100985042 | 3300005844 | Bacteria | 833 |
| 56 | Ga0075365_10024446 | 3300006038 | Bacteria | 3812 |
| 57 | Ga0075368_10000814 | 3300006042 | Bacteria | 9602 |
| 58 | Ga0075363_100004578 | 3300006048 | Bacteria | 6065 |
| 59 | Ga0075364_10062219 | 3300006051 | Bacteria | 2449 |
| 60 | Ga0075362_10004964 | 3300006177 | Bacteria | 4823 |
| 61 | Ga0075367_10031819 | 3300006178 | Bacteria | 3031 |
| 62 | Ga0075369_10136397 | 3300006186 | Bacteria | 1117 |
| 63 | Ga0075366_10019237 | 3300006195 | Bacteria | 3948 |
| 64 | Ga0075366_10154877 | 3300006195 | Bacteria | 1388 |
| 65 | Ga0075370_10026182 | 3300006353 | Bacteria | 3230 |
| 66 | Ga0075370_10078403 | 3300006353 | Bacteria | 1897 |
| 67 | Ga0075370_10274061 | 3300006353 | Bacteria | 1002 |
| 68 | Ga0075370_10629193 | 3300006353 | Bacteria | 651 |
| 69 | Ga0075370_10797049 | 3300006353 | Bacteria | 576 |
| 70 | Ga0075431_100006139 | 3300006847 | Bacteria | 11921 |
| 71 | Ga0097620_100000746 | 3300006931 | Bacteria | 32794 |
| 72 | Ga0097620_100126562 | 3300006931 | Bacteria | 2624 |
| 73 | Ga0097620_100546456 | 3300006931 | Bacteria | 1253 |
| 74 | Ga0079104_1021464 | 3300006946 | Bacteria | 1757 |
| 75 | Ga0079104_1021569 | 3300006946 | Bacteria | 1751 |
| 76 | Ga0105251_10057917 | 3300009011 | Bacteria | 1830 |
| 77 | Ga0105250_10181447 | 3300009092 | Bacteria | 883 |
| 78 | Ga0105247_10000506 | 3300009101 | Bacteria | 32000 |
| 79 | Ga0105248_10021667 | 3300009177 | Bacteria | 7119 |
| 80 | Ga0105238_10002561 | 3300009551 | Bacteria | 18161 |
| 81 | Ga0105249_10001762 | 3300009553 | Bacteria | 18861 |
| 82 | Ga0105249_10003180 | 3300009553 | Bacteria | 14205 |
| 83 | Ga0105239_10276385 | 3300010375 | Bacteria | 1890 |
| 84 | Ga0163162_10003696 | 3300013306 | Bacteria | 14665 |
| 85 | Ga0163162_10352037 | 3300013306 | Bacteria | 1605 |
| 86 | Ga0157372_10635823 | 3300013307 | Bacteria | 1243 |
| 87 | Ga0163163_10036098 | 3300014325 | Bacteria | 4799 |
| 88 | Ga0157380_10109416 | 3300014326 | Bacteria | 2319 |
| 89 | Ga0157380_10438349 | 3300014326 | Bacteria | 1251 |
| 90 | Ga0157379_10058554 | 3300014968 | Bacteria | 3445 |
| 91 | Ga0209437_106934 | 3300025233 | Bacteria | 1867 |
| 92 | Ga0209233_1000107 | 3300025261 | Bacteria | 267399 |
| 93 | Ga0209675_1000075 | 3300025291 | Bacteria | 161623 |
| 94 | Ga0209676_1000457 | 3300025292 | Bacteria | 68913 |
| 95 | Ga0209676_1000554 | 3300025292 | Bacteria | 56925 |
| 96 | Ga0209676_1001099 | 3300025292 | Bacteria | 30043 |
| 97 | Ga0209025_1007647 | 3300025294 | Bacteria | 7990 |
| 98 | Ga0209050_1000017 | 3300025298 | Bacteria | 728928 |
| 99 | Ga0209050_1016075 | 3300025298 | Bacteria | 3089 |
| 100 | Ga0209050_1021141 | 3300025298 | Bacteria | 2386 |
| 101 | Ga0209257_1000206 | 3300025304 | Bacteria | 142184 |
| 102 | Ga0209257_1000456 | 3300025304 | Bacteria | 75804 |
| 103 | Ga0209257_1003373 | 3300025304 | Bacteria | 13795 |
| 104 | Ga0207697_10010432 | 3300025315 | Bacteria | 3972 |
| 105 | Ga0207710_10001407 | 3300025900 | Bacteria | 12033 |
| 106 | Ga0207680_10000161 | 3300025903 | Bacteria | 32807 |
| 107 | Ga0207680_10061485 | 3300025903 | Bacteria | 2291 |
| 108 | Ga0207680_10145567 | 3300025903 | Bacteria | 1575 |
| 109 | Ga0207647_10015730 | 3300025904 | Bacteria | 5180 |
| 110 | Ga0207705_10000009 | 3300025909 | Bacteria | 576128 |
| 111 | Ga0207705_10462050 | 3300025909 | Bacteria | 985 |
| 112 | Ga0207695_10018669 | 3300025913 | Bacteria | 8010 |
| 113 | Ga0207652_10091426 | 3300025921 | Bacteria | 2676 |
| 114 | Ga0207681_10000010 | 3300025923 | Bacteria | 403379 |
| 115 | Ga0207694_10020862 | 3300025924 | Bacteria | 4960 |
| 116 | Ga0207650_10105379 | 3300025925 | Bacteria | 2177 |
| 117 | Ga0207644_10000007 | 3300025931 | Bacteria | 381778 |
| 118 | Ga0207644_10000097 | 3300025931 | Bacteria | 63086 |
| 119 | Ga0207711_10044211 | 3300025941 | Bacteria | 3802 |
| 120 | Ga0207661_10499030 | 3300025944 | Bacteria | 1112 |
| 121 | Ga0207667_10361160 | 3300025949 | Bacteria | 1481 |
| 122 | Ga0207651_10067139 | 3300025960 | Bacteria | 2523 |
| 123 | Ga0207712_10037467 | 3300025961 | Bacteria | 3309 |
| 124 | Ga0207712_10147243 | 3300025961 | Bacteria | 1815 |
| 125 | Ga0207668_10000364 | 3300025972 | Bacteria | 28957 |
| 126 | Ga0207668_10011203 | 3300025972 | Bacteria | 5442 |
| 127 | Ga0207668_10388454 | 3300025972 | Bacteria | 1177 |
| 128 | Ga0207658_10001853 | 3300025986 | Bacteria | 15830 |
| 129 | Ga0207658_10046829 | 3300025986 | Bacteria | 3160 |
| 130 | Ga0207703_10012780 | 3300026035 | Bacteria | 6545 |
| 131 | Ga0207703_10033293 | 3300026035 | Bacteria | 4084 |
| 132 | Ga0207639_10278270 | 3300026041 | Bacteria | 1471 |
| 133 | Ga0207678_10246571 | 3300026067 | Bacteria | 1530 |
| 134 | Ga0207702_10037227 | 3300026078 | Bacteria | 4072 |
| 135 | Ga0207641_10000001 | 3300026088 | Bacteria | 1180841 |
| 136 | Ga0207641_10000042 | 3300026088 | Bacteria | 186384 |
| 137 | Ga0207641_10015799 | 3300026088 | Bacteria | 6183 |
| 138 | Ga0207641_10499322 | 3300026088 | Bacteria | 1181 |
| 139 | Ga0207641_10766604 | 3300026088 | Bacteria | 953 |
| 140 | Ga0207676_10036351 | 3300026095 | Bacteria | 3745 |
| 141 | Ga0207675_100000263 | 3300026118 | Bacteria | 50093 |
| 142 | Ga0207698_10000714 | 3300026142 | Bacteria | 19200 |
| 143 | Ga0207698_10076976 | 3300026142 | Bacteria | 2673 |
| 144 | Ga0209281_1019310 | 3300027111 | Bacteria | 1348 |
| 145 | Ga0209982_1010103 | 3300027552 | Bacteria | 1398 |
| 146 | Ga0209813_10000603 | 3300027866 | Bacteria | 8358 |
| 147 | Ga0209974_10014092 | 3300027876 | Bacteria | 2663 |
| 148 | Ga0268266_10044841 | 3300028379 | Bacteria | 3781 |
| 149 | Ga0268266_10094286 | 3300028379 | Bacteria | 2627 |
| 150 | Ga0268265_10000058 | 3300028380 | Bacteria | 154702 |
| 151 | Ga0268265_10007092 | 3300028380 | Bacteria | 7574 |
| 152 | Ga0268265_10022876 | 3300028380 | Bacteria | 4399 |
| 153 | Ga0268264_10000134 | 3300028381 | Bacteria | 179475 |
| 154 | Ga0268264_10000551 | 3300028381 | Bacteria | 47040 |
| 155 | Ga0268264_10039853 | 3300028381 | Bacteria | 3881 |
| 156 | Ga0316183_1069303 | 3300030742 | Bacteria | 706 |
| 157 | Ga0265331_10041068 | 3300031250 | Bacteria | 2249 |
| 158 | Ga0307408_100015251 | 3300031548 | Bacteria | 5116 |
| 159 | Ga0307408_101483999 | 3300031548 | Bacteria | 641 |
| 160 | Ga0316579_10083207 | 3300031691 | Bacteria | 1525 |
| 161 | Ga0307405_10043443 | 3300031731 | Bacteria | 2742 |
| 162 | Ga0307413_10221626 | 3300031824 | Bacteria | 1382 |
| 163 | Ga0307413_10334510 | 3300031824 | Bacteria | 1162 |
| 164 | Ga0307413_10337439 | 3300031824 | Bacteria | 1158 |
| 165 | Ga0307410_10004453 | 3300031852 | Bacteria | 7245 |
| 166 | Ga0307406_10002515 | 3300031901 | Bacteria | 9995 |
| 167 | Ga0307406_10283444 | 3300031901 | Bacteria | 1265 |
| 168 | Ga0307407_10012110 | 3300031903 | Bacteria | 4135 |
| 169 | Ga0307407_10022324 | 3300031903 | Bacteria | 3281 |
| 170 | Ga0307412_10005529 | 3300031911 | Bacteria | 7097 |
| 171 | Ga0307412_10035279 | 3300031911 | Bacteria | 3194 |
| 172 | Ga0307412_10075911 | 3300031911 | Bacteria | 2307 |
| 173 | Ga0307412_10194731 | 3300031911 | Bacteria | 1535 |
| 174 | Ga0307412_10350172 | 3300031911 | Bacteria | 1186 |
| 175 | Ga0307409_100098766 | 3300031995 | Bacteria | 2415 |
| 176 | Ga0307409_100291343 | 3300031995 | Bacteria | 1514 |
| 177 | Ga0307416_100037474 | 3300032002 | Bacteria | 3731 |
| 178 | Ga0307416_100651596 | 3300032002 | Bacteria | 1138 |
| 179 | Ga0307414_10000070 | 3300032004 | Bacteria | 96231 |
| 180 | Ga0307414_10036542 | 3300032004 | Bacteria | 3280 |
| 181 | Ga0307414_10068609 | 3300032004 | Bacteria | 2545 |
| 182 | Ga0307414_10108760 | 3300032004 | Bacteria | 2104 |
| 183 | Ga0307414_10311890 | 3300032004 | Bacteria | 1335 |
| 184 | Ga0307414_10349685 | 3300032004 | Bacteria | 1268 |
| 185 | Ga0307414_10734975 | 3300032004 | Bacteria | 896 |
| 186 | Ga0307411_10003811 | 3300032005 | Bacteria | 7090 |
| 187 | Ga0307411_10125295 | 3300032005 | Bacteria | 1867 |
| 188 | Ga0307411_10145451 | 3300032005 | Bacteria | 1754 |
| 189 | Ga0307415_100083457 | 3300032126 | Bacteria | 2289 |
| 190 | Ga0316583_10004739 | 3300032133 | Bacteria | 4859 |
| 191 | Ga0316582_0094463 | 3300036647 | Bacteria | 1973 |
| 192 | Ga0316582_0792611 | 3300036647 | Bacteria | 649 |
| 193 | Ga0439465_0004009 | 3300041413 | Bacteria | 4799 |
| 194 | Ga0439445_0012089 | 3300042004 | Bacteria | 2068 |
| 195 | Ga0439435_0008825 | 3300042436 | Bacteria | 2349 |
| 196 | Ga0495639_0086521 | 3300046475 | Bacteria | 1466 |
| 197 | Ga0495643_0047369 | 3300046522 | Bacteria | 2328 |
| 198 | Ga0495643_0224244 | 3300046522 | Bacteria | 890 |
| 199 | Ga0495654_0001285 | 3300046530 | Bacteria | 17616 |
| 200 | Ga0495598_0004101 | 3300046537 | Bacteria | 3135 |
| 201 | Ga0495668_0001806 | 3300046616 | Bacteria | 19490 |
| 202 | Ga0495668_0231370 | 3300046616 | Bacteria | 1012 |
| 203 | Ga0495668_0302580 | 3300046616 | Bacteria | 877 |
| 204 | Ga0495625_0000936 | 3300046660 | Bacteria | 39185 |
| 205 | Ga0495687_108330 | 3300047443 | Bacteria | 1027 |
| 206 | Ga0496101_0499155 | 3300048904 | Bacteria | 961 |
| 207 | Ga0496102_0163369 | 3300048905 | Bacteria | 2095 |
| 208 | Ga0496103_0190364 | 3300048906 | Bacteria | 1319 |
| 209 | Ga0496103_0265322 | 3300048906 | Bacteria | 1105 |
| 210 | Ga0496104_0016596 | 3300048907 | Bacteria | 6692 |
| 211 | Ga0496105_0014243 | 3300048908 | Bacteria | 6327 |
| 212 | Ga0496105_1115247 | 3300048908 | Bacteria | 585 |
| 213 | Ga0496107_0076605 | 3300048910 | Bacteria | 2436 |
| 214 | Ga0496110_0091850 | 3300048913 | Bacteria | 2716 |
| 215 | Ga0496111_0975386 | 3300048914 | Bacteria | 608 |
| 216 | Ga0496116_0000035 | 3300048919 | Bacteria | 402424 |
| 217 | Ga0496117_0053276 | 3300048920 | Bacteria | 2844 |
| 218 | Ga0496117_0094870 | 3300048920 | Bacteria | 1908 |
| 219 | Ga0496118_0031975 | 3300048921 | Bacteria | 4347 |
| 220 | Ga0496118_0142444 | 3300048921 | Bacteria | 1516 |
| 221 | Ga0496119_0105100 | 3300048922 | Bacteria | 1578 |
| 222 | Ga0496120_0124576 | 3300048923 | Bacteria | 1328 |
| 223 | Ga0496121_0000087 | 3300048924 | Bacteria | 222451 |
| 224 | Ga0496121_0003927 | 3300048924 | Bacteria | 20608 |
| 225 | Ga0496122_0021058 | 3300048925 | Bacteria | 5856 |
| 226 | Ga0496123_0002756 | 3300048926 | Bacteria | 21027 |
| 227 | Ga0496123_0083091 | 3300048926 | Bacteria | 1938 |
| 228 | Ga0496124_0003962 | 3300048927 | Bacteria | 17654 |
| 229 | Ga0496124_0010337 | 3300048927 | Bacteria | 9467 |
| 230 | Ga0496124_0035362 | 3300048927 | Bacteria | 4371 |
| 231 | Ga0496124_0038562 | 3300048927 | Bacteria | 4148 |
| 232 | Ga0496125_0026241 | 3300048928 | Bacteria | 5313 |
| 233 | Ga0496126_0000084 | 3300048929 | Bacteria | 217111 |
| 234 | Ga0496126_0141223 | 3300048929 | Bacteria | 2073 |
| 235 | Ga0496126_0159410 | 3300048929 | Bacteria | 1929 |
| 236 | Ga0501292_000008 | 3300049515 | Bacteria | 83748 |
| 237 | Ga0501294_000256 | 3300049517 | Bacteria | 6545 |
| 238 | Ga0501297_003212 | 3300049520 | Bacteria | 1617 |
| 239 | Ga0501300_000579 | 3300049523 | Bacteria | 5482 |
| 240 | Ga0501335_027402 | 3300049551 | Bacteria | 632 |
| 241 | Ga0501206_001048 | 3300049653 | Bacteria | 3451 |
| 242 | Ga0501223_000865 | 3300049663 | Bacteria | 7187 |
| 243 | Ga0501224_012473 | 3300049664 | Bacteria | 1252 |
| 244 | Ga0501227_001961 | 3300049665 | Bacteria | 4574 |
| 245 | Ga0501233_013731 | 3300049668 | Bacteria | 1647 |
| 246 | Ga0501235_006556 | 3300049669 | Bacteria | 2535 |
| 247 | Ga0501257_059104 | 3300049686 | Bacteria | 967 |
| 248 | Ga0501259_000164 | 3300049688 | Bacteria | 10004 |
| 249 | Ga0501261_000020 | 3300049690 | Bacteria | 37889 |
| 250 | Ga0501221_002785 | 3300049704 | Bacteria | 2877 |
| 251 | Ga0501262_008229 | 3300049759 | Bacteria | 1274 |
| 252 | Ga0501279_000002 | 3300049775 | Bacteria | 205937 |
| 253 | Ga0501280_000010 | 3300049776 | Bacteria | 63153 |
| 254 | Ga0501281_00115 | 3300049777 | Bacteria | 9747 |
| 255 | Ga0501282_000387 | 3300049778 | Bacteria | 5324 |
| 256 | Ga0501044_0009663 | 3300049823 | Bacteria | 10492 |
| 257 | Ga0501044_0852803 | 3300049823 | Bacteria | 788 |
| 258 | Ga0501226_012577 | 3300049853 | Bacteria | 937 |
| 259 | nmdc:mga03683_391_c1 | 3300050489 | Bacteria | 12569 |
| 260 | nmdc:mga00v17_29707_c1 | 3300050491 | Bacteria | 3210 |
| 261 | nmdc:mga0yw44_22632_c1 | 3300050492 | Bacteria | 3527 |
| 262 | nmdc:mga0k408_126766_c1 | 3300050493 | Bacteria | 1514 |
| 263 | nmdc:mga0k408_175083_c1 | 3300050493 | Bacteria | 1279 |
| 264 | nmdc:mga0k408_210086_c1 | 3300050493 | Bacteria | 1162 |
| 265 | nmdc:mga0k408_53531_c1 | 3300050493 | Bacteria | 2340 |
| 266 | nmdc:mga06z11_129_c1 | 3300050494 | Bacteria | 30757 |
| 267 | nmdc:mga04h51_461_c1 | 3300050495 | Bacteria | 9759 |
| 268 | nmdc:mga07m45_1229_c1 | 3300050496 | Bacteria | 11611 |
| 269 | nmdc:mga07m45_126245_c1 | 3300050496 | Bacteria | 1479 |
| 270 | nmdc:mga07m45_213001_c1 | 3300050496 | Bacteria | 1124 |
| 271 | nmdc:mga07m45_377428_c1 | 3300050496 | Bacteria | 823 |
| 272 | nmdc:mga07m45_383_c1 | 3300050496 | Bacteria | 17738 |
| 273 | nmdc:mga07m45_44227_c1 | 3300050496 | Bacteria | 2498 |
| 274 | nmdc:mga07m45_539734_c1 | 3300050496 | Bacteria | 675 |
| 275 | nmdc:mga06r32_10994_c1 | 3300050510 | Bacteria | 8148 |
| 276 | Ga0500647_0042113 | 3300053091 | Bacteria | 2192 |
| 277 | Ga0500555_056606 | 3300053103 | Bacteria | 1063 |
| 278 | Ga0500594_0052140 | 3300053118 | Bacteria | 1155 |
| 279 | Ga0500595_058216 | 3300053119 | Bacteria | 1175 |
| 280 | Ga0500607_000003 | 3300053121 | Bacteria | 149664 |
| 281 | Ga0500608_002768 | 3300053122 | Bacteria | 6460 |
| 282 | Ga0500618_001469 | 3300053125 | Bacteria | 10447 |
| 283 | Ga0500618_026501 | 3300053125 | Bacteria | 1384 |
| 284 | Ga0500658_0091436 | 3300053134 | Bacteria | 1316 |
| 285 | Ga0500559_0000887 | 3300053136 | Bacteria | 19149 |
| 286 | Ga0500559_0022107 | 3300053136 | Bacteria | 2697 |
| 287 | Ga0500559_0028282 | 3300053136 | Bacteria | 2395 |
| 288 | Ga0500559_0126118 | 3300053136 | Bacteria | 1193 |
| 289 | Ga0500564_001539 | 3300053138 | Bacteria | 8026 |
| 290 | Ga0500568_0001144 | 3300053139 | Bacteria | 17799 |
| 291 | Ga0500588_0003571 | 3300053146 | Bacteria | 3297 |
| 292 | Ga0500604_0005548 | 3300053151 | Bacteria | 3330 |
| 293 | Ga0500604_0237117 | 3300053151 | Bacteria | 630 |
| 294 | Ga0500627_0000173 | 3300053158 | Bacteria | 19050 |
| 295 | Ga0500637_0001437 | 3300053178 | Bacteria | 10142 |
| 296 | Ga0500567_001496 | 3300053723 | Bacteria | 9477 |
| 297 | Ga0500625_000001 | 3300053729 | Bacteria | 395993 |
| 298 | Ga0500645_004031 | 3300053730 | Bacteria | 5768 |
| 299 | Ga0500645_028410 | 3300053730 | Bacteria | 1692 |
| 300 | Ga0500596_008182 | 3300053735 | Bacteria | 1676 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005564 | Ga0070664_100425929 | Ga0070664_1004259292 | 160 |
| 2 | 3300003781 | Ga0055536_1000909 | Ga0055536_10009095 | 166 |
| 3 | 3300003781 | Ga0055536_1005009 | Ga0055536_10050093 | 166 |
| 4 | 3300003791 | Ga0055530_10000439 | Ga0055530_1000043922 | 166 |
| 5 | 3300003794 | Ga0055531_10002007 | Ga0055531_1000200715 | 166 |
| 6 | 3300006353 | Ga0075370_10274061 | Ga0075370_102740612 | 166 |
| 7 | 3300025291 | Ga0209675_1000075 | Ga0209675_1000075114 | 166 |
| 8 | 3300025292 | Ga0209676_1000554 | Ga0209676_100055423 | 166 |
| 9 | 3300025292 | Ga0209676_1001099 | Ga0209676_100109934 | 166 |
| 10 | 3300025294 | Ga0209025_1007647 | Ga0209025_10076472 | 166 |
| 11 | 3300025298 | Ga0209050_1000017 | Ga0209050_1000017120 | 166 |
| 12 | 3300025298 | Ga0209050_1016075 | Ga0209050_10160753 | 166 |
| 13 | 3300025304 | Ga0209257_1000206 | Ga0209257_1000206126 | 166 |
| 14 | 3300031901 | Ga0307406_10283444 | Ga0307406_102834442 | 166 |
| 15 | 3300031911 | Ga0307412_10035279 | Ga0307412_100352793 | 166 |
| 16 | 3300032005 | Ga0307411_10145451 | Ga0307411_101454512 | 166 |
| 17 | iso_pu_bacteria | 2773857759 | 2774384340 | 167 |
| 18 | iso_pu_bacteria | 2977251589 | 2977254073 | 167 |
| 19 | 3300025903 | Ga0207680_10145567 | Ga0207680_101455672 | 170 |
| 20 | iso_pu_bacteria | 2739367664 | 2739648902 | 171 |
| 21 | iso_pu_bacteria | 2739367865 | 2740027375 | 171 |
| 22 | iso_pu_bacteria | 2818991438 | 2819552336 | 171 |
| 23 | iso_pu_bacteria | 2895880812 | 2895881383 | 172 |
| 24 | 3300031852 | Ga0307410_10004453 | Ga0307410_100044536 | 173 |
| 25 | 3300031903 | Ga0307407_10012110 | Ga0307407_100121102 | 173 |
| 26 | 3300032004 | Ga0307414_10108760 | Ga0307414_101087603 | 173 |
| 27 | 3300046522 | Ga0495643_0224244 | Ga0495643_0224244_55_594 | 173 |
| 28 | 3300005844 | Ga0068862_100985042 | Ga0068862_1009850421 | 174 |
| 29 | 3300048906 | Ga0496103_0265322 | Ga0496103_0265322_403_927 | 174 |
| 30 | 3300048907 | Ga0496104_0016596 | Ga0496104_0016596_2300_2824 | 174 |
| 31 | 3300048908 | Ga0496105_0014243 | Ga0496105_0014243_2955_3479 | 174 |
| 32 | iso_pu_bacteria | 2643221563 | 2643834335 | 174 |
| 33 | iso_pu_bacteria | 2643221588 | 2643951612 | 174 |
| 34 | iso_pu_bacteria | 2643221608 | 2644055260 | 174 |
| 35 | iso_pu_bacteria | 2848297114 | 2848298859 | 174 |
| 36 | iso_pu_bacteria | 2852653556 | 2852654317 | 174 |
| 37 | 3300005295 | Ga0065707_10545170 | Ga0065707_105451701 | 175 |
| 38 | 3300005327 | Ga0070658_10000083 | Ga0070658_1000008374 | 175 |
| 39 | 3300005335 | Ga0070666_10110889 | Ga0070666_101108893 | 175 |
| 40 | 3300005347 | Ga0070668_100712524 | Ga0070668_1007125241 | 175 |
| 41 | 3300005440 | Ga0070705_100158058 | Ga0070705_1001580582 | 175 |
| 42 | 3300005468 | Ga0070707_100430414 | Ga0070707_1004304142 | 175 |
| 43 | 3300005563 | Ga0068855_100108157 | Ga0068855_1001081572 | 175 |
| 44 | 3300005578 | Ga0068854_100001258 | Ga0068854_1000012582 | 175 |
| 45 | 3300005614 | Ga0068856_100004828 | Ga0068856_10000482810 | 175 |
| 46 | 3300005616 | Ga0068852_100000365 | Ga0068852_10000036526 | 175 |
| 47 | 3300005616 | Ga0068852_100310456 | Ga0068852_1003104562 | 175 |
| 48 | 3300005617 | Ga0068859_100546392 | Ga0068859_1005463922 | 175 |
| 49 | 3300005843 | Ga0068860_100063402 | Ga0068860_1000634025 | 175 |
| 50 | 3300005844 | Ga0068862_100003499 | Ga0068862_10000349914 | 175 |
| 51 | 3300006195 | Ga0075366_10154877 | Ga0075366_101548772 | 175 |
| 52 | 3300006353 | Ga0075370_10078403 | Ga0075370_100784033 | 175 |
| 53 | 3300006353 | Ga0075370_10629193 | Ga0075370_106291931 | 175 |
| 54 | 3300006931 | Ga0097620_100546456 | Ga0097620_1005464562 | 175 |
| 55 | 3300009092 | Ga0105250_10181447 | Ga0105250_101814471 | 175 |
| 56 | 3300025904 | Ga0207647_10015730 | Ga0207647_100157304 | 175 |
| 57 | 3300025909 | Ga0207705_10000009 | Ga0207705_10000009470 | 175 |
| 58 | 3300025913 | Ga0207695_10018669 | Ga0207695_100186691 | 175 |
| 59 | 3300025924 | Ga0207694_10020862 | Ga0207694_100208622 | 175 |
| 60 | 3300025944 | Ga0207661_10499030 | Ga0207661_104990302 | 175 |
| 61 | 3300025949 | Ga0207667_10361160 | Ga0207667_103611602 | 175 |
| 62 | 3300026078 | Ga0207702_10037227 | Ga0207702_100372272 | 175 |
| 63 | 3300026088 | Ga0207641_10499322 | Ga0207641_104993222 | 175 |
| 64 | 3300026142 | Ga0207698_10000714 | Ga0207698_100007144 | 175 |
| 65 | 3300026142 | Ga0207698_10076976 | Ga0207698_100769764 | 175 |
| 66 | 3300028380 | Ga0268265_10022876 | Ga0268265_100228765 | 175 |
| 67 | 3300028381 | Ga0268264_10039853 | Ga0268264_100398532 | 175 |
| 68 | 3300031250 | Ga0265331_10041068 | Ga0265331_100410682 | 175 |
| 69 | 3300046475 | Ga0495639_0086521 | Ga0495639_0086521_33_560 | 175 |
| 70 | 3300047443 | Ga0495687_108330 | Ga0495687_108330_134_661 | 175 |
| 71 | 3300048904 | Ga0496101_0499155 | Ga0496101_0499155_259_804 | 175 |
| 72 | 3300048919 | Ga0496116_0000035 | Ga0496116_0000035_185614_186159 | 175 |
| 73 | 3300048920 | Ga0496117_0094870 | Ga0496117_0094870_1161_1706 | 175 |
| 74 | 3300048921 | Ga0496118_0142444 | Ga0496118_0142444_46_591 | 175 |
| 75 | 3300048924 | Ga0496121_0003927 | Ga0496121_0003927_11618_12163 | 175 |
| 76 | 3300048925 | Ga0496122_0021058 | Ga0496122_0021058_1720_2265 | 175 |
| 77 | 3300048926 | Ga0496123_0002756 | Ga0496123_0002756_8328_8873 | 175 |
| 78 | 3300048927 | Ga0496124_0003962 | Ga0496124_0003962_5180_5725 | 175 |
| 79 | 3300048927 | Ga0496124_0010337 | Ga0496124_0010337_1683_2228 | 175 |
| 80 | 3300048928 | Ga0496125_0026241 | Ga0496125_0026241_2416_2961 | 175 |
| 81 | 3300048929 | Ga0496126_0000084 | Ga0496126_0000084_31826_32371 | 175 |
| 82 | 3300050493 | nmdc:mga0k408_175083_c1 | nmdc:mga0k408_175083_c1_119_646 | 175 |
| 83 | 3300050496 | nmdc:mga07m45_44227_c1 | nmdc:mga07m45_44227_c1_98_625 | 175 |
| 84 | 3300050496 | nmdc:mga07m45_539734_c1 | nmdc:mga07m45_539734_c1_57_584 | 175 |
| 85 | 3300053091 | Ga0500647_0042113 | Ga0500647_0042113_602_1129 | 175 |
| 86 | 3300053118 | Ga0500594_0052140 | Ga0500594_0052140_593_1120 | 175 |
| 87 | 3300053122 | Ga0500608_002768 | Ga0500608_002768_2664_3191 | 175 |
| 88 | 3300053125 | Ga0500618_001469 | Ga0500618_001469_9603_10172 | 175 |
| 89 | 3300053136 | Ga0500559_0028282 | Ga0500559_0028282_358_885 | 175 |
| 90 | 3300053138 | Ga0500564_001539 | Ga0500564_001539_6476_7003 | 175 |
| 91 | 3300053723 | Ga0500567_001496 | Ga0500567_001496_931_1458 | 175 |
| 92 | 3300053729 | Ga0500625_000001 | Ga0500625_000001_228596_229123 | 175 |
| 93 | iso_pu_bacteria | 2928027323 | 2928028273 | 175 |
| 94 | iso_pu_bacteria | 2984555340 | 2984556242 | 175 |
| 95 | iso_pu_bacteria | 2984564862 | 2984565590 | 175 |
| 96 | iso_pu_bacteria | 2993356040 | 2993356661 | 175 |
| 97 | 3300005344 | Ga0070661_100743240 | Ga0070661_1007432401 | 176 |
| 98 | 3300005618 | Ga0068864_100001835 | Ga0068864_1000018355 | 176 |
| 99 | 3300005841 | Ga0068863_100000052 | Ga0068863_10000005281 | 176 |
| 100 | 3300026088 | Ga0207641_10000042 | Ga0207641_1000004281 | 176 |
| 101 | 3300031911 | Ga0307412_10350172 | Ga0307412_103501722 | 176 |
| 102 | 3300005331 | Ga0070670_100012280 | Ga0070670_1000122809 | 177 |
| 103 | 3300005335 | Ga0070666_10003496 | Ga0070666_100034966 | 177 |
| 104 | 3300005347 | Ga0070668_100032482 | Ga0070668_1000324822 | 177 |
| 105 | 3300005353 | Ga0070669_100000110 | Ga0070669_10000011056 | 177 |
| 106 | 3300005355 | Ga0070671_100000004 | Ga0070671_10000000435 | 177 |
| 107 | 3300005367 | Ga0070667_100007392 | Ga0070667_1000073924 | 177 |
| 108 | 3300005445 | Ga0070708_100695751 | Ga0070708_1006957512 | 177 |
| 109 | 3300005617 | Ga0068859_100000746 | Ga0068859_10000074624 | 177 |
| 110 | 3300005618 | Ga0068864_100013873 | Ga0068864_1000138738 | 177 |
| 111 | 3300005719 | Ga0068861_100020160 | Ga0068861_1000201605 | 177 |
| 112 | 3300005841 | Ga0068863_100015887 | Ga0068863_1000158875 | 177 |
| 113 | 3300005842 | Ga0068858_100001524 | Ga0068858_10000152412 | 177 |
| 114 | 3300005842 | Ga0068858_100111470 | Ga0068858_1001114701 | 177 |
| 115 | 3300005843 | Ga0068860_100050186 | Ga0068860_1000501862 | 177 |
| 116 | 3300005844 | Ga0068862_100000137 | Ga0068862_10000013731 | 177 |
| 117 | 3300006038 | Ga0075365_10024446 | Ga0075365_100244463 | 177 |
| 118 | 3300006042 | Ga0075368_10000814 | Ga0075368_100008145 | 177 |
| 119 | 3300006048 | Ga0075363_100004578 | Ga0075363_1000045784 | 177 |
| 120 | 3300006051 | Ga0075364_10062219 | Ga0075364_100622193 | 177 |
| 121 | 3300006177 | Ga0075362_10004964 | Ga0075362_100049644 | 177 |
| 122 | 3300006178 | Ga0075367_10031819 | Ga0075367_100318193 | 177 |
| 123 | 3300006186 | Ga0075369_10136397 | Ga0075369_101363971 | 177 |
| 124 | 3300006195 | Ga0075366_10019237 | Ga0075366_100192374 | 177 |
| 125 | 3300006353 | Ga0075370_10026182 | Ga0075370_100261824 | 177 |
| 126 | 3300006353 | Ga0075370_10797049 | Ga0075370_107970491 | 177 |
| 127 | 3300006931 | Ga0097620_100000746 | Ga0097620_10000074624 | 177 |
| 128 | 3300006946 | Ga0079104_1021464 | Ga0079104_10214642 | 177 |
| 129 | 3300009011 | Ga0105251_10057917 | Ga0105251_100579171 | 177 |
| 130 | 3300009101 | Ga0105247_10000506 | Ga0105247_1000050615 | 177 |
| 131 | 3300009177 | Ga0105248_10021667 | Ga0105248_100216676 | 177 |
| 132 | 3300009551 | Ga0105238_10002561 | Ga0105238_100025614 | 177 |
| 133 | 3300009553 | Ga0105249_10001762 | Ga0105249_100017625 | 177 |
| 134 | 3300010375 | Ga0105239_10276385 | Ga0105239_102763852 | 177 |
| 135 | 3300013306 | Ga0163162_10003696 | Ga0163162_100036965 | 177 |
| 136 | 3300013307 | Ga0157372_10635823 | Ga0157372_106358232 | 177 |
| 137 | 3300014325 | Ga0163163_10036098 | Ga0163163_100360985 | 177 |
| 138 | 3300014968 | Ga0157379_10058554 | Ga0157379_100585543 | 177 |
| 139 | 3300025315 | Ga0207697_10010432 | Ga0207697_100104324 | 177 |
| 140 | 3300025900 | Ga0207710_10001407 | Ga0207710_1000140712 | 177 |
| 141 | 3300025903 | Ga0207680_10000161 | Ga0207680_1000016124 | 177 |
| 142 | 3300025909 | Ga0207705_10462050 | Ga0207705_104620502 | 177 |
| 143 | 3300025923 | Ga0207681_10000010 | Ga0207681_1000001041 | 177 |
| 144 | 3300025925 | Ga0207650_10105379 | Ga0207650_101053792 | 177 |
| 145 | 3300025931 | Ga0207644_10000007 | Ga0207644_1000000741 | 177 |
| 146 | 3300025941 | Ga0207711_10044211 | Ga0207711_100442112 | 177 |
| 147 | 3300025961 | Ga0207712_10147243 | Ga0207712_101472432 | 177 |
| 148 | 3300025972 | Ga0207668_10011203 | Ga0207668_100112035 | 177 |
| 149 | 3300025986 | Ga0207658_10046829 | Ga0207658_100468294 | 177 |
| 150 | 3300026035 | Ga0207703_10012780 | Ga0207703_100127806 | 177 |
| 151 | 3300026035 | Ga0207703_10033293 | Ga0207703_100332932 | 177 |
| 152 | 3300026041 | Ga0207639_10278270 | Ga0207639_102782702 | 177 |
| 153 | 3300026088 | Ga0207641_10015799 | Ga0207641_100157993 | 177 |
| 154 | 3300026095 | Ga0207676_10036351 | Ga0207676_100363515 | 177 |
| 155 | 3300026118 | Ga0207675_100000263 | Ga0207675_10000026323 | 177 |
| 156 | 3300027552 | Ga0209982_1010103 | Ga0209982_10101032 | 177 |
| 157 | 3300027866 | Ga0209813_10000603 | Ga0209813_100006035 | 177 |
| 158 | 3300027876 | Ga0209974_10014092 | Ga0209974_100140923 | 177 |
| 159 | 3300028380 | Ga0268265_10000058 | Ga0268265_10000058145 | 177 |
| 160 | 3300028381 | Ga0268264_10000551 | Ga0268264_1000055128 | 177 |
| 161 | 3300032004 | Ga0307414_10734975 | Ga0307414_107349752 | 177 |
| 162 | 3300042436 | Ga0439435_0008825 | Ga0439435_0008825_589_1125 | 177 |
| 163 | 3300046530 | Ga0495654_0001285 | Ga0495654_0001285_13764_14297 | 177 |
| 164 | 3300046616 | Ga0495668_0001806 | Ga0495668_0001806_7031_7564 | 177 |
| 165 | 3300046616 | Ga0495668_0231370 | Ga0495668_0231370_166_705 | 177 |
| 166 | 3300046616 | Ga0495668_0302580 | Ga0495668_0302580_324_860 | 177 |
| 167 | 3300048905 | Ga0496102_0163369 | Ga0496102_0163369_798_1331 | 177 |
| 168 | 3300048906 | Ga0496103_0190364 | Ga0496103_0190364_773_1306 | 177 |
| 169 | 3300048908 | Ga0496105_1115247 | Ga0496105_1115247_35_568 | 177 |
| 170 | 3300048910 | Ga0496107_0076605 | Ga0496107_0076605_679_1212 | 177 |
| 171 | 3300048913 | Ga0496110_0091850 | Ga0496110_0091850_554_1087 | 177 |
| 172 | 3300048914 | Ga0496111_0975386 | Ga0496111_0975386_35_568 | 177 |
| 173 | 3300048920 | Ga0496117_0053276 | Ga0496117_0053276_1147_1680 | 177 |
| 174 | 3300048921 | Ga0496118_0031975 | Ga0496118_0031975_2471_3004 | 177 |
| 175 | 3300048922 | Ga0496119_0105100 | Ga0496119_0105100_434_967 | 177 |
| 176 | 3300048923 | Ga0496120_0124576 | Ga0496120_0124576_31_564 | 177 |
| 177 | 3300048924 | Ga0496121_0000087 | Ga0496121_0000087_46172_46711 | 177 |
| 178 | 3300048926 | Ga0496123_0083091 | Ga0496123_0083091_260_793 | 177 |
| 179 | 3300048927 | Ga0496124_0035362 | Ga0496124_0035362_2007_2540 | 177 |
| 180 | 3300048927 | Ga0496124_0038562 | Ga0496124_0038562_489_1022 | 177 |
| 181 | 3300048929 | Ga0496126_0159410 | Ga0496126_0159410_32_565 | 177 |
| 182 | 3300049515 | Ga0501292_000008 | Ga0501292_000008_16417_16950 | 177 |
| 183 | 3300049517 | Ga0501294_000256 | Ga0501294_000256_2356_2889 | 177 |
| 184 | 3300049520 | Ga0501297_003212 | Ga0501297_003212_898_1431 | 177 |
| 185 | 3300049523 | Ga0501300_000579 | Ga0501300_000579_279_812 | 177 |
| 186 | 3300049551 | Ga0501335_027402 | Ga0501335_027402_53_586 | 177 |
| 187 | 3300049653 | Ga0501206_001048 | Ga0501206_001048_593_1126 | 177 |
| 188 | 3300049663 | Ga0501223_000865 | Ga0501223_000865_6197_6730 | 177 |
| 189 | 3300049664 | Ga0501224_012473 | Ga0501224_012473_65_742 | 177 |
| 190 | 3300049665 | Ga0501227_001961 | Ga0501227_001961_3921_4454 | 177 |
| 191 | 3300049668 | Ga0501233_013731 | Ga0501233_013731_1036_1569 | 177 |
| 192 | 3300049669 | Ga0501235_006556 | Ga0501235_006556_1864_2397 | 177 |
| 193 | 3300049686 | Ga0501257_059104 | Ga0501257_059104_218_751 | 177 |
| 194 | 3300049688 | Ga0501259_000164 | Ga0501259_000164_8031_8564 | 177 |
| 195 | 3300049690 | Ga0501261_000020 | Ga0501261_000020_19394_19927 | 177 |
| 196 | 3300049704 | Ga0501221_002785 | Ga0501221_002785_817_1350 | 177 |
| 197 | 3300049775 | Ga0501279_000002 | Ga0501279_000002_88349_88882 | 177 |
| 198 | 3300049776 | Ga0501280_000010 | Ga0501280_000010_31072_31605 | 177 |
| 199 | 3300049777 | Ga0501281_00115 | Ga0501281_00115_302_835 | 177 |
| 200 | 3300049778 | Ga0501282_000387 | Ga0501282_000387_2535_3068 | 177 |
| 201 | 3300049823 | Ga0501044_0009663 | Ga0501044_0009663_1973_2524 | 177 |
| 202 | 3300049823 | Ga0501044_0852803 | Ga0501044_0852803_70_609 | 177 |
| 203 | 3300049853 | Ga0501226_012577 | Ga0501226_012577_352_885 | 177 |
| 204 | 3300050489 | nmdc:mga03683_391_c1 | nmdc:mga03683_391_c1_4073_4609 | 177 |
| 205 | 3300050491 | nmdc:mga00v17_29707_c1 | nmdc:mga00v17_29707_c1_984_1520 | 177 |
| 206 | 3300050492 | nmdc:mga0yw44_22632_c1 | nmdc:mga0yw44_22632_c1_2816_3352 | 177 |
| 207 | 3300050493 | nmdc:mga0k408_53531_c1 | nmdc:mga0k408_53531_c1_432_968 | 177 |
| 208 | 3300050494 | nmdc:mga06z11_129_c1 | nmdc:mga06z11_129_c1_557_1093 | 177 |
| 209 | 3300050495 | nmdc:mga04h51_461_c1 | nmdc:mga04h51_461_c1_4067_4603 | 177 |
| 210 | 3300050496 | nmdc:mga07m45_1229_c1 | nmdc:mga07m45_1229_c1_4087_4623 | 177 |
| 211 | 3300050496 | nmdc:mga07m45_126245_c1 | nmdc:mga07m45_126245_c1_51_587 | 177 |
| 212 | 3300050496 | nmdc:mga07m45_213001_c1 | nmdc:mga07m45_213001_c1_98_646 | 177 |
| 213 | 3300050496 | nmdc:mga07m45_377428_c1 | nmdc:mga07m45_377428_c1_210_749 | 177 |
| 214 | 3300050496 | nmdc:mga07m45_383_c1 | nmdc:mga07m45_383_c1_9353_9889 | 177 |
| 215 | 3300053119 | Ga0500595_058216 | Ga0500595_058216_90_626 | 177 |
| 216 | 3300053121 | Ga0500607_000003 | Ga0500607_000003_2434_2982 | 177 |
| 217 | 3300053125 | Ga0500618_026501 | Ga0500618_026501_802_1341 | 177 |
| 218 | 3300053134 | Ga0500658_0091436 | Ga0500658_0091436_682_1215 | 177 |
| 219 | 3300053136 | Ga0500559_0000887 | Ga0500559_0000887_13087_13635 | 177 |
| 220 | 3300053136 | Ga0500559_0022107 | Ga0500559_0022107_1423_1959 | 177 |
| 221 | 3300053146 | Ga0500588_0003571 | Ga0500588_0003571_1673_2275 | 177 |
| 222 | 3300053151 | Ga0500604_0005548 | Ga0500604_0005548_1260_1793 | 177 |
| 223 | 3300053151 | Ga0500604_0237117 | Ga0500604_0237117_29_568 | 177 |
| 224 | 3300053158 | Ga0500627_0000173 | Ga0500627_0000173_11916_12449 | 177 |
| 225 | 3300053178 | Ga0500637_0001437 | Ga0500637_0001437_6686_7234 | 177 |
| 226 | 3300053730 | Ga0500645_004031 | Ga0500645_004031_1641_2189 | 177 |
| 227 | 3300053730 | Ga0500645_028410 | Ga0500645_028410_672_1208 | 177 |
| 228 | 3300003791 | Ga0055530_10053082 | Ga0055530_100530822 | 178 |
| 229 | 3300005337 | Ga0070682_100285593 | Ga0070682_1002855932 | 178 |
| 230 | 3300005354 | Ga0070675_100691412 | Ga0070675_1006914122 | 178 |
| 231 | 3300005455 | Ga0070663_100578358 | Ga0070663_1005783581 | 178 |
| 232 | 3300005466 | Ga0070685_10603206 | Ga0070685_106032062 | 178 |
| 233 | 3300006946 | Ga0079104_1021569 | Ga0079104_10215692 | 178 |
| 234 | 3300014326 | Ga0157380_10438349 | Ga0157380_104383492 | 178 |
| 235 | 3300025292 | Ga0209676_1000457 | Ga0209676_100045751 | 178 |
| 236 | 3300025298 | Ga0209050_1021141 | Ga0209050_10211413 | 178 |
| 237 | 3300025304 | Ga0209257_1000456 | Ga0209257_100045627 | 178 |
| 238 | 3300025304 | Ga0209257_1003373 | Ga0209257_10033735 | 178 |
| 239 | 3300026067 | Ga0207678_10246571 | Ga0207678_102465712 | 178 |
| 240 | 3300027111 | Ga0209281_1019310 | Ga0209281_10193102 | 178 |
| 241 | 3300031548 | Ga0307408_101483999 | Ga0307408_1014839991 | 178 |
| 242 | 3300031691 | Ga0316579_10083207 | Ga0316579_100832072 | 178 |
| 243 | 3300031824 | Ga0307413_10334510 | Ga0307413_103345102 | 178 |
| 244 | 3300031824 | Ga0307413_10337439 | Ga0307413_103374391 | 178 |
| 245 | 3300031911 | Ga0307412_10005529 | Ga0307412_100055295 | 178 |
| 246 | 3300031911 | Ga0307412_10194731 | Ga0307412_101947312 | 178 |
| 247 | 3300032002 | Ga0307416_100651596 | Ga0307416_1006515962 | 178 |
| 248 | 3300032004 | Ga0307414_10000070 | Ga0307414_1000007079 | 178 |
| 249 | 3300032004 | Ga0307414_10036542 | Ga0307414_100365423 | 178 |
| 250 | 3300032004 | Ga0307414_10068609 | Ga0307414_100686092 | 178 |
| 251 | 3300032133 | Ga0316583_10004739 | Ga0316583_100047394 | 178 |
| 252 | 3300036647 | Ga0316582_0094463 | Ga0316582_0094463_408_947 | 178 |
| 253 | 3300036647 | Ga0316582_0792611 | Ga0316582_0792611_17_556 | 178 |
| 254 | 3300046522 | Ga0495643_0047369 | Ga0495643_0047369_980_1516 | 178 |
| 255 | 3300046537 | Ga0495598_0004101 | Ga0495598_0004101_1004_1558 | 178 |
| 256 | 3300046660 | Ga0495625_0000936 | Ga0495625_0000936_23229_23765 | 178 |
| 257 | 3300048929 | Ga0496126_0141223 | Ga0496126_0141223_930_1466 | 178 |
| 258 | 3300049759 | Ga0501262_008229 | Ga0501262_008229_405_941 | 178 |
| 259 | 3300050493 | nmdc:mga0k408_126766_c1 | nmdc:mga0k408_126766_c1_661_1197 | 178 |
| 260 | 3300050493 | nmdc:mga0k408_210086_c1 | nmdc:mga0k408_210086_c1_162_746 | 178 |
| 261 | 3300053139 | Ga0500568_0001144 | Ga0500568_0001144_1140_1676 | 178 |
| 262 | 3300005548 | Ga0070665_100015817 | Ga0070665_1000158178 | 179 |
| 263 | 3300005843 | Ga0068860_100000007 | Ga0068860_100000007336 | 179 |
| 264 | 3300025986 | Ga0207658_10001853 | Ga0207658_100018536 | 179 |
| 265 | 3300028379 | Ga0268266_10044841 | Ga0268266_100448413 | 179 |
| 266 | 3300028381 | Ga0268264_10000134 | Ga0268264_1000013479 | 179 |
| 267 | 3300032004 | Ga0307414_10311890 | Ga0307414_103118902 | 179 |
| 268 | 3300032005 | Ga0307411_10125295 | Ga0307411_101252952 | 179 |
| 269 | 3300053735 | Ga0500596_008182 | Ga0500596_008182_860_1399 | 179 |
| 270 | 3300003214 | JGI25165J46597_1000065 | JGI25165J46597_1000065200 | 181 |
| 271 | 3300005335 | Ga0070666_10050123 | Ga0070666_100501234 | 181 |
| 272 | 3300005347 | Ga0070668_100004778 | Ga0070668_1000047782 | 181 |
| 273 | 3300005355 | Ga0070671_100000160 | Ga0070671_10000016011 | 181 |
| 274 | 3300005364 | Ga0070673_100039610 | Ga0070673_1000396102 | 181 |
| 275 | 3300005530 | Ga0070679_100077369 | Ga0070679_1000773693 | 181 |
| 276 | 3300005548 | Ga0070665_100641292 | Ga0070665_1006412922 | 181 |
| 277 | 3300005617 | Ga0068859_100126561 | Ga0068859_1001265612 | 181 |
| 278 | 3300005841 | Ga0068863_100000020 | Ga0068863_100000020153 | 181 |
| 279 | 3300005844 | Ga0068862_100005361 | Ga0068862_1000053617 | 181 |
| 280 | 3300006847 | Ga0075431_100006139 | Ga0075431_1000061396 | 181 |
| 281 | 3300006931 | Ga0097620_100126562 | Ga0097620_1001265622 | 181 |
| 282 | 3300009553 | Ga0105249_10003180 | Ga0105249_1000318010 | 181 |
| 283 | 3300013306 | Ga0163162_10352037 | Ga0163162_103520372 | 181 |
| 284 | 3300014326 | Ga0157380_10109416 | Ga0157380_101094163 | 181 |
| 285 | 3300025233 | Ga0209437_106934 | Ga0209437_1069343 | 181 |
| 286 | 3300025261 | Ga0209233_1000107 | Ga0209233_10001078 | 181 |
| 287 | 3300025903 | Ga0207680_10061485 | Ga0207680_100614852 | 181 |
| 288 | 3300025921 | Ga0207652_10091426 | Ga0207652_100914263 | 181 |
| 289 | 3300025931 | Ga0207644_10000097 | Ga0207644_1000009720 | 181 |
| 290 | 3300025960 | Ga0207651_10067139 | Ga0207651_100671393 | 181 |
| 291 | 3300025961 | Ga0207712_10037467 | Ga0207712_100374674 | 181 |
| 292 | 3300025972 | Ga0207668_10000364 | Ga0207668_1000036420 | 181 |
| 293 | 3300025972 | Ga0207668_10388454 | Ga0207668_103884541 | 181 |
| 294 | 3300026088 | Ga0207641_10000001 | Ga0207641_100000011102 | 181 |
| 295 | 3300026088 | Ga0207641_10766604 | Ga0207641_107666042 | 181 |
| 296 | 3300028379 | Ga0268266_10094286 | Ga0268266_100942864 | 181 |
| 297 | 3300028380 | Ga0268265_10007092 | Ga0268265_100070926 | 181 |
| 298 | 3300030742 | Ga0316183_1069303 | Ga0316183_10693031 | 181 |
| 299 | 3300031548 | Ga0307408_100015251 | Ga0307408_1000152513 | 181 |
| 300 | 3300031731 | Ga0307405_10043443 | Ga0307405_100434433 | 181 |
| 301 | 3300031824 | Ga0307413_10221626 | Ga0307413_102216261 | 181 |
| 302 | 3300031901 | Ga0307406_10002515 | Ga0307406_1000251510 | 181 |
| 303 | 3300031903 | Ga0307407_10022324 | Ga0307407_100223245 | 181 |
| 304 | 3300031911 | Ga0307412_10075911 | Ga0307412_100759112 | 181 |
| 305 | 3300031995 | Ga0307409_100098766 | Ga0307409_1000987662 | 181 |
| 306 | 3300031995 | Ga0307409_100291343 | Ga0307409_1002913432 | 181 |
| 307 | 3300032002 | Ga0307416_100037474 | Ga0307416_1000374742 | 181 |
| 308 | 3300032004 | Ga0307414_10349685 | Ga0307414_103496852 | 181 |
| 309 | 3300032005 | Ga0307411_10003811 | Ga0307411_100038113 | 181 |
| 310 | 3300032126 | Ga0307415_100083457 | Ga0307415_1000834574 | 181 |
| 311 | 3300041413 | Ga0439465_0004009 | Ga0439465_0004009_970_1515 | 181 |
| 312 | 3300042004 | Ga0439445_0012089 | Ga0439445_0012089_1423_1968 | 181 |
| 313 | 3300050510 | nmdc:mga06r32_10994_c1 | nmdc:mga06r32_10994_c1_4330_4878 | 181 |
| 314 | 3300053103 | Ga0500555_056606 | Ga0500555_056606_348_896 | 181 |
| 315 | 3300053136 | Ga0500559_0126118 | Ga0500559_0126118_442_987 | 181 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2j89-assembly1.cif.gz_A | functional and structural aspects of poplar cytosolic and plastidial type a methionine sulfoxide reductases | 0.9321 | 3 | 150 |
| 3bqg-assembly1.cif.gz_A | structure of the central domain (msra) of neisseria meningitidis pilb (sulfenic acid form) | 0.928 | 1 | 147 |
| 7e43-assembly2.cif.gz_A | structural insights into a bifunctional peptide methionine sulfoxide reductase msra/b fusion protein from helicobacter pylori | 0.9273 | 2 | 147 |
| 7e43-assembly1.cif.gz_B | structural insights into a bifunctional peptide methionine sulfoxide reductase msra/b fusion protein from helicobacter pylori | 0.9243 | 2 | 147 |
| 3bqf-assembly1.cif.gz_A | structure of the central domain (msra) of neisseria meningitidis pilb (complex with a substrate) | 0.9152 | 1 | 154 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q551H3_1_147_3.30.1060.10 | Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA | 0.9348 | 4 | 147 | 3.30.1060.10 |
| af_Q5AD39_5_182_3.30.1060.10 | Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA | 0.9314 | 3 | 147 | 3.30.1060.10 |
| af_B6TNT5_14_185_3.30.1060.10 | Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA | 0.9261 | 3 | 151 | 3.30.1060.10 |
| af_Q551H3_1_147_3.30.1060.10 | Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA | 0.9105 | 4 | 147 | 3.30.1060.10 |
| af_P0A084_1_166_3.30.1060.10 | Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA | 0.8979 | 1 | 163 | 3.30.1060.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3B0LYD3-F1-model_v4 | Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) | 0.947 | 1 | 161 |
GO:0008113
GO:0033744 GO:0036211 |
| AF-R5Q992-F1-model_v4 | Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) | 0.9416 | 2 | 150 |
GO:0008113
GO:0033743 GO:0033744 GO:0036211 |
| AF-A0A843CK81-F1-model_v4 | peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) | 0.9415 | 2 | 145 |
GO:0008113
|
| AF-A0A150Q9B7-F1-model_v4 | Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) | 0.9415 | 4 | 147 |
GO:0008113
GO:0033744 GO:0036211 |
| AF-A0A0J7IFK9-F1-model_v4 | Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) | 0.9394 | 3 | 169 |
GO:0008113
GO:0033743 GO:0033744 GO:0036211 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar