F403419

General Info

Members Datasets Scaffolds Average Seq Length
315 209 300 178

Family's Representative Sequence

Representative Sequence 3300053146|Ga0500588_0003571|Ga0500588_0003571_1673_2275
Length 200
Sequence MHVRIDDKRRVRSYLSSERRRDDMAKEVAIFAGGCFWCTEAVFKSLAGVEEVESGYIGGAVPHPSYKQVCGGDTGHAEAIRVTFDPETISYGDLLDVNFATHDPTTLNRQGNDVGTQYRSAIFPLSDEQRKEAEAGIMRANADYDGRVVTTIEGPAEWYPAENYHQDYWQNEGQRNPYCMAVIPPKLAKLRKGFAERLKA

Samples

Sample ID Description Type Environment
1 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
2 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
3 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
4 2739367664 Novosphingobium sp. GV002 Isolate Unclassified
5 2739367865 Novosphingobium sp. GV013 Isolate Unclassified
6 2773857759 Microbacterium sp. 1294 Isolate Unclassified
7 2818991438 Novosphingobium barchaimii 1192 Isolate Unclassified
8 2848297114 Croceibacterium ferulae EGI 63111 Isolate Unclassified
9 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
10 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
11 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
12 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
13 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
14 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
15 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
16 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
17 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
20 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
53 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
56 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
57 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
63 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
64 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
68 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
69 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
70 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
71 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
75 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
76 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
77 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
78 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
80 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
82 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
109 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
111 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
116 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
119 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
120 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
121 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
122 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
123 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
124 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
125 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
126 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
127 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
128 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
129 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
130 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
131 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
132 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
133 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
134 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
135 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
136 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
137 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
138 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
139 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
140 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
141 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
142 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
143 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
144 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
145 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
146 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
147 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
148 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
149 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
150 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
151 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
152 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
153 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
154 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
155 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
156 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
157 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
158 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
159 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
160 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
161 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
162 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
163 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
164 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
165 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
167 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
168 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
169 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
170 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
171 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
172 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
173 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
174 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
175 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
176 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
177 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
178 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
179 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
180 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
181 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
183 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
184 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
185 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
186 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
187 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
188 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
189 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
190 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
191 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
192 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
193 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
194 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
195 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
196 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
197 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
198 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
199 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
200 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
201 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
202 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
203 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
204 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
205 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
206 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
207 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
208 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
209 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.92
Metatranscriptomes 0.32
Isolates 4.76

Biome Distribution

Category Percentage (%)
Aerial Root 0.95
Bulb 0
Endosphere 23.81
Nodule 0.95
Rhizoplane 3.17
Rhizosphere 61.27
Stem 0
Stem Tuber 0
Unclassified 9.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25165J46597_1000065 3300003214 Bacteria 199761
2 Ga0055536_1000909 3300003781 Bacteria 19129
3 Ga0055536_1005009 3300003781 Bacteria 6584
4 Ga0055530_10000439 3300003791 Bacteria 36986
5 Ga0055530_10053082 3300003791 Bacteria 932
6 Ga0055531_10002007 3300003794 Bacteria 14133
7 Ga0065707_10545170 3300005295 Bacteria 725
8 Ga0070658_10000083 3300005327 Bacteria 89189
9 Ga0070670_100012280 3300005331 Bacteria 7330
10 Ga0070666_10003496 3300005335 Bacteria 9517
11 Ga0070666_10050123 3300005335 Bacteria 2808
12 Ga0070666_10110889 3300005335 Bacteria 1897
13 Ga0070682_100285593 3300005337 Bacteria 1205
14 Ga0070661_100743240 3300005344 Bacteria 802
15 Ga0070668_100004778 3300005347 Bacteria 10049
16 Ga0070668_100032482 3300005347 Bacteria 3972
17 Ga0070668_100712524 3300005347 Bacteria 886
18 Ga0070669_100000110 3300005353 Bacteria 79144
19 Ga0070675_100691412 3300005354 Bacteria 929
20 Ga0070671_100000004 3300005355 Bacteria 262155
21 Ga0070671_100000160 3300005355 Bacteria 44240
22 Ga0070673_100039610 3300005364 Bacteria 3608
23 Ga0070667_100007392 3300005367 Bacteria 9123
24 Ga0070705_100158058 3300005440 Bacteria 1512
25 Ga0070708_100695751 3300005445 Bacteria 957
26 Ga0070663_100578358 3300005455 Bacteria 942
27 Ga0070685_10603206 3300005466 Bacteria 790
28 Ga0070707_100430414 3300005468 Bacteria 1280
29 Ga0070679_100077369 3300005530 Bacteria 3316
30 Ga0070665_100015817 3300005548 Bacteria 7576
31 Ga0070665_100641292 3300005548 Bacteria 1075
32 Ga0068855_100108157 3300005563 Bacteria 3194
33 Ga0070664_100425929 3300005564 Bacteria 1216
34 Ga0068854_100001258 3300005578 Bacteria 15222
35 Ga0068856_100004828 3300005614 Bacteria 13365
36 Ga0068852_100000365 3300005616 Bacteria 30503
37 Ga0068852_100310456 3300005616 Bacteria 1529
38 Ga0068859_100000746 3300005617 Bacteria 32794
39 Ga0068859_100126561 3300005617 Bacteria 2624
40 Ga0068859_100546392 3300005617 Bacteria 1253
41 Ga0068864_100001835 3300005618 Bacteria 17465
42 Ga0068864_100013873 3300005618 Bacteria 6679
43 Ga0068861_100020160 3300005719 Bacteria 4770
44 Ga0068863_100000020 3300005841 Bacteria 198519
45 Ga0068863_100000052 3300005841 Bacteria 125430
46 Ga0068863_100015887 3300005841 Bacteria 7221
47 Ga0068858_100001524 3300005842 Bacteria 23805
48 Ga0068858_100111470 3300005842 Bacteria 2555
49 Ga0068860_100000007 3300005843 Bacteria 429329
50 Ga0068860_100050186 3300005843 Bacteria 3972
51 Ga0068860_100063402 3300005843 Bacteria 3511
52 Ga0068862_100000137 3300005844 Bacteria 82832
53 Ga0068862_100003499 3300005844 Bacteria 13482
54 Ga0068862_100005361 3300005844 Bacteria 10741
55 Ga0068862_100985042 3300005844 Bacteria 833
56 Ga0075365_10024446 3300006038 Bacteria 3812
57 Ga0075368_10000814 3300006042 Bacteria 9602
58 Ga0075363_100004578 3300006048 Bacteria 6065
59 Ga0075364_10062219 3300006051 Bacteria 2449
60 Ga0075362_10004964 3300006177 Bacteria 4823
61 Ga0075367_10031819 3300006178 Bacteria 3031
62 Ga0075369_10136397 3300006186 Bacteria 1117
63 Ga0075366_10019237 3300006195 Bacteria 3948
64 Ga0075366_10154877 3300006195 Bacteria 1388
65 Ga0075370_10026182 3300006353 Bacteria 3230
66 Ga0075370_10078403 3300006353 Bacteria 1897
67 Ga0075370_10274061 3300006353 Bacteria 1002
68 Ga0075370_10629193 3300006353 Bacteria 651
69 Ga0075370_10797049 3300006353 Bacteria 576
70 Ga0075431_100006139 3300006847 Bacteria 11921
71 Ga0097620_100000746 3300006931 Bacteria 32794
72 Ga0097620_100126562 3300006931 Bacteria 2624
73 Ga0097620_100546456 3300006931 Bacteria 1253
74 Ga0079104_1021464 3300006946 Bacteria 1757
75 Ga0079104_1021569 3300006946 Bacteria 1751
76 Ga0105251_10057917 3300009011 Bacteria 1830
77 Ga0105250_10181447 3300009092 Bacteria 883
78 Ga0105247_10000506 3300009101 Bacteria 32000
79 Ga0105248_10021667 3300009177 Bacteria 7119
80 Ga0105238_10002561 3300009551 Bacteria 18161
81 Ga0105249_10001762 3300009553 Bacteria 18861
82 Ga0105249_10003180 3300009553 Bacteria 14205
83 Ga0105239_10276385 3300010375 Bacteria 1890
84 Ga0163162_10003696 3300013306 Bacteria 14665
85 Ga0163162_10352037 3300013306 Bacteria 1605
86 Ga0157372_10635823 3300013307 Bacteria 1243
87 Ga0163163_10036098 3300014325 Bacteria 4799
88 Ga0157380_10109416 3300014326 Bacteria 2319
89 Ga0157380_10438349 3300014326 Bacteria 1251
90 Ga0157379_10058554 3300014968 Bacteria 3445
91 Ga0209437_106934 3300025233 Bacteria 1867
92 Ga0209233_1000107 3300025261 Bacteria 267399
93 Ga0209675_1000075 3300025291 Bacteria 161623
94 Ga0209676_1000457 3300025292 Bacteria 68913
95 Ga0209676_1000554 3300025292 Bacteria 56925
96 Ga0209676_1001099 3300025292 Bacteria 30043
97 Ga0209025_1007647 3300025294 Bacteria 7990
98 Ga0209050_1000017 3300025298 Bacteria 728928
99 Ga0209050_1016075 3300025298 Bacteria 3089
100 Ga0209050_1021141 3300025298 Bacteria 2386
101 Ga0209257_1000206 3300025304 Bacteria 142184
102 Ga0209257_1000456 3300025304 Bacteria 75804
103 Ga0209257_1003373 3300025304 Bacteria 13795
104 Ga0207697_10010432 3300025315 Bacteria 3972
105 Ga0207710_10001407 3300025900 Bacteria 12033
106 Ga0207680_10000161 3300025903 Bacteria 32807
107 Ga0207680_10061485 3300025903 Bacteria 2291
108 Ga0207680_10145567 3300025903 Bacteria 1575
109 Ga0207647_10015730 3300025904 Bacteria 5180
110 Ga0207705_10000009 3300025909 Bacteria 576128
111 Ga0207705_10462050 3300025909 Bacteria 985
112 Ga0207695_10018669 3300025913 Bacteria 8010
113 Ga0207652_10091426 3300025921 Bacteria 2676
114 Ga0207681_10000010 3300025923 Bacteria 403379
115 Ga0207694_10020862 3300025924 Bacteria 4960
116 Ga0207650_10105379 3300025925 Bacteria 2177
117 Ga0207644_10000007 3300025931 Bacteria 381778
118 Ga0207644_10000097 3300025931 Bacteria 63086
119 Ga0207711_10044211 3300025941 Bacteria 3802
120 Ga0207661_10499030 3300025944 Bacteria 1112
121 Ga0207667_10361160 3300025949 Bacteria 1481
122 Ga0207651_10067139 3300025960 Bacteria 2523
123 Ga0207712_10037467 3300025961 Bacteria 3309
124 Ga0207712_10147243 3300025961 Bacteria 1815
125 Ga0207668_10000364 3300025972 Bacteria 28957
126 Ga0207668_10011203 3300025972 Bacteria 5442
127 Ga0207668_10388454 3300025972 Bacteria 1177
128 Ga0207658_10001853 3300025986 Bacteria 15830
129 Ga0207658_10046829 3300025986 Bacteria 3160
130 Ga0207703_10012780 3300026035 Bacteria 6545
131 Ga0207703_10033293 3300026035 Bacteria 4084
132 Ga0207639_10278270 3300026041 Bacteria 1471
133 Ga0207678_10246571 3300026067 Bacteria 1530
134 Ga0207702_10037227 3300026078 Bacteria 4072
135 Ga0207641_10000001 3300026088 Bacteria 1180841
136 Ga0207641_10000042 3300026088 Bacteria 186384
137 Ga0207641_10015799 3300026088 Bacteria 6183
138 Ga0207641_10499322 3300026088 Bacteria 1181
139 Ga0207641_10766604 3300026088 Bacteria 953
140 Ga0207676_10036351 3300026095 Bacteria 3745
141 Ga0207675_100000263 3300026118 Bacteria 50093
142 Ga0207698_10000714 3300026142 Bacteria 19200
143 Ga0207698_10076976 3300026142 Bacteria 2673
144 Ga0209281_1019310 3300027111 Bacteria 1348
145 Ga0209982_1010103 3300027552 Bacteria 1398
146 Ga0209813_10000603 3300027866 Bacteria 8358
147 Ga0209974_10014092 3300027876 Bacteria 2663
148 Ga0268266_10044841 3300028379 Bacteria 3781
149 Ga0268266_10094286 3300028379 Bacteria 2627
150 Ga0268265_10000058 3300028380 Bacteria 154702
151 Ga0268265_10007092 3300028380 Bacteria 7574
152 Ga0268265_10022876 3300028380 Bacteria 4399
153 Ga0268264_10000134 3300028381 Bacteria 179475
154 Ga0268264_10000551 3300028381 Bacteria 47040
155 Ga0268264_10039853 3300028381 Bacteria 3881
156 Ga0316183_1069303 3300030742 Bacteria 706
157 Ga0265331_10041068 3300031250 Bacteria 2249
158 Ga0307408_100015251 3300031548 Bacteria 5116
159 Ga0307408_101483999 3300031548 Bacteria 641
160 Ga0316579_10083207 3300031691 Bacteria 1525
161 Ga0307405_10043443 3300031731 Bacteria 2742
162 Ga0307413_10221626 3300031824 Bacteria 1382
163 Ga0307413_10334510 3300031824 Bacteria 1162
164 Ga0307413_10337439 3300031824 Bacteria 1158
165 Ga0307410_10004453 3300031852 Bacteria 7245
166 Ga0307406_10002515 3300031901 Bacteria 9995
167 Ga0307406_10283444 3300031901 Bacteria 1265
168 Ga0307407_10012110 3300031903 Bacteria 4135
169 Ga0307407_10022324 3300031903 Bacteria 3281
170 Ga0307412_10005529 3300031911 Bacteria 7097
171 Ga0307412_10035279 3300031911 Bacteria 3194
172 Ga0307412_10075911 3300031911 Bacteria 2307
173 Ga0307412_10194731 3300031911 Bacteria 1535
174 Ga0307412_10350172 3300031911 Bacteria 1186
175 Ga0307409_100098766 3300031995 Bacteria 2415
176 Ga0307409_100291343 3300031995 Bacteria 1514
177 Ga0307416_100037474 3300032002 Bacteria 3731
178 Ga0307416_100651596 3300032002 Bacteria 1138
179 Ga0307414_10000070 3300032004 Bacteria 96231
180 Ga0307414_10036542 3300032004 Bacteria 3280
181 Ga0307414_10068609 3300032004 Bacteria 2545
182 Ga0307414_10108760 3300032004 Bacteria 2104
183 Ga0307414_10311890 3300032004 Bacteria 1335
184 Ga0307414_10349685 3300032004 Bacteria 1268
185 Ga0307414_10734975 3300032004 Bacteria 896
186 Ga0307411_10003811 3300032005 Bacteria 7090
187 Ga0307411_10125295 3300032005 Bacteria 1867
188 Ga0307411_10145451 3300032005 Bacteria 1754
189 Ga0307415_100083457 3300032126 Bacteria 2289
190 Ga0316583_10004739 3300032133 Bacteria 4859
191 Ga0316582_0094463 3300036647 Bacteria 1973
192 Ga0316582_0792611 3300036647 Bacteria 649
193 Ga0439465_0004009 3300041413 Bacteria 4799
194 Ga0439445_0012089 3300042004 Bacteria 2068
195 Ga0439435_0008825 3300042436 Bacteria 2349
196 Ga0495639_0086521 3300046475 Bacteria 1466
197 Ga0495643_0047369 3300046522 Bacteria 2328
198 Ga0495643_0224244 3300046522 Bacteria 890
199 Ga0495654_0001285 3300046530 Bacteria 17616
200 Ga0495598_0004101 3300046537 Bacteria 3135
201 Ga0495668_0001806 3300046616 Bacteria 19490
202 Ga0495668_0231370 3300046616 Bacteria 1012
203 Ga0495668_0302580 3300046616 Bacteria 877
204 Ga0495625_0000936 3300046660 Bacteria 39185
205 Ga0495687_108330 3300047443 Bacteria 1027
206 Ga0496101_0499155 3300048904 Bacteria 961
207 Ga0496102_0163369 3300048905 Bacteria 2095
208 Ga0496103_0190364 3300048906 Bacteria 1319
209 Ga0496103_0265322 3300048906 Bacteria 1105
210 Ga0496104_0016596 3300048907 Bacteria 6692
211 Ga0496105_0014243 3300048908 Bacteria 6327
212 Ga0496105_1115247 3300048908 Bacteria 585
213 Ga0496107_0076605 3300048910 Bacteria 2436
214 Ga0496110_0091850 3300048913 Bacteria 2716
215 Ga0496111_0975386 3300048914 Bacteria 608
216 Ga0496116_0000035 3300048919 Bacteria 402424
217 Ga0496117_0053276 3300048920 Bacteria 2844
218 Ga0496117_0094870 3300048920 Bacteria 1908
219 Ga0496118_0031975 3300048921 Bacteria 4347
220 Ga0496118_0142444 3300048921 Bacteria 1516
221 Ga0496119_0105100 3300048922 Bacteria 1578
222 Ga0496120_0124576 3300048923 Bacteria 1328
223 Ga0496121_0000087 3300048924 Bacteria 222451
224 Ga0496121_0003927 3300048924 Bacteria 20608
225 Ga0496122_0021058 3300048925 Bacteria 5856
226 Ga0496123_0002756 3300048926 Bacteria 21027
227 Ga0496123_0083091 3300048926 Bacteria 1938
228 Ga0496124_0003962 3300048927 Bacteria 17654
229 Ga0496124_0010337 3300048927 Bacteria 9467
230 Ga0496124_0035362 3300048927 Bacteria 4371
231 Ga0496124_0038562 3300048927 Bacteria 4148
232 Ga0496125_0026241 3300048928 Bacteria 5313
233 Ga0496126_0000084 3300048929 Bacteria 217111
234 Ga0496126_0141223 3300048929 Bacteria 2073
235 Ga0496126_0159410 3300048929 Bacteria 1929
236 Ga0501292_000008 3300049515 Bacteria 83748
237 Ga0501294_000256 3300049517 Bacteria 6545
238 Ga0501297_003212 3300049520 Bacteria 1617
239 Ga0501300_000579 3300049523 Bacteria 5482
240 Ga0501335_027402 3300049551 Bacteria 632
241 Ga0501206_001048 3300049653 Bacteria 3451
242 Ga0501223_000865 3300049663 Bacteria 7187
243 Ga0501224_012473 3300049664 Bacteria 1252
244 Ga0501227_001961 3300049665 Bacteria 4574
245 Ga0501233_013731 3300049668 Bacteria 1647
246 Ga0501235_006556 3300049669 Bacteria 2535
247 Ga0501257_059104 3300049686 Bacteria 967
248 Ga0501259_000164 3300049688 Bacteria 10004
249 Ga0501261_000020 3300049690 Bacteria 37889
250 Ga0501221_002785 3300049704 Bacteria 2877
251 Ga0501262_008229 3300049759 Bacteria 1274
252 Ga0501279_000002 3300049775 Bacteria 205937
253 Ga0501280_000010 3300049776 Bacteria 63153
254 Ga0501281_00115 3300049777 Bacteria 9747
255 Ga0501282_000387 3300049778 Bacteria 5324
256 Ga0501044_0009663 3300049823 Bacteria 10492
257 Ga0501044_0852803 3300049823 Bacteria 788
258 Ga0501226_012577 3300049853 Bacteria 937
259 nmdc:mga03683_391_c1 3300050489 Bacteria 12569
260 nmdc:mga00v17_29707_c1 3300050491 Bacteria 3210
261 nmdc:mga0yw44_22632_c1 3300050492 Bacteria 3527
262 nmdc:mga0k408_126766_c1 3300050493 Bacteria 1514
263 nmdc:mga0k408_175083_c1 3300050493 Bacteria 1279
264 nmdc:mga0k408_210086_c1 3300050493 Bacteria 1162
265 nmdc:mga0k408_53531_c1 3300050493 Bacteria 2340
266 nmdc:mga06z11_129_c1 3300050494 Bacteria 30757
267 nmdc:mga04h51_461_c1 3300050495 Bacteria 9759
268 nmdc:mga07m45_1229_c1 3300050496 Bacteria 11611
269 nmdc:mga07m45_126245_c1 3300050496 Bacteria 1479
270 nmdc:mga07m45_213001_c1 3300050496 Bacteria 1124
271 nmdc:mga07m45_377428_c1 3300050496 Bacteria 823
272 nmdc:mga07m45_383_c1 3300050496 Bacteria 17738
273 nmdc:mga07m45_44227_c1 3300050496 Bacteria 2498
274 nmdc:mga07m45_539734_c1 3300050496 Bacteria 675
275 nmdc:mga06r32_10994_c1 3300050510 Bacteria 8148
276 Ga0500647_0042113 3300053091 Bacteria 2192
277 Ga0500555_056606 3300053103 Bacteria 1063
278 Ga0500594_0052140 3300053118 Bacteria 1155
279 Ga0500595_058216 3300053119 Bacteria 1175
280 Ga0500607_000003 3300053121 Bacteria 149664
281 Ga0500608_002768 3300053122 Bacteria 6460
282 Ga0500618_001469 3300053125 Bacteria 10447
283 Ga0500618_026501 3300053125 Bacteria 1384
284 Ga0500658_0091436 3300053134 Bacteria 1316
285 Ga0500559_0000887 3300053136 Bacteria 19149
286 Ga0500559_0022107 3300053136 Bacteria 2697
287 Ga0500559_0028282 3300053136 Bacteria 2395
288 Ga0500559_0126118 3300053136 Bacteria 1193
289 Ga0500564_001539 3300053138 Bacteria 8026
290 Ga0500568_0001144 3300053139 Bacteria 17799
291 Ga0500588_0003571 3300053146 Bacteria 3297
292 Ga0500604_0005548 3300053151 Bacteria 3330
293 Ga0500604_0237117 3300053151 Bacteria 630
294 Ga0500627_0000173 3300053158 Bacteria 19050
295 Ga0500637_0001437 3300053178 Bacteria 10142
296 Ga0500567_001496 3300053723 Bacteria 9477
297 Ga0500625_000001 3300053729 Bacteria 395993
298 Ga0500645_004031 3300053730 Bacteria 5768
299 Ga0500645_028410 3300053730 Bacteria 1692
300 Ga0500596_008182 3300053735 Bacteria 1676

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005564 Ga0070664_100425929 Ga0070664_1004259292 160
2 3300003781 Ga0055536_1000909 Ga0055536_10009095 166
3 3300003781 Ga0055536_1005009 Ga0055536_10050093 166
4 3300003791 Ga0055530_10000439 Ga0055530_1000043922 166
5 3300003794 Ga0055531_10002007 Ga0055531_1000200715 166
6 3300006353 Ga0075370_10274061 Ga0075370_102740612 166
7 3300025291 Ga0209675_1000075 Ga0209675_1000075114 166
8 3300025292 Ga0209676_1000554 Ga0209676_100055423 166
9 3300025292 Ga0209676_1001099 Ga0209676_100109934 166
10 3300025294 Ga0209025_1007647 Ga0209025_10076472 166
11 3300025298 Ga0209050_1000017 Ga0209050_1000017120 166
12 3300025298 Ga0209050_1016075 Ga0209050_10160753 166
13 3300025304 Ga0209257_1000206 Ga0209257_1000206126 166
14 3300031901 Ga0307406_10283444 Ga0307406_102834442 166
15 3300031911 Ga0307412_10035279 Ga0307412_100352793 166
16 3300032005 Ga0307411_10145451 Ga0307411_101454512 166
17 iso_pu_bacteria 2773857759 2774384340 167
18 iso_pu_bacteria 2977251589 2977254073 167
19 3300025903 Ga0207680_10145567 Ga0207680_101455672 170
20 iso_pu_bacteria 2739367664 2739648902 171
21 iso_pu_bacteria 2739367865 2740027375 171
22 iso_pu_bacteria 2818991438 2819552336 171
23 iso_pu_bacteria 2895880812 2895881383 172
24 3300031852 Ga0307410_10004453 Ga0307410_100044536 173
25 3300031903 Ga0307407_10012110 Ga0307407_100121102 173
26 3300032004 Ga0307414_10108760 Ga0307414_101087603 173
27 3300046522 Ga0495643_0224244 Ga0495643_0224244_55_594 173
28 3300005844 Ga0068862_100985042 Ga0068862_1009850421 174
29 3300048906 Ga0496103_0265322 Ga0496103_0265322_403_927 174
30 3300048907 Ga0496104_0016596 Ga0496104_0016596_2300_2824 174
31 3300048908 Ga0496105_0014243 Ga0496105_0014243_2955_3479 174
32 iso_pu_bacteria 2643221563 2643834335 174
33 iso_pu_bacteria 2643221588 2643951612 174
34 iso_pu_bacteria 2643221608 2644055260 174
35 iso_pu_bacteria 2848297114 2848298859 174
36 iso_pu_bacteria 2852653556 2852654317 174
37 3300005295 Ga0065707_10545170 Ga0065707_105451701 175
38 3300005327 Ga0070658_10000083 Ga0070658_1000008374 175
39 3300005335 Ga0070666_10110889 Ga0070666_101108893 175
40 3300005347 Ga0070668_100712524 Ga0070668_1007125241 175
41 3300005440 Ga0070705_100158058 Ga0070705_1001580582 175
42 3300005468 Ga0070707_100430414 Ga0070707_1004304142 175
43 3300005563 Ga0068855_100108157 Ga0068855_1001081572 175
44 3300005578 Ga0068854_100001258 Ga0068854_1000012582 175
45 3300005614 Ga0068856_100004828 Ga0068856_10000482810 175
46 3300005616 Ga0068852_100000365 Ga0068852_10000036526 175
47 3300005616 Ga0068852_100310456 Ga0068852_1003104562 175
48 3300005617 Ga0068859_100546392 Ga0068859_1005463922 175
49 3300005843 Ga0068860_100063402 Ga0068860_1000634025 175
50 3300005844 Ga0068862_100003499 Ga0068862_10000349914 175
51 3300006195 Ga0075366_10154877 Ga0075366_101548772 175
52 3300006353 Ga0075370_10078403 Ga0075370_100784033 175
53 3300006353 Ga0075370_10629193 Ga0075370_106291931 175
54 3300006931 Ga0097620_100546456 Ga0097620_1005464562 175
55 3300009092 Ga0105250_10181447 Ga0105250_101814471 175
56 3300025904 Ga0207647_10015730 Ga0207647_100157304 175
57 3300025909 Ga0207705_10000009 Ga0207705_10000009470 175
58 3300025913 Ga0207695_10018669 Ga0207695_100186691 175
59 3300025924 Ga0207694_10020862 Ga0207694_100208622 175
60 3300025944 Ga0207661_10499030 Ga0207661_104990302 175
61 3300025949 Ga0207667_10361160 Ga0207667_103611602 175
62 3300026078 Ga0207702_10037227 Ga0207702_100372272 175
63 3300026088 Ga0207641_10499322 Ga0207641_104993222 175
64 3300026142 Ga0207698_10000714 Ga0207698_100007144 175
65 3300026142 Ga0207698_10076976 Ga0207698_100769764 175
66 3300028380 Ga0268265_10022876 Ga0268265_100228765 175
67 3300028381 Ga0268264_10039853 Ga0268264_100398532 175
68 3300031250 Ga0265331_10041068 Ga0265331_100410682 175
69 3300046475 Ga0495639_0086521 Ga0495639_0086521_33_560 175
70 3300047443 Ga0495687_108330 Ga0495687_108330_134_661 175
71 3300048904 Ga0496101_0499155 Ga0496101_0499155_259_804 175
72 3300048919 Ga0496116_0000035 Ga0496116_0000035_185614_186159 175
73 3300048920 Ga0496117_0094870 Ga0496117_0094870_1161_1706 175
74 3300048921 Ga0496118_0142444 Ga0496118_0142444_46_591 175
75 3300048924 Ga0496121_0003927 Ga0496121_0003927_11618_12163 175
76 3300048925 Ga0496122_0021058 Ga0496122_0021058_1720_2265 175
77 3300048926 Ga0496123_0002756 Ga0496123_0002756_8328_8873 175
78 3300048927 Ga0496124_0003962 Ga0496124_0003962_5180_5725 175
79 3300048927 Ga0496124_0010337 Ga0496124_0010337_1683_2228 175
80 3300048928 Ga0496125_0026241 Ga0496125_0026241_2416_2961 175
81 3300048929 Ga0496126_0000084 Ga0496126_0000084_31826_32371 175
82 3300050493 nmdc:mga0k408_175083_c1 nmdc:mga0k408_175083_c1_119_646 175
83 3300050496 nmdc:mga07m45_44227_c1 nmdc:mga07m45_44227_c1_98_625 175
84 3300050496 nmdc:mga07m45_539734_c1 nmdc:mga07m45_539734_c1_57_584 175
85 3300053091 Ga0500647_0042113 Ga0500647_0042113_602_1129 175
86 3300053118 Ga0500594_0052140 Ga0500594_0052140_593_1120 175
87 3300053122 Ga0500608_002768 Ga0500608_002768_2664_3191 175
88 3300053125 Ga0500618_001469 Ga0500618_001469_9603_10172 175
89 3300053136 Ga0500559_0028282 Ga0500559_0028282_358_885 175
90 3300053138 Ga0500564_001539 Ga0500564_001539_6476_7003 175
91 3300053723 Ga0500567_001496 Ga0500567_001496_931_1458 175
92 3300053729 Ga0500625_000001 Ga0500625_000001_228596_229123 175
93 iso_pu_bacteria 2928027323 2928028273 175
94 iso_pu_bacteria 2984555340 2984556242 175
95 iso_pu_bacteria 2984564862 2984565590 175
96 iso_pu_bacteria 2993356040 2993356661 175
97 3300005344 Ga0070661_100743240 Ga0070661_1007432401 176
98 3300005618 Ga0068864_100001835 Ga0068864_1000018355 176
99 3300005841 Ga0068863_100000052 Ga0068863_10000005281 176
100 3300026088 Ga0207641_10000042 Ga0207641_1000004281 176
101 3300031911 Ga0307412_10350172 Ga0307412_103501722 176
102 3300005331 Ga0070670_100012280 Ga0070670_1000122809 177
103 3300005335 Ga0070666_10003496 Ga0070666_100034966 177
104 3300005347 Ga0070668_100032482 Ga0070668_1000324822 177
105 3300005353 Ga0070669_100000110 Ga0070669_10000011056 177
106 3300005355 Ga0070671_100000004 Ga0070671_10000000435 177
107 3300005367 Ga0070667_100007392 Ga0070667_1000073924 177
108 3300005445 Ga0070708_100695751 Ga0070708_1006957512 177
109 3300005617 Ga0068859_100000746 Ga0068859_10000074624 177
110 3300005618 Ga0068864_100013873 Ga0068864_1000138738 177
111 3300005719 Ga0068861_100020160 Ga0068861_1000201605 177
112 3300005841 Ga0068863_100015887 Ga0068863_1000158875 177
113 3300005842 Ga0068858_100001524 Ga0068858_10000152412 177
114 3300005842 Ga0068858_100111470 Ga0068858_1001114701 177
115 3300005843 Ga0068860_100050186 Ga0068860_1000501862 177
116 3300005844 Ga0068862_100000137 Ga0068862_10000013731 177
117 3300006038 Ga0075365_10024446 Ga0075365_100244463 177
118 3300006042 Ga0075368_10000814 Ga0075368_100008145 177
119 3300006048 Ga0075363_100004578 Ga0075363_1000045784 177
120 3300006051 Ga0075364_10062219 Ga0075364_100622193 177
121 3300006177 Ga0075362_10004964 Ga0075362_100049644 177
122 3300006178 Ga0075367_10031819 Ga0075367_100318193 177
123 3300006186 Ga0075369_10136397 Ga0075369_101363971 177
124 3300006195 Ga0075366_10019237 Ga0075366_100192374 177
125 3300006353 Ga0075370_10026182 Ga0075370_100261824 177
126 3300006353 Ga0075370_10797049 Ga0075370_107970491 177
127 3300006931 Ga0097620_100000746 Ga0097620_10000074624 177
128 3300006946 Ga0079104_1021464 Ga0079104_10214642 177
129 3300009011 Ga0105251_10057917 Ga0105251_100579171 177
130 3300009101 Ga0105247_10000506 Ga0105247_1000050615 177
131 3300009177 Ga0105248_10021667 Ga0105248_100216676 177
132 3300009551 Ga0105238_10002561 Ga0105238_100025614 177
133 3300009553 Ga0105249_10001762 Ga0105249_100017625 177
134 3300010375 Ga0105239_10276385 Ga0105239_102763852 177
135 3300013306 Ga0163162_10003696 Ga0163162_100036965 177
136 3300013307 Ga0157372_10635823 Ga0157372_106358232 177
137 3300014325 Ga0163163_10036098 Ga0163163_100360985 177
138 3300014968 Ga0157379_10058554 Ga0157379_100585543 177
139 3300025315 Ga0207697_10010432 Ga0207697_100104324 177
140 3300025900 Ga0207710_10001407 Ga0207710_1000140712 177
141 3300025903 Ga0207680_10000161 Ga0207680_1000016124 177
142 3300025909 Ga0207705_10462050 Ga0207705_104620502 177
143 3300025923 Ga0207681_10000010 Ga0207681_1000001041 177
144 3300025925 Ga0207650_10105379 Ga0207650_101053792 177
145 3300025931 Ga0207644_10000007 Ga0207644_1000000741 177
146 3300025941 Ga0207711_10044211 Ga0207711_100442112 177
147 3300025961 Ga0207712_10147243 Ga0207712_101472432 177
148 3300025972 Ga0207668_10011203 Ga0207668_100112035 177
149 3300025986 Ga0207658_10046829 Ga0207658_100468294 177
150 3300026035 Ga0207703_10012780 Ga0207703_100127806 177
151 3300026035 Ga0207703_10033293 Ga0207703_100332932 177
152 3300026041 Ga0207639_10278270 Ga0207639_102782702 177
153 3300026088 Ga0207641_10015799 Ga0207641_100157993 177
154 3300026095 Ga0207676_10036351 Ga0207676_100363515 177
155 3300026118 Ga0207675_100000263 Ga0207675_10000026323 177
156 3300027552 Ga0209982_1010103 Ga0209982_10101032 177
157 3300027866 Ga0209813_10000603 Ga0209813_100006035 177
158 3300027876 Ga0209974_10014092 Ga0209974_100140923 177
159 3300028380 Ga0268265_10000058 Ga0268265_10000058145 177
160 3300028381 Ga0268264_10000551 Ga0268264_1000055128 177
161 3300032004 Ga0307414_10734975 Ga0307414_107349752 177
162 3300042436 Ga0439435_0008825 Ga0439435_0008825_589_1125 177
163 3300046530 Ga0495654_0001285 Ga0495654_0001285_13764_14297 177
164 3300046616 Ga0495668_0001806 Ga0495668_0001806_7031_7564 177
165 3300046616 Ga0495668_0231370 Ga0495668_0231370_166_705 177
166 3300046616 Ga0495668_0302580 Ga0495668_0302580_324_860 177
167 3300048905 Ga0496102_0163369 Ga0496102_0163369_798_1331 177
168 3300048906 Ga0496103_0190364 Ga0496103_0190364_773_1306 177
169 3300048908 Ga0496105_1115247 Ga0496105_1115247_35_568 177
170 3300048910 Ga0496107_0076605 Ga0496107_0076605_679_1212 177
171 3300048913 Ga0496110_0091850 Ga0496110_0091850_554_1087 177
172 3300048914 Ga0496111_0975386 Ga0496111_0975386_35_568 177
173 3300048920 Ga0496117_0053276 Ga0496117_0053276_1147_1680 177
174 3300048921 Ga0496118_0031975 Ga0496118_0031975_2471_3004 177
175 3300048922 Ga0496119_0105100 Ga0496119_0105100_434_967 177
176 3300048923 Ga0496120_0124576 Ga0496120_0124576_31_564 177
177 3300048924 Ga0496121_0000087 Ga0496121_0000087_46172_46711 177
178 3300048926 Ga0496123_0083091 Ga0496123_0083091_260_793 177
179 3300048927 Ga0496124_0035362 Ga0496124_0035362_2007_2540 177
180 3300048927 Ga0496124_0038562 Ga0496124_0038562_489_1022 177
181 3300048929 Ga0496126_0159410 Ga0496126_0159410_32_565 177
182 3300049515 Ga0501292_000008 Ga0501292_000008_16417_16950 177
183 3300049517 Ga0501294_000256 Ga0501294_000256_2356_2889 177
184 3300049520 Ga0501297_003212 Ga0501297_003212_898_1431 177
185 3300049523 Ga0501300_000579 Ga0501300_000579_279_812 177
186 3300049551 Ga0501335_027402 Ga0501335_027402_53_586 177
187 3300049653 Ga0501206_001048 Ga0501206_001048_593_1126 177
188 3300049663 Ga0501223_000865 Ga0501223_000865_6197_6730 177
189 3300049664 Ga0501224_012473 Ga0501224_012473_65_742 177
190 3300049665 Ga0501227_001961 Ga0501227_001961_3921_4454 177
191 3300049668 Ga0501233_013731 Ga0501233_013731_1036_1569 177
192 3300049669 Ga0501235_006556 Ga0501235_006556_1864_2397 177
193 3300049686 Ga0501257_059104 Ga0501257_059104_218_751 177
194 3300049688 Ga0501259_000164 Ga0501259_000164_8031_8564 177
195 3300049690 Ga0501261_000020 Ga0501261_000020_19394_19927 177
196 3300049704 Ga0501221_002785 Ga0501221_002785_817_1350 177
197 3300049775 Ga0501279_000002 Ga0501279_000002_88349_88882 177
198 3300049776 Ga0501280_000010 Ga0501280_000010_31072_31605 177
199 3300049777 Ga0501281_00115 Ga0501281_00115_302_835 177
200 3300049778 Ga0501282_000387 Ga0501282_000387_2535_3068 177
201 3300049823 Ga0501044_0009663 Ga0501044_0009663_1973_2524 177
202 3300049823 Ga0501044_0852803 Ga0501044_0852803_70_609 177
203 3300049853 Ga0501226_012577 Ga0501226_012577_352_885 177
204 3300050489 nmdc:mga03683_391_c1 nmdc:mga03683_391_c1_4073_4609 177
205 3300050491 nmdc:mga00v17_29707_c1 nmdc:mga00v17_29707_c1_984_1520 177
206 3300050492 nmdc:mga0yw44_22632_c1 nmdc:mga0yw44_22632_c1_2816_3352 177
207 3300050493 nmdc:mga0k408_53531_c1 nmdc:mga0k408_53531_c1_432_968 177
208 3300050494 nmdc:mga06z11_129_c1 nmdc:mga06z11_129_c1_557_1093 177
209 3300050495 nmdc:mga04h51_461_c1 nmdc:mga04h51_461_c1_4067_4603 177
210 3300050496 nmdc:mga07m45_1229_c1 nmdc:mga07m45_1229_c1_4087_4623 177
211 3300050496 nmdc:mga07m45_126245_c1 nmdc:mga07m45_126245_c1_51_587 177
212 3300050496 nmdc:mga07m45_213001_c1 nmdc:mga07m45_213001_c1_98_646 177
213 3300050496 nmdc:mga07m45_377428_c1 nmdc:mga07m45_377428_c1_210_749 177
214 3300050496 nmdc:mga07m45_383_c1 nmdc:mga07m45_383_c1_9353_9889 177
215 3300053119 Ga0500595_058216 Ga0500595_058216_90_626 177
216 3300053121 Ga0500607_000003 Ga0500607_000003_2434_2982 177
217 3300053125 Ga0500618_026501 Ga0500618_026501_802_1341 177
218 3300053134 Ga0500658_0091436 Ga0500658_0091436_682_1215 177
219 3300053136 Ga0500559_0000887 Ga0500559_0000887_13087_13635 177
220 3300053136 Ga0500559_0022107 Ga0500559_0022107_1423_1959 177
221 3300053146 Ga0500588_0003571 Ga0500588_0003571_1673_2275 177
222 3300053151 Ga0500604_0005548 Ga0500604_0005548_1260_1793 177
223 3300053151 Ga0500604_0237117 Ga0500604_0237117_29_568 177
224 3300053158 Ga0500627_0000173 Ga0500627_0000173_11916_12449 177
225 3300053178 Ga0500637_0001437 Ga0500637_0001437_6686_7234 177
226 3300053730 Ga0500645_004031 Ga0500645_004031_1641_2189 177
227 3300053730 Ga0500645_028410 Ga0500645_028410_672_1208 177
228 3300003791 Ga0055530_10053082 Ga0055530_100530822 178
229 3300005337 Ga0070682_100285593 Ga0070682_1002855932 178
230 3300005354 Ga0070675_100691412 Ga0070675_1006914122 178
231 3300005455 Ga0070663_100578358 Ga0070663_1005783581 178
232 3300005466 Ga0070685_10603206 Ga0070685_106032062 178
233 3300006946 Ga0079104_1021569 Ga0079104_10215692 178
234 3300014326 Ga0157380_10438349 Ga0157380_104383492 178
235 3300025292 Ga0209676_1000457 Ga0209676_100045751 178
236 3300025298 Ga0209050_1021141 Ga0209050_10211413 178
237 3300025304 Ga0209257_1000456 Ga0209257_100045627 178
238 3300025304 Ga0209257_1003373 Ga0209257_10033735 178
239 3300026067 Ga0207678_10246571 Ga0207678_102465712 178
240 3300027111 Ga0209281_1019310 Ga0209281_10193102 178
241 3300031548 Ga0307408_101483999 Ga0307408_1014839991 178
242 3300031691 Ga0316579_10083207 Ga0316579_100832072 178
243 3300031824 Ga0307413_10334510 Ga0307413_103345102 178
244 3300031824 Ga0307413_10337439 Ga0307413_103374391 178
245 3300031911 Ga0307412_10005529 Ga0307412_100055295 178
246 3300031911 Ga0307412_10194731 Ga0307412_101947312 178
247 3300032002 Ga0307416_100651596 Ga0307416_1006515962 178
248 3300032004 Ga0307414_10000070 Ga0307414_1000007079 178
249 3300032004 Ga0307414_10036542 Ga0307414_100365423 178
250 3300032004 Ga0307414_10068609 Ga0307414_100686092 178
251 3300032133 Ga0316583_10004739 Ga0316583_100047394 178
252 3300036647 Ga0316582_0094463 Ga0316582_0094463_408_947 178
253 3300036647 Ga0316582_0792611 Ga0316582_0792611_17_556 178
254 3300046522 Ga0495643_0047369 Ga0495643_0047369_980_1516 178
255 3300046537 Ga0495598_0004101 Ga0495598_0004101_1004_1558 178
256 3300046660 Ga0495625_0000936 Ga0495625_0000936_23229_23765 178
257 3300048929 Ga0496126_0141223 Ga0496126_0141223_930_1466 178
258 3300049759 Ga0501262_008229 Ga0501262_008229_405_941 178
259 3300050493 nmdc:mga0k408_126766_c1 nmdc:mga0k408_126766_c1_661_1197 178
260 3300050493 nmdc:mga0k408_210086_c1 nmdc:mga0k408_210086_c1_162_746 178
261 3300053139 Ga0500568_0001144 Ga0500568_0001144_1140_1676 178
262 3300005548 Ga0070665_100015817 Ga0070665_1000158178 179
263 3300005843 Ga0068860_100000007 Ga0068860_100000007336 179
264 3300025986 Ga0207658_10001853 Ga0207658_100018536 179
265 3300028379 Ga0268266_10044841 Ga0268266_100448413 179
266 3300028381 Ga0268264_10000134 Ga0268264_1000013479 179
267 3300032004 Ga0307414_10311890 Ga0307414_103118902 179
268 3300032005 Ga0307411_10125295 Ga0307411_101252952 179
269 3300053735 Ga0500596_008182 Ga0500596_008182_860_1399 179
270 3300003214 JGI25165J46597_1000065 JGI25165J46597_1000065200 181
271 3300005335 Ga0070666_10050123 Ga0070666_100501234 181
272 3300005347 Ga0070668_100004778 Ga0070668_1000047782 181
273 3300005355 Ga0070671_100000160 Ga0070671_10000016011 181
274 3300005364 Ga0070673_100039610 Ga0070673_1000396102 181
275 3300005530 Ga0070679_100077369 Ga0070679_1000773693 181
276 3300005548 Ga0070665_100641292 Ga0070665_1006412922 181
277 3300005617 Ga0068859_100126561 Ga0068859_1001265612 181
278 3300005841 Ga0068863_100000020 Ga0068863_100000020153 181
279 3300005844 Ga0068862_100005361 Ga0068862_1000053617 181
280 3300006847 Ga0075431_100006139 Ga0075431_1000061396 181
281 3300006931 Ga0097620_100126562 Ga0097620_1001265622 181
282 3300009553 Ga0105249_10003180 Ga0105249_1000318010 181
283 3300013306 Ga0163162_10352037 Ga0163162_103520372 181
284 3300014326 Ga0157380_10109416 Ga0157380_101094163 181
285 3300025233 Ga0209437_106934 Ga0209437_1069343 181
286 3300025261 Ga0209233_1000107 Ga0209233_10001078 181
287 3300025903 Ga0207680_10061485 Ga0207680_100614852 181
288 3300025921 Ga0207652_10091426 Ga0207652_100914263 181
289 3300025931 Ga0207644_10000097 Ga0207644_1000009720 181
290 3300025960 Ga0207651_10067139 Ga0207651_100671393 181
291 3300025961 Ga0207712_10037467 Ga0207712_100374674 181
292 3300025972 Ga0207668_10000364 Ga0207668_1000036420 181
293 3300025972 Ga0207668_10388454 Ga0207668_103884541 181
294 3300026088 Ga0207641_10000001 Ga0207641_100000011102 181
295 3300026088 Ga0207641_10766604 Ga0207641_107666042 181
296 3300028379 Ga0268266_10094286 Ga0268266_100942864 181
297 3300028380 Ga0268265_10007092 Ga0268265_100070926 181
298 3300030742 Ga0316183_1069303 Ga0316183_10693031 181
299 3300031548 Ga0307408_100015251 Ga0307408_1000152513 181
300 3300031731 Ga0307405_10043443 Ga0307405_100434433 181
301 3300031824 Ga0307413_10221626 Ga0307413_102216261 181
302 3300031901 Ga0307406_10002515 Ga0307406_1000251510 181
303 3300031903 Ga0307407_10022324 Ga0307407_100223245 181
304 3300031911 Ga0307412_10075911 Ga0307412_100759112 181
305 3300031995 Ga0307409_100098766 Ga0307409_1000987662 181
306 3300031995 Ga0307409_100291343 Ga0307409_1002913432 181
307 3300032002 Ga0307416_100037474 Ga0307416_1000374742 181
308 3300032004 Ga0307414_10349685 Ga0307414_103496852 181
309 3300032005 Ga0307411_10003811 Ga0307411_100038113 181
310 3300032126 Ga0307415_100083457 Ga0307415_1000834574 181
311 3300041413 Ga0439465_0004009 Ga0439465_0004009_970_1515 181
312 3300042004 Ga0439445_0012089 Ga0439445_0012089_1423_1968 181
313 3300050510 nmdc:mga06r32_10994_c1 nmdc:mga06r32_10994_c1_4330_4878 181
314 3300053103 Ga0500555_056606 Ga0500555_056606_348_896 181
315 3300053136 Ga0500559_0126118 Ga0500559_0126118_442_987 181

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01625

PMSR

Peptide methionine sulfoxide reductase

28

180

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2j89-assembly1.cif.gz_A functional and structural aspects of poplar cytosolic and plastidial type a methionine sulfoxide reductases 0.9321 3 150
3bqg-assembly1.cif.gz_A structure of the central domain (msra) of neisseria meningitidis pilb (sulfenic acid form) 0.928 1 147
7e43-assembly2.cif.gz_A structural insights into a bifunctional peptide methionine sulfoxide reductase msra/b fusion protein from helicobacter pylori 0.9273 2 147
7e43-assembly1.cif.gz_B structural insights into a bifunctional peptide methionine sulfoxide reductase msra/b fusion protein from helicobacter pylori 0.9243 2 147
3bqf-assembly1.cif.gz_A structure of the central domain (msra) of neisseria meningitidis pilb (complex with a substrate) 0.9152 1 154
ID Description Score Start End Superfamily
af_Q551H3_1_147_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9348 4 147 3.30.1060.10
af_Q5AD39_5_182_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9314 3 147 3.30.1060.10
af_B6TNT5_14_185_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9261 3 151 3.30.1060.10
af_Q551H3_1_147_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9105 4 147 3.30.1060.10
af_P0A084_1_166_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.8979 1 163 3.30.1060.10
ID Description Score Start End GO Terms
AF-A0A3B0LYD3-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) 0.947 1 161 GO:0008113
GO:0033744
GO:0036211
AF-R5Q992-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) 0.9416 2 150 GO:0008113
GO:0033743
GO:0033744
GO:0036211
AF-A0A843CK81-F1-model_v4 peptide-methionine (S)-S-oxide reductase (EC 1.8.4.11) 0.9415 2 145 GO:0008113
AF-A0A150Q9B7-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) 0.9415 4 147 GO:0008113
GO:0033744
GO:0036211
AF-A0A0J7IFK9-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) 0.9394 3 169 GO:0008113
GO:0033743
GO:0033744
GO:0036211

Feature Viewer

pLDDT pTM Quality
85.43 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map