F403386
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 315 | 210 | 313 | 148 |
Family's Representative Sequence
| Representative Sequence | 3300049589|Ga0501073_0315172|Ga0501073_0315172_214_660 |
| Length | 130 |
| Sequence | MSTNTIRLHRVLRAAPERVYRAFLDADAKAKWLPPNGFTGKVHHLDARVPGGRFLELTPHERIRYTDEFDDPNLPGEIQVTVALKSVSCGTDLTVVQEGVPDVIPPEACYLGWQESLALLAKLVEADIPD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 2 | 2990196909 | Pseudomonas mangrovi TC-11 | Isolate | Unclassified |
| 3 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 4 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 23 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 27 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 31 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 33 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 34 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 35 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 36 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 37 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 38 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 39 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 40 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 41 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 42 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 43 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 44 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 45 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 46 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 48 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 49 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 50 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 51 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 52 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 53 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 54 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 56 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 66 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 77 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 79 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 80 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 113 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 116 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 117 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 118 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 119 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 120 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 121 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 122 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 123 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 124 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 125 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 126 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 127 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 128 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 129 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 130 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 131 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 132 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 133 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 134 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 135 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 136 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 137 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 138 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 139 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 140 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 141 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 142 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 143 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 144 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 145 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 146 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 147 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 148 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 149 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 150 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 151 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 152 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 153 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 154 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 155 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 167 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 168 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 169 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 170 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 171 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 172 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 173 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 174 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 175 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 176 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 177 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 178 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 179 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 180 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 181 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 182 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 183 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 184 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 185 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 186 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 187 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 188 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 189 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 190 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 191 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 192 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 193 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 194 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 195 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 196 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 197 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 198 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 199 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 200 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 201 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 202 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 203 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 204 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 205 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 207 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 208 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 209 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 210 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.05 |
| Metatranscriptomes | 0.32 |
| Isolates | 0.63 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.76 |
| Nodule | 0 |
| Rhizoplane | 0.95 |
| Rhizosphere | 93.65 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.63 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065712_10651302 | 3300005290 | Bacteria | 567 |
| 2 | Ga0065715_10324808 | 3300005293 | Bacteria | 993 |
| 3 | Ga0070658_10017722 | 3300005327 | Bacteria | 5696 |
| 4 | Ga0070683_100298879 | 3300005329 | Bacteria | 1531 |
| 5 | Ga0070683_100393880 | 3300005329 | Unclassified | 1321 |
| 6 | Ga0070670_100267590 | 3300005331 | Bacteria | 1491 |
| 7 | Ga0068869_100749165 | 3300005334 | Bacteria | 836 |
| 8 | Ga0070680_100158333 | 3300005336 | Bacteria | 1903 |
| 9 | Ga0068868_100001832 | 3300005338 | Bacteria | 14607 |
| 10 | Ga0070660_100007534 | 3300005339 | Bacteria | 7587 |
| 11 | Ga0070660_100018054 | 3300005339 | Bacteria | 5147 |
| 12 | Ga0070661_100414997 | 3300005344 | Bacteria | 1066 |
| 13 | Ga0070668_101480822 | 3300005347 | Bacteria | 620 |
| 14 | Ga0070671_100580348 | 3300005355 | Bacteria | 968 |
| 15 | Ga0070673_100156223 | 3300005364 | Bacteria | 1936 |
| 16 | Ga0070659_100019518 | 3300005366 | Bacteria | 5138 |
| 17 | Ga0070667_100035281 | 3300005367 | Bacteria | 4189 |
| 18 | Ga0070667_100216377 | 3300005367 | Bacteria | 1704 |
| 19 | Ga0070667_101850613 | 3300005367 | Bacteria | 568 |
| 20 | Ga0070714_100634887 | 3300005435 | Bacteria | 1027 |
| 21 | Ga0070710_11090067 | 3300005437 | Bacteria | 586 |
| 22 | Ga0070711_100432894 | 3300005439 | Bacteria | 1074 |
| 23 | Ga0070681_10056312 | 3300005458 | Unclassified | 3913 |
| 24 | Ga0070681_10210552 | 3300005458 | Bacteria | 1860 |
| 25 | Ga0070681_10214489 | 3300005458 | Unclassified | 1841 |
| 26 | Ga0070681_11222991 | 3300005458 | Unclassified | 673 |
| 27 | Ga0068867_100384666 | 3300005459 | Bacteria | 1179 |
| 28 | Ga0068867_100592656 | 3300005459 | Bacteria | 965 |
| 29 | Ga0070685_11354381 | 3300005466 | Bacteria | 545 |
| 30 | Ga0070679_100201707 | 3300005530 | Bacteria | 1955 |
| 31 | Ga0070679_101486264 | 3300005530 | Unclassified | 624 |
| 32 | Ga0070684_100019281 | 3300005535 | Bacteria | 5639 |
| 33 | Ga0070684_100219149 | 3300005535 | Bacteria | 1736 |
| 34 | Ga0068853_100635649 | 3300005539 | Unclassified | 1015 |
| 35 | Ga0068853_101400779 | 3300005539 | Bacteria | 676 |
| 36 | Ga0070693_100138157 | 3300005547 | Bacteria | 1531 |
| 37 | Ga0070665_100028808 | 3300005548 | Bacteria | 5591 |
| 38 | Ga0070704_101165535 | 3300005549 | Bacteria | 702 |
| 39 | Ga0068855_100017876 | 3300005563 | Bacteria | 8520 |
| 40 | Ga0068855_100053325 | 3300005563 | Unclassified | 4758 |
| 41 | Ga0068855_100268278 | 3300005563 | Unclassified | 1899 |
| 42 | Ga0068855_100436383 | 3300005563 | Bacteria | 1431 |
| 43 | Ga0070664_100286300 | 3300005564 | Bacteria | 1487 |
| 44 | Ga0068857_100006515 | 3300005577 | Bacteria | 10019 |
| 45 | Ga0068857_100015728 | 3300005577 | Bacteria | 6618 |
| 46 | Ga0068856_100024733 | 3300005614 | Bacteria | 5849 |
| 47 | Ga0068856_100034151 | 3300005614 | Bacteria | 4983 |
| 48 | Ga0068856_100037869 | 3300005614 | Bacteria | 4732 |
| 49 | Ga0068856_100702153 | 3300005614 | Unclassified | 1032 |
| 50 | Ga0068852_100028510 | 3300005616 | Bacteria | 4571 |
| 51 | Ga0068852_102068297 | 3300005616 | Bacteria | 591 |
| 52 | Ga0068859_100009550 | 3300005617 | Bacteria | 9793 |
| 53 | Ga0068859_100188270 | 3300005617 | Bacteria | 2148 |
| 54 | Ga0068859_102097736 | 3300005617 | Bacteria | 624 |
| 55 | Ga0068864_100009726 | 3300005618 | Bacteria | 7933 |
| 56 | Ga0068864_100077675 | 3300005618 | Bacteria | 2904 |
| 57 | Ga0068864_101227062 | 3300005618 | Bacteria | 749 |
| 58 | Ga0068861_101758819 | 3300005719 | Bacteria | 614 |
| 59 | Ga0068863_100461408 | 3300005841 | Bacteria | 1247 |
| 60 | Ga0068858_100767035 | 3300005842 | Bacteria | 940 |
| 61 | Ga0068862_100153363 | 3300005844 | Bacteria | 2052 |
| 62 | Ga0081455_10001105 | 3300005937 | Bacteria | 33920 |
| 63 | Ga0081455_10018382 | 3300005937 | Bacteria | 6662 |
| 64 | Ga0075368_10173254 | 3300006042 | Bacteria | 907 |
| 65 | Ga0075363_100084719 | 3300006048 | Bacteria | 1738 |
| 66 | Ga0075362_10006750 | 3300006177 | Bacteria | 4290 |
| 67 | Ga0075366_10315991 | 3300006195 | Bacteria | 956 |
| 68 | Ga0097621_100040785 | 3300006237 | Bacteria | 3734 |
| 69 | Ga0097621_100147130 | 3300006237 | Bacteria | 2018 |
| 70 | Ga0075370_10088532 | 3300006353 | Bacteria | 1785 |
| 71 | Ga0075370_10100068 | 3300006353 | Bacteria | 1677 |
| 72 | Ga0068871_100246156 | 3300006358 | Bacteria | 1556 |
| 73 | Ga0075428_100016435 | 3300006844 | Bacteria | 8175 |
| 74 | Ga0075431_100182564 | 3300006847 | Bacteria | 2153 |
| 75 | Ga0075433_10343325 | 3300006852 | Bacteria | 1320 |
| 76 | Ga0075429_100000901 | 3300006880 | Bacteria | 23511 |
| 77 | Ga0068865_100331674 | 3300006881 | Bacteria | 1227 |
| 78 | Ga0097620_100009550 | 3300006931 | Bacteria | 9793 |
| 79 | Ga0097620_100188265 | 3300006931 | Bacteria | 2148 |
| 80 | Ga0097620_102098514 | 3300006931 | Bacteria | 624 |
| 81 | Ga0099795_10043719 | 3300007788 | Bacteria | 1604 |
| 82 | Ga0105240_10069609 | 3300009093 | Bacteria | 4354 |
| 83 | Ga0105240_10182660 | 3300009093 | Bacteria | 2474 |
| 84 | Ga0105240_10206169 | 3300009093 | Bacteria | 2301 |
| 85 | Ga0105240_10227806 | 3300009093 | Unclassified | 2168 |
| 86 | Ga0105240_10242018 | 3300009093 | Bacteria | 2091 |
| 87 | Ga0111539_10046058 | 3300009094 | Bacteria | 5219 |
| 88 | Ga0111539_11579736 | 3300009094 | Bacteria | 761 |
| 89 | Ga0105245_10029305 | 3300009098 | Unclassified | 4861 |
| 90 | Ga0105245_10161847 | 3300009098 | Bacteria | 2124 |
| 91 | Ga0105245_10511404 | 3300009098 | Bacteria | 1218 |
| 92 | Ga0114129_10071456 | 3300009147 | Bacteria | 4839 |
| 93 | Ga0114129_10078504 | 3300009147 | Bacteria | 4592 |
| 94 | Ga0114129_12635389 | 3300009147 | Bacteria | 600 |
| 95 | Ga0105241_10055682 | 3300009174 | Bacteria | 3030 |
| 96 | Ga0105242_10272961 | 3300009176 | Bacteria | 1532 |
| 97 | Ga0105242_10349242 | 3300009176 | Bacteria | 1366 |
| 98 | Ga0105242_10512344 | 3300009176 | Bacteria | 1143 |
| 99 | Ga0105248_11635934 | 3300009177 | Bacteria | 730 |
| 100 | Ga0105237_10451504 | 3300009545 | Bacteria | 1291 |
| 101 | Ga0105237_10595243 | 3300009545 | Unclassified | 1113 |
| 102 | Ga0105238_10012729 | 3300009551 | Bacteria | 8492 |
| 103 | Ga0105238_10241346 | 3300009551 | Bacteria | 1784 |
| 104 | Ga0105238_12585403 | 3300009551 | Unclassified | 544 |
| 105 | Ga0099796_10203535 | 3300010159 | Bacteria | 804 |
| 106 | Ga0105239_10007005 | 3300010375 | Bacteria | 12974 |
| 107 | Ga0105239_10302283 | 3300010375 | Bacteria | 1802 |
| 108 | Ga0157370_10007530 | 3300013104 | Bacteria | 11828 |
| 109 | Ga0157369_10019784 | 3300013105 | Bacteria | 7534 |
| 110 | Ga0157369_11283936 | 3300013105 | Bacteria | 746 |
| 111 | Ga0157374_10005365 | 3300013296 | Bacteria | 10771 |
| 112 | Ga0157374_10667230 | 3300013296 | Unclassified | 1052 |
| 113 | Ga0157374_10915172 | 3300013296 | Bacteria | 895 |
| 114 | Ga0157378_10000503 | 3300013297 | Bacteria | 37108 |
| 115 | Ga0157378_10002349 | 3300013297 | Bacteria | 16815 |
| 116 | Ga0163162_10000247 | 3300013306 | Bacteria | 48957 |
| 117 | Ga0163162_10701992 | 3300013306 | Bacteria | 1133 |
| 118 | Ga0163162_10909223 | 3300013306 | Bacteria | 993 |
| 119 | Ga0157372_10025305 | 3300013307 | Bacteria | 6451 |
| 120 | Ga0157372_10045416 | 3300013307 | Unclassified | 4873 |
| 121 | Ga0157375_10849994 | 3300013308 | Bacteria | 1059 |
| 122 | Ga0157375_12949130 | 3300013308 | Bacteria | 568 |
| 123 | Ga0163163_10003011 | 3300014325 | Bacteria | 14262 |
| 124 | Ga0163163_10086519 | 3300014325 | Bacteria | 3144 |
| 125 | Ga0163163_10697367 | 3300014325 | Bacteria | 1079 |
| 126 | Ga0163163_12453102 | 3300014325 | Bacteria | 580 |
| 127 | Ga0157380_11263181 | 3300014326 | Unclassified | 784 |
| 128 | Ga0182008_10003941 | 3300014497 | Bacteria | 8786 |
| 129 | Ga0157379_10289045 | 3300014968 | Unclassified | 1493 |
| 130 | Ga0182006_1065398 | 3300015261 | Bacteria | 1361 |
| 131 | Ga0207425_1038352 | 3300025245 | Bacteria | 921 |
| 132 | Ga0207680_10268726 | 3300025903 | Bacteria | 1182 |
| 133 | Ga0207705_10714531 | 3300025909 | Bacteria | 779 |
| 134 | Ga0207654_10065288 | 3300025911 | Bacteria | 2142 |
| 135 | Ga0207654_10178213 | 3300025911 | Bacteria | 1385 |
| 136 | Ga0207707_10161546 | 3300025912 | Unclassified | 1958 |
| 137 | Ga0207707_10240340 | 3300025912 | Unclassified | 1575 |
| 138 | Ga0207707_10361577 | 3300025912 | Bacteria | 1250 |
| 139 | Ga0207695_10166564 | 3300025913 | Unclassified | 2132 |
| 140 | Ga0207695_10554618 | 3300025913 | Unclassified | 1031 |
| 141 | Ga0207695_10600117 | 3300025913 | Unclassified | 982 |
| 142 | Ga0207671_10036135 | 3300025914 | Bacteria | 3663 |
| 143 | Ga0207660_10233096 | 3300025917 | Bacteria | 1448 |
| 144 | Ga0207657_10013378 | 3300025919 | Bacteria | 8051 |
| 145 | Ga0207657_10126170 | 3300025919 | Bacteria | 2102 |
| 146 | Ga0207652_10118911 | 3300025921 | Bacteria | 2349 |
| 147 | Ga0207694_10005903 | 3300025924 | Bacteria | 9387 |
| 148 | Ga0207694_10023886 | 3300025924 | Bacteria | 4642 |
| 149 | Ga0207694_10056482 | 3300025924 | Bacteria | 3049 |
| 150 | Ga0207694_10259526 | 3300025924 | Bacteria | 1423 |
| 151 | Ga0207687_10137191 | 3300025927 | Bacteria | 1851 |
| 152 | Ga0207687_10236677 | 3300025927 | Unclassified | 1445 |
| 153 | Ga0207687_11065805 | 3300025927 | Bacteria | 694 |
| 154 | Ga0207644_10503386 | 3300025931 | Unclassified | 999 |
| 155 | Ga0207690_10002276 | 3300025932 | Bacteria | 11703 |
| 156 | Ga0207686_10180028 | 3300025934 | Bacteria | 1498 |
| 157 | Ga0207686_10410355 | 3300025934 | Bacteria | 1034 |
| 158 | Ga0207686_10447759 | 3300025934 | Bacteria | 993 |
| 159 | Ga0207670_10374285 | 3300025936 | Bacteria | 1133 |
| 160 | Ga0207689_10278323 | 3300025942 | Bacteria | 1385 |
| 161 | Ga0207661_10460111 | 3300025944 | Unclassified | 1159 |
| 162 | Ga0207661_10567811 | 3300025944 | Unclassified | 1040 |
| 163 | Ga0207667_10009419 | 3300025949 | Bacteria | 11503 |
| 164 | Ga0207667_10019833 | 3300025949 | Bacteria | 7493 |
| 165 | Ga0207667_10408798 | 3300025949 | Unclassified | 1382 |
| 166 | Ga0207667_10850455 | 3300025949 | Bacteria | 906 |
| 167 | Ga0207651_10121934 | 3300025960 | Bacteria | 1978 |
| 168 | Ga0207640_11288884 | 3300025981 | Unclassified | 652 |
| 169 | Ga0207658_10034793 | 3300025986 | Bacteria | 3603 |
| 170 | Ga0207677_10008229 | 3300026023 | Bacteria | 5812 |
| 171 | Ga0207703_10859014 | 3300026035 | Bacteria | 868 |
| 172 | Ga0207639_10433165 | 3300026041 | Bacteria | 1191 |
| 173 | Ga0207639_10913524 | 3300026041 | Unclassified | 821 |
| 174 | Ga0207702_10180608 | 3300026078 | Unclassified | 1943 |
| 175 | Ga0207702_10268201 | 3300026078 | Bacteria | 1609 |
| 176 | Ga0207702_10293376 | 3300026078 | Bacteria | 1541 |
| 177 | Ga0207702_10692088 | 3300026078 | Bacteria | 1004 |
| 178 | Ga0207641_10037308 | 3300026088 | Bacteria | 4058 |
| 179 | Ga0207648_10369219 | 3300026089 | Bacteria | 1296 |
| 180 | Ga0207676_10170649 | 3300026095 | Bacteria | 1895 |
| 181 | Ga0207676_10210318 | 3300026095 | Unclassified | 1725 |
| 182 | Ga0207676_11140269 | 3300026095 | Bacteria | 772 |
| 183 | Ga0207674_10001855 | 3300026116 | Bacteria | 26925 |
| 184 | Ga0207674_10002269 | 3300026116 | Bacteria | 24372 |
| 185 | Ga0207675_100597149 | 3300026118 | Bacteria | 1107 |
| 186 | Ga0207698_10111663 | 3300026142 | Unclassified | 2292 |
| 187 | Ga0207698_11886623 | 3300026142 | Bacteria | 612 |
| 188 | Ga0209813_10118813 | 3300027866 | Bacteria | 918 |
| 189 | Ga0207428_10055952 | 3300027907 | Bacteria | 3135 |
| 190 | Ga0268266_10019012 | 3300028379 | Bacteria | 5853 |
| 191 | Ga0268265_10159502 | 3300028380 | Bacteria | 1914 |
| 192 | Ga0307515_10866055 | 3300028794 | Bacteria | 531 |
| 193 | Ga0265338_10035467 | 3300028800 | Bacteria | 4794 |
| 194 | Ga0265762_1012320 | 3300030760 | Bacteria | 1533 |
| 195 | Ga0265325_10000376 | 3300031241 | Bacteria | 31396 |
| 196 | Ga0265339_10072680 | 3300031249 | Bacteria | 1830 |
| 197 | Ga0265327_10228806 | 3300031251 | Bacteria | 834 |
| 198 | Ga0265316_10035095 | 3300031344 | Unclassified | 4069 |
| 199 | Ga0307408_100112410 | 3300031548 | Bacteria | 2094 |
| 200 | Ga0265313_10107300 | 3300031595 | Bacteria | 1232 |
| 201 | Ga0307405_10575237 | 3300031731 | Bacteria | 915 |
| 202 | Ga0307405_11887635 | 3300031731 | Bacteria | 533 |
| 203 | Ga0307410_11823076 | 3300031852 | Bacteria | 541 |
| 204 | Ga0307412_10417758 | 3300031911 | Bacteria | 1096 |
| 205 | Ga0307412_10569068 | 3300031911 | Bacteria | 954 |
| 206 | Ga0307416_100024623 | 3300032002 | Bacteria | 4398 |
| 207 | Ga0307416_100059447 | 3300032002 | Bacteria | 3106 |
| 208 | Ga0307416_101983447 | 3300032002 | Bacteria | 685 |
| 209 | Ga0307414_10633541 | 3300032004 | Bacteria | 962 |
| 210 | Ga0307414_11098813 | 3300032004 | Unclassified | 734 |
| 211 | Ga0373952_0004333 | 3300035092 | Bacteria | 2572 |
| 212 | Ga0373960_0041264 | 3300035121 | Bacteria | 1335 |
| 213 | Ga0373961_0275427 | 3300035241 | Bacteria | 616 |
| 214 | Ga0373931_0126548 | 3300035691 | Bacteria | 1466 |
| 215 | Ga0373931_0378676 | 3300035691 | Bacteria | 892 |
| 216 | Ga0395900_0227576 | 3300037418 | Bacteria | 1877 |
| 217 | Ga0395898_0071169 | 3300037466 | Bacteria | 3361 |
| 218 | Ga0395901_1908984 | 3300038443 | Bacteria | 541 |
| 219 | Ga0439436_0001739 | 3300041404 | Bacteria | 6380 |
| 220 | Ga0439439_0091229 | 3300041406 | Bacteria | 832 |
| 221 | Ga0451798_0944711 | 3300041458 | Bacteria | 514 |
| 222 | Ga0451802_0913559 | 3300041460 | Bacteria | 515 |
| 223 | Ga0439431_0113142 | 3300041997 | Bacteria | 753 |
| 224 | Ga0439445_0031635 | 3300042004 | Bacteria | 1376 |
| 225 | Ga0439449_0008806 | 3300042007 | Bacteria | 3827 |
| 226 | Ga0439452_039850 | 3300042010 | Bacteria | 1110 |
| 227 | Ga0439457_073963 | 3300042014 | Bacteria | 779 |
| 228 | Ga0450923_071263 | 3300042125 | Bacteria | 771 |
| 229 | Ga0450890_048988 | 3300042127 | Bacteria | 641 |
| 230 | Ga0450894_034526 | 3300042131 | Bacteria | 713 |
| 231 | Ga0450898_014209 | 3300042134 | Bacteria | 1336 |
| 232 | Ga0450907_006346 | 3300042146 | Bacteria | 1975 |
| 233 | Ga0439446_0005393 | 3300042156 | Bacteria | 3287 |
| 234 | Ga0450908_002048 | 3300042184 | Bacteria | 3935 |
| 235 | Ga0450893_0018972 | 3300042532 | Bacteria | 1174 |
| 236 | Ga0451577_0358483 | 3300042876 | Bacteria | 1323 |
| 237 | Ga0451577_1566095 | 3300042876 | Bacteria | 582 |
| 238 | Ga0453684_0176977 | 3300044712 | Bacteria | 2508 |
| 239 | Ga0495651_0201296 | 3300046462 | Bacteria | 1393 |
| 240 | Ga0495580_0298885 | 3300046472 | Bacteria | 1096 |
| 241 | Ga0495594_0215122 | 3300046499 | Bacteria | 1096 |
| 242 | Ga0495630_1441137 | 3300046517 | Bacteria | 517 |
| 243 | Ga0495665_0647786 | 3300046531 | Bacteria | 526 |
| 244 | Ga0495586_0158723 | 3300046535 | Bacteria | 1275 |
| 245 | Ga0495622_0376334 | 3300046557 | Bacteria | 613 |
| 246 | Ga0495669_0087087 | 3300046684 | Unclassified | 1439 |
| 247 | Ga0495600_0821351 | 3300046809 | Bacteria | 553 |
| 248 | Ga0495636_0082162 | 3300047318 | Bacteria | 1389 |
| 249 | Ga0495593_0240101 | 3300047673 | Bacteria | 908 |
| 250 | Ga0496112_0346131 | 3300048915 | Unclassified | 1429 |
| 251 | Ga0501031_0294319 | 3300049568 | Bacteria | 1052 |
| 252 | Ga0501034_0055005 | 3300049571 | Bacteria | 4005 |
| 253 | Ga0501034_0058376 | 3300049571 | Bacteria | 3878 |
| 254 | Ga0501034_0310851 | 3300049571 | Bacteria | 1510 |
| 255 | Ga0501036_0055728 | 3300049572 | Bacteria | 3349 |
| 256 | Ga0501036_0214611 | 3300049572 | Bacteria | 1616 |
| 257 | Ga0501037_0289976 | 3300049573 | Bacteria | 1139 |
| 258 | Ga0501038_0061860 | 3300049574 | Bacteria | 3201 |
| 259 | Ga0501039_0286584 | 3300049575 | Bacteria | 1295 |
| 260 | Ga0501040_0079130 | 3300049576 | Bacteria | 2275 |
| 261 | Ga0501041_0012561 | 3300049577 | Bacteria | 5017 |
| 262 | Ga0501042_0216938 | 3300049578 | Bacteria | 1380 |
| 263 | Ga0501042_0322169 | 3300049578 | Bacteria | 1117 |
| 264 | Ga0501043_0000953 | 3300049579 | Bacteria | 25644 |
| 265 | Ga0501046_0506289 | 3300049580 | Bacteria | 864 |
| 266 | Ga0501047_0001877 | 3300049581 | Bacteria | 20227 |
| 267 | Ga0501047_0061653 | 3300049581 | Bacteria | 3618 |
| 268 | Ga0501047_0074775 | 3300049581 | Bacteria | 3261 |
| 269 | Ga0501047_0207957 | 3300049581 | Unclassified | 1816 |
| 270 | Ga0501068_0382640 | 3300049584 | Bacteria | 906 |
| 271 | Ga0501069_0001771 | 3300049585 | Bacteria | 10789 |
| 272 | Ga0501070_0225293 | 3300049586 | Bacteria | 1537 |
| 273 | Ga0501071_0466202 | 3300049587 | Bacteria | 967 |
| 274 | Ga0501072_0109032 | 3300049588 | Bacteria | 2203 |
| 275 | Ga0501073_0078084 | 3300049589 | Bacteria | 2303 |
| 276 | Ga0501073_0137001 | 3300049589 | Bacteria | 1696 |
| 277 | Ga0501073_0315172 | 3300049589 | Bacteria | 1079 |
| 278 | Ga0501074_0069835 | 3300049590 | Bacteria | 2526 |
| 279 | Ga0501075_0276219 | 3300049591 | Bacteria | 1280 |
| 280 | Ga0501076_0496054 | 3300049592 | Bacteria | 1006 |
| 281 | Ga0501077_0165513 | 3300049593 | Bacteria | 1405 |
| 282 | Ga0501077_0568878 | 3300049593 | Bacteria | 728 |
| 283 | Ga0501079_0355215 | 3300049741 | Bacteria | 1148 |
| 284 | Ga0501080_0155143 | 3300049742 | Bacteria | 2115 |
| 285 | Ga0501080_0394442 | 3300049742 | Bacteria | 1246 |
| 286 | Ga0501081_0188643 | 3300049743 | Bacteria | 1492 |
| 287 | Ga0501083_0063661 | 3300049744 | Bacteria | 2459 |
| 288 | Ga0501083_0433601 | 3300049744 | Bacteria | 855 |
| 289 | Ga0501035_0267432 | 3300049822 | Bacteria | 1448 |
| 290 | Ga0501035_0428858 | 3300049822 | Bacteria | 1097 |
| 291 | Ga0501044_0053528 | 3300049823 | Bacteria | 4152 |
| 292 | Ga0501044_0722554 | 3300049823 | Bacteria | 880 |
| 293 | Ga0501045_0009817 | 3300049824 | Bacteria | 6698 |
| 294 | nmdc:mga03683_51448_c1 | 3300050489 | Bacteria | 1719 |
| 295 | nmdc:mga0k408_24519_c1 | 3300050493 | Bacteria | 3410 |
| 296 | nmdc:mga0k408_297009_c1 | 3300050493 | Bacteria | 964 |
| 297 | nmdc:mga04h51_109847_c1 | 3300050495 | Bacteria | 1015 |
| 298 | nmdc:mga07m45_85508_c1 | 3300050496 | Bacteria | 1803 |
| 299 | nmdc:mga05p37_60180_c1 | 3300050507 | Bacteria | 4677 |
| 300 | nmdc:mga05p37_7761_c1 | 3300050507 | Bacteria | 12667 |
| 301 | nmdc:mga09592_328_c1 | 3300050508 | Bacteria | 34777 |
| 302 | nmdc:mga06r32_132794_c1 | 3300050510 | Bacteria | 2463 |
| 303 | nmdc:mga08y16_999224_c1 | 3300050511 | Bacteria | 817 |
| 304 | nmdc:mga0n895_1902748_c1 | 3300050512 | Bacteria | 554 |
| 305 | Ga0495619_0525322 | 3300053085 | Unclassified | 813 |
| 306 | Ga0500643_001044 | 3300053087 | Bacteria | 16807 |
| 307 | Ga0500616_0196544 | 3300053153 | Bacteria | 897 |
| 308 | Ga0501084_0127779 | 3300054114 | Bacteria | 2139 |
| 309 | Ga0501084_0240767 | 3300054114 | Bacteria | 1527 |
| 310 | Ga0501084_0341043 | 3300054114 | Bacteria | 1266 |
| 311 | Ga0501082_0001227 | 3300060353 | Bacteria | 22546 |
| 312 | Ga0501082_0028576 | 3300060353 | Bacteria | 4804 |
| 313 | Ga0530510_0014998 | 3300061734 | Bacteria | 5474 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009551 | Ga0105238_12585403 | Ga0105238_125854031 | 127 |
| 2 | 3300035241 | Ga0373961_0275427 | Ga0373961_0275427_15_407 | 130 |
| 3 | 3300046809 | Ga0495600_0821351 | Ga0495600_0821351_126_518 | 130 |
| 4 | 3300049589 | Ga0501073_0315172 | Ga0501073_0315172_214_660 | 130 |
| 5 | 3300047673 | Ga0495593_0240101 | Ga0495593_0240101_430_846 | 138 |
| 6 | 3300053085 | Ga0495619_0525322 | Ga0495619_0525322_387_803 | 138 |
| 7 | iso_pu_bacteria | 2990196909 | 2990200101 | 143 |
| 8 | iso_pu_bacteria | 2945909444 | 2945909631 | 144 |
| 9 | 3300005530 | Ga0070679_101486264 | Ga0070679_1014862641 | 145 |
| 10 | 3300025912 | Ga0207707_10361577 | Ga0207707_103615772 | 145 |
| 11 | 3300049742 | Ga0501080_0394442 | Ga0501080_0394442_256_696 | 146 |
| 12 | 3300005293 | Ga0065715_10324808 | Ga0065715_103248082 | 147 |
| 13 | 3300005331 | Ga0070670_100267590 | Ga0070670_1002675902 | 147 |
| 14 | 3300005338 | Ga0068868_100001832 | Ga0068868_1000018329 | 147 |
| 15 | 3300005347 | Ga0070668_101480822 | Ga0070668_1014808221 | 147 |
| 16 | 3300005364 | Ga0070673_100156223 | Ga0070673_1001562232 | 147 |
| 17 | 3300005367 | Ga0070667_100035281 | Ga0070667_1000352813 | 147 |
| 18 | 3300005367 | Ga0070667_100216377 | Ga0070667_1002163773 | 147 |
| 19 | 3300005367 | Ga0070667_101850613 | Ga0070667_1018506131 | 147 |
| 20 | 3300005458 | Ga0070681_10210552 | Ga0070681_102105522 | 147 |
| 21 | 3300005459 | Ga0068867_100384666 | Ga0068867_1003846662 | 147 |
| 22 | 3300005459 | Ga0068867_100592656 | Ga0068867_1005926562 | 147 |
| 23 | 3300005466 | Ga0070685_11354381 | Ga0070685_113543811 | 147 |
| 24 | 3300005535 | Ga0070684_100219149 | Ga0070684_1002191492 | 147 |
| 25 | 3300005548 | Ga0070665_100028808 | Ga0070665_1000288086 | 147 |
| 26 | 3300005564 | Ga0070664_100286300 | Ga0070664_1002863003 | 147 |
| 27 | 3300005617 | Ga0068859_100009550 | Ga0068859_1000095507 | 147 |
| 28 | 3300005618 | Ga0068864_101227062 | Ga0068864_1012270622 | 147 |
| 29 | 3300005937 | Ga0081455_10001105 | Ga0081455_100011059 | 147 |
| 30 | 3300006042 | Ga0075368_10173254 | Ga0075368_101732542 | 147 |
| 31 | 3300006195 | Ga0075366_10315991 | Ga0075366_103159912 | 147 |
| 32 | 3300006237 | Ga0097621_100040785 | Ga0097621_1000407852 | 147 |
| 33 | 3300006353 | Ga0075370_10100068 | Ga0075370_101000683 | 147 |
| 34 | 3300006852 | Ga0075433_10343325 | Ga0075433_103433251 | 147 |
| 35 | 3300006881 | Ga0068865_100331674 | Ga0068865_1003316741 | 147 |
| 36 | 3300006931 | Ga0097620_100009550 | Ga0097620_1000095507 | 147 |
| 37 | 3300009093 | Ga0105240_10242018 | Ga0105240_102420185 | 147 |
| 38 | 3300009094 | Ga0111539_11579736 | Ga0111539_115797361 | 147 |
| 39 | 3300009147 | Ga0114129_12635389 | Ga0114129_126353891 | 147 |
| 40 | 3300009176 | Ga0105242_10512344 | Ga0105242_105123442 | 147 |
| 41 | 3300009177 | Ga0105248_11635934 | Ga0105248_116359341 | 147 |
| 42 | 3300009551 | Ga0105238_10241346 | Ga0105238_102413462 | 147 |
| 43 | 3300013105 | Ga0157369_11283936 | Ga0157369_112839361 | 147 |
| 44 | 3300013306 | Ga0163162_10909223 | Ga0163162_109092231 | 147 |
| 45 | 3300013308 | Ga0157375_10849994 | Ga0157375_108499942 | 147 |
| 46 | 3300014325 | Ga0163163_10086519 | Ga0163163_100865192 | 147 |
| 47 | 3300014325 | Ga0163163_12453102 | Ga0163163_124531022 | 147 |
| 48 | 3300025903 | Ga0207680_10268726 | Ga0207680_102687261 | 147 |
| 49 | 3300025909 | Ga0207705_10714531 | Ga0207705_107145311 | 147 |
| 50 | 3300025913 | Ga0207695_10600117 | Ga0207695_106001171 | 147 |
| 51 | 3300025924 | Ga0207694_10259526 | Ga0207694_102595262 | 147 |
| 52 | 3300025934 | Ga0207686_10447759 | Ga0207686_104477592 | 147 |
| 53 | 3300025960 | Ga0207651_10121934 | Ga0207651_101219343 | 147 |
| 54 | 3300025986 | Ga0207658_10034793 | Ga0207658_100347933 | 147 |
| 55 | 3300026023 | Ga0207677_10008229 | Ga0207677_100082296 | 147 |
| 56 | 3300026078 | Ga0207702_10692088 | Ga0207702_106920881 | 147 |
| 57 | 3300026089 | Ga0207648_10369219 | Ga0207648_103692192 | 147 |
| 58 | 3300026095 | Ga0207676_11140269 | Ga0207676_111402692 | 147 |
| 59 | 3300027866 | Ga0209813_10118813 | Ga0209813_101188131 | 147 |
| 60 | 3300027907 | Ga0207428_10055952 | Ga0207428_100559522 | 147 |
| 61 | 3300028379 | Ga0268266_10019012 | Ga0268266_100190122 | 147 |
| 62 | 3300031731 | Ga0307405_11887635 | Ga0307405_118876351 | 147 |
| 63 | 3300031852 | Ga0307410_11823076 | Ga0307410_118230761 | 147 |
| 64 | 3300032002 | Ga0307416_101983447 | Ga0307416_1019834471 | 147 |
| 65 | 3300035691 | Ga0373931_0126548 | Ga0373931_0126548_292_735 | 147 |
| 66 | 3300037418 | Ga0395900_0227576 | Ga0395900_0227576_855_1298 | 147 |
| 67 | 3300037466 | Ga0395898_0071169 | Ga0395898_0071169_22_465 | 147 |
| 68 | 3300038443 | Ga0395901_1908984 | Ga0395901_1908984_45_488 | 147 |
| 69 | 3300041458 | Ga0451798_0944711 | Ga0451798_0944711_54_497 | 147 |
| 70 | 3300041460 | Ga0451802_0913559 | Ga0451802_0913559_34_477 | 147 |
| 71 | 3300042876 | Ga0451577_0358483 | Ga0451577_0358483_631_1083 | 147 |
| 72 | 3300044712 | Ga0453684_0176977 | Ga0453684_0176977_1488_1934 | 147 |
| 73 | 3300046462 | Ga0495651_0201296 | Ga0495651_0201296_25_468 | 147 |
| 74 | 3300046499 | Ga0495594_0215122 | Ga0495594_0215122_299_742 | 147 |
| 75 | 3300046684 | Ga0495669_0087087 | Ga0495669_0087087_730_1173 | 147 |
| 76 | 3300047318 | Ga0495636_0082162 | Ga0495636_0082162_676_1119 | 147 |
| 77 | 3300049568 | Ga0501031_0294319 | Ga0501031_0294319_287_730 | 147 |
| 78 | 3300049571 | Ga0501034_0055005 | Ga0501034_0055005_579_1022 | 147 |
| 79 | 3300049571 | Ga0501034_0058376 | Ga0501034_0058376_1517_1960 | 147 |
| 80 | 3300049571 | Ga0501034_0310851 | Ga0501034_0310851_71_514 | 147 |
| 81 | 3300049572 | Ga0501036_0055728 | Ga0501036_0055728_2407_2850 | 147 |
| 82 | 3300049572 | Ga0501036_0214611 | Ga0501036_0214611_229_672 | 147 |
| 83 | 3300049573 | Ga0501037_0289976 | Ga0501037_0289976_206_649 | 147 |
| 84 | 3300049574 | Ga0501038_0061860 | Ga0501038_0061860_2094_2537 | 147 |
| 85 | 3300049579 | Ga0501043_0000953 | Ga0501043_0000953_19998_20441 | 147 |
| 86 | 3300049581 | Ga0501047_0001877 | Ga0501047_0001877_15583_16026 | 147 |
| 87 | 3300049581 | Ga0501047_0061653 | Ga0501047_0061653_411_854 | 147 |
| 88 | 3300049581 | Ga0501047_0074775 | Ga0501047_0074775_2440_2883 | 147 |
| 89 | 3300049581 | Ga0501047_0207957 | Ga0501047_0207957_936_1379 | 147 |
| 90 | 3300049585 | Ga0501069_0001771 | Ga0501069_0001771_176_619 | 147 |
| 91 | 3300049586 | Ga0501070_0225293 | Ga0501070_0225293_139_582 | 147 |
| 92 | 3300049589 | Ga0501073_0078084 | Ga0501073_0078084_142_585 | 147 |
| 93 | 3300049589 | Ga0501073_0137001 | Ga0501073_0137001_714_1157 | 147 |
| 94 | 3300049593 | Ga0501077_0165513 | Ga0501077_0165513_48_491 | 147 |
| 95 | 3300049744 | Ga0501083_0063661 | Ga0501083_0063661_1639_2082 | 147 |
| 96 | 3300049822 | Ga0501035_0267432 | Ga0501035_0267432_262_705 | 147 |
| 97 | 3300049822 | Ga0501035_0428858 | Ga0501035_0428858_98_541 | 147 |
| 98 | 3300049823 | Ga0501044_0053528 | Ga0501044_0053528_2808_3251 | 147 |
| 99 | 3300050493 | nmdc:mga0k408_297009_c1 | nmdc:mga0k408_297009_c1_213_656 | 147 |
| 100 | 3300050495 | nmdc:mga04h51_109847_c1 | nmdc:mga04h51_109847_c1_293_736 | 147 |
| 101 | 3300053087 | Ga0500643_001044 | Ga0500643_001044_10142_10585 | 147 |
| 102 | 3300054114 | Ga0501084_0127779 | Ga0501084_0127779_1618_2061 | 147 |
| 103 | 3300060353 | Ga0501082_0001227 | Ga0501082_0001227_12892_13335 | 147 |
| 104 | 3300005290 | Ga0065712_10651302 | Ga0065712_106513021 | 148 |
| 105 | 3300005327 | Ga0070658_10017722 | Ga0070658_100177222 | 148 |
| 106 | 3300005329 | Ga0070683_100298879 | Ga0070683_1002988792 | 148 |
| 107 | 3300005329 | Ga0070683_100393880 | Ga0070683_1003938802 | 148 |
| 108 | 3300005334 | Ga0068869_100749165 | Ga0068869_1007491652 | 148 |
| 109 | 3300005336 | Ga0070680_100158333 | Ga0070680_1001583332 | 148 |
| 110 | 3300005339 | Ga0070660_100007534 | Ga0070660_10000753411 | 148 |
| 111 | 3300005339 | Ga0070660_100018054 | Ga0070660_1000180545 | 148 |
| 112 | 3300005344 | Ga0070661_100414997 | Ga0070661_1004149972 | 148 |
| 113 | 3300005355 | Ga0070671_100580348 | Ga0070671_1005803481 | 148 |
| 114 | 3300005366 | Ga0070659_100019518 | Ga0070659_1000195184 | 148 |
| 115 | 3300005435 | Ga0070714_100634887 | Ga0070714_1006348872 | 148 |
| 116 | 3300005437 | Ga0070710_11090067 | Ga0070710_110900671 | 148 |
| 117 | 3300005439 | Ga0070711_100432894 | Ga0070711_1004328942 | 148 |
| 118 | 3300005458 | Ga0070681_10056312 | Ga0070681_100563128 | 148 |
| 119 | 3300005458 | Ga0070681_10214489 | Ga0070681_102144892 | 148 |
| 120 | 3300005458 | Ga0070681_11222991 | Ga0070681_112229912 | 148 |
| 121 | 3300005530 | Ga0070679_100201707 | Ga0070679_1002017073 | 148 |
| 122 | 3300005535 | Ga0070684_100019281 | Ga0070684_1000192816 | 148 |
| 123 | 3300005539 | Ga0068853_100635649 | Ga0068853_1006356491 | 148 |
| 124 | 3300005539 | Ga0068853_101400779 | Ga0068853_1014007791 | 148 |
| 125 | 3300005547 | Ga0070693_100138157 | Ga0070693_1001381571 | 148 |
| 126 | 3300005549 | Ga0070704_101165535 | Ga0070704_1011655351 | 148 |
| 127 | 3300005563 | Ga0068855_100017876 | Ga0068855_1000178764 | 148 |
| 128 | 3300005563 | Ga0068855_100053325 | Ga0068855_1000533258 | 148 |
| 129 | 3300005563 | Ga0068855_100268278 | Ga0068855_1002682783 | 148 |
| 130 | 3300005563 | Ga0068855_100436383 | Ga0068855_1004363832 | 148 |
| 131 | 3300005577 | Ga0068857_100006515 | Ga0068857_1000065159 | 148 |
| 132 | 3300005577 | Ga0068857_100015728 | Ga0068857_1000157284 | 148 |
| 133 | 3300005614 | Ga0068856_100024733 | Ga0068856_1000247336 | 148 |
| 134 | 3300005614 | Ga0068856_100034151 | Ga0068856_1000341512 | 148 |
| 135 | 3300005614 | Ga0068856_100037869 | Ga0068856_1000378691 | 148 |
| 136 | 3300005614 | Ga0068856_100702153 | Ga0068856_1007021531 | 148 |
| 137 | 3300005616 | Ga0068852_100028510 | Ga0068852_1000285103 | 148 |
| 138 | 3300005616 | Ga0068852_102068297 | Ga0068852_1020682971 | 148 |
| 139 | 3300005617 | Ga0068859_100188270 | Ga0068859_1001882703 | 148 |
| 140 | 3300005617 | Ga0068859_102097736 | Ga0068859_1020977362 | 148 |
| 141 | 3300005618 | Ga0068864_100009726 | Ga0068864_10000972614 | 148 |
| 142 | 3300005618 | Ga0068864_100077675 | Ga0068864_1000776752 | 148 |
| 143 | 3300005719 | Ga0068861_101758819 | Ga0068861_1017588191 | 148 |
| 144 | 3300005841 | Ga0068863_100461408 | Ga0068863_1004614082 | 148 |
| 145 | 3300005842 | Ga0068858_100767035 | Ga0068858_1007670352 | 148 |
| 146 | 3300005844 | Ga0068862_100153363 | Ga0068862_1001533632 | 148 |
| 147 | 3300005937 | Ga0081455_10018382 | Ga0081455_100183828 | 148 |
| 148 | 3300006048 | Ga0075363_100084719 | Ga0075363_1000847192 | 148 |
| 149 | 3300006177 | Ga0075362_10006750 | Ga0075362_100067505 | 148 |
| 150 | 3300006237 | Ga0097621_100147130 | Ga0097621_1001471303 | 148 |
| 151 | 3300006353 | Ga0075370_10088532 | Ga0075370_100885323 | 148 |
| 152 | 3300006358 | Ga0068871_100246156 | Ga0068871_1002461562 | 148 |
| 153 | 3300006844 | Ga0075428_100016435 | Ga0075428_1000164358 | 148 |
| 154 | 3300006847 | Ga0075431_100182564 | Ga0075431_1001825643 | 148 |
| 155 | 3300006880 | Ga0075429_100000901 | Ga0075429_1000009016 | 148 |
| 156 | 3300006931 | Ga0097620_100188265 | Ga0097620_1001882653 | 148 |
| 157 | 3300006931 | Ga0097620_102098514 | Ga0097620_1020985142 | 148 |
| 158 | 3300007788 | Ga0099795_10043719 | Ga0099795_100437192 | 148 |
| 159 | 3300009093 | Ga0105240_10069609 | Ga0105240_100696091 | 148 |
| 160 | 3300009093 | Ga0105240_10182660 | Ga0105240_101826602 | 148 |
| 161 | 3300009093 | Ga0105240_10206169 | Ga0105240_102061691 | 148 |
| 162 | 3300009093 | Ga0105240_10227806 | Ga0105240_102278063 | 148 |
| 163 | 3300009094 | Ga0111539_10046058 | Ga0111539_100460582 | 148 |
| 164 | 3300009098 | Ga0105245_10029305 | Ga0105245_100293054 | 148 |
| 165 | 3300009098 | Ga0105245_10161847 | Ga0105245_101618471 | 148 |
| 166 | 3300009098 | Ga0105245_10511404 | Ga0105245_105114042 | 148 |
| 167 | 3300009147 | Ga0114129_10071456 | Ga0114129_100714563 | 148 |
| 168 | 3300009147 | Ga0114129_10078504 | Ga0114129_100785047 | 148 |
| 169 | 3300009174 | Ga0105241_10055682 | Ga0105241_100556822 | 148 |
| 170 | 3300009176 | Ga0105242_10272961 | Ga0105242_102729612 | 148 |
| 171 | 3300009176 | Ga0105242_10349242 | Ga0105242_103492421 | 148 |
| 172 | 3300009545 | Ga0105237_10451504 | Ga0105237_104515041 | 148 |
| 173 | 3300009545 | Ga0105237_10595243 | Ga0105237_105952431 | 148 |
| 174 | 3300009551 | Ga0105238_10012729 | Ga0105238_1001272910 | 148 |
| 175 | 3300010159 | Ga0099796_10203535 | Ga0099796_102035351 | 148 |
| 176 | 3300010375 | Ga0105239_10007005 | Ga0105239_100070059 | 148 |
| 177 | 3300010375 | Ga0105239_10302283 | Ga0105239_103022832 | 148 |
| 178 | 3300013104 | Ga0157370_10007530 | Ga0157370_100075307 | 148 |
| 179 | 3300013105 | Ga0157369_10019784 | Ga0157369_100197841 | 148 |
| 180 | 3300013296 | Ga0157374_10005365 | Ga0157374_100053654 | 148 |
| 181 | 3300013296 | Ga0157374_10667230 | Ga0157374_106672301 | 148 |
| 182 | 3300013296 | Ga0157374_10915172 | Ga0157374_109151722 | 148 |
| 183 | 3300013297 | Ga0157378_10000503 | Ga0157378_100005038 | 148 |
| 184 | 3300013297 | Ga0157378_10002349 | Ga0157378_100023499 | 148 |
| 185 | 3300013306 | Ga0163162_10000247 | Ga0163162_1000024726 | 148 |
| 186 | 3300013306 | Ga0163162_10701992 | Ga0163162_107019921 | 148 |
| 187 | 3300013307 | Ga0157372_10025305 | Ga0157372_100253053 | 148 |
| 188 | 3300013307 | Ga0157372_10045416 | Ga0157372_100454168 | 148 |
| 189 | 3300013308 | Ga0157375_12949130 | Ga0157375_129491301 | 148 |
| 190 | 3300014325 | Ga0163163_10003011 | Ga0163163_1000301118 | 148 |
| 191 | 3300014325 | Ga0163163_10697367 | Ga0163163_106973671 | 148 |
| 192 | 3300014326 | Ga0157380_11263181 | Ga0157380_112631812 | 148 |
| 193 | 3300014497 | Ga0182008_10003941 | Ga0182008_100039413 | 148 |
| 194 | 3300014968 | Ga0157379_10289045 | Ga0157379_102890452 | 148 |
| 195 | 3300015261 | Ga0182006_1065398 | Ga0182006_10653981 | 148 |
| 196 | 3300025245 | Ga0207425_1038352 | Ga0207425_10383522 | 148 |
| 197 | 3300025911 | Ga0207654_10065288 | Ga0207654_100652882 | 148 |
| 198 | 3300025911 | Ga0207654_10178213 | Ga0207654_101782131 | 148 |
| 199 | 3300025912 | Ga0207707_10161546 | Ga0207707_101615464 | 148 |
| 200 | 3300025912 | Ga0207707_10240340 | Ga0207707_102403403 | 148 |
| 201 | 3300025913 | Ga0207695_10166564 | Ga0207695_101665644 | 148 |
| 202 | 3300025913 | Ga0207695_10554618 | Ga0207695_105546181 | 148 |
| 203 | 3300025914 | Ga0207671_10036135 | Ga0207671_100361353 | 148 |
| 204 | 3300025917 | Ga0207660_10233096 | Ga0207660_102330961 | 148 |
| 205 | 3300025919 | Ga0207657_10013378 | Ga0207657_1001337810 | 148 |
| 206 | 3300025919 | Ga0207657_10126170 | Ga0207657_101261704 | 148 |
| 207 | 3300025921 | Ga0207652_10118911 | Ga0207652_101189112 | 148 |
| 208 | 3300025924 | Ga0207694_10005903 | Ga0207694_100059035 | 148 |
| 209 | 3300025924 | Ga0207694_10023886 | Ga0207694_100238864 | 148 |
| 210 | 3300025924 | Ga0207694_10056482 | Ga0207694_100564823 | 148 |
| 211 | 3300025927 | Ga0207687_10137191 | Ga0207687_101371911 | 148 |
| 212 | 3300025927 | Ga0207687_10236677 | Ga0207687_102366772 | 148 |
| 213 | 3300025927 | Ga0207687_11065805 | Ga0207687_110658051 | 148 |
| 214 | 3300025931 | Ga0207644_10503386 | Ga0207644_105033863 | 148 |
| 215 | 3300025932 | Ga0207690_10002276 | Ga0207690_1000227611 | 148 |
| 216 | 3300025934 | Ga0207686_10180028 | Ga0207686_101800282 | 148 |
| 217 | 3300025934 | Ga0207686_10410355 | Ga0207686_104103551 | 148 |
| 218 | 3300025936 | Ga0207670_10374285 | Ga0207670_103742852 | 148 |
| 219 | 3300025942 | Ga0207689_10278323 | Ga0207689_102783232 | 148 |
| 220 | 3300025944 | Ga0207661_10460111 | Ga0207661_104601112 | 148 |
| 221 | 3300025944 | Ga0207661_10567811 | Ga0207661_105678112 | 148 |
| 222 | 3300025949 | Ga0207667_10009419 | Ga0207667_1000941912 | 148 |
| 223 | 3300025949 | Ga0207667_10019833 | Ga0207667_100198336 | 148 |
| 224 | 3300025949 | Ga0207667_10408798 | Ga0207667_104087982 | 148 |
| 225 | 3300025949 | Ga0207667_10850455 | Ga0207667_108504552 | 148 |
| 226 | 3300025981 | Ga0207640_11288884 | Ga0207640_112888841 | 148 |
| 227 | 3300026035 | Ga0207703_10859014 | Ga0207703_108590142 | 148 |
| 228 | 3300026041 | Ga0207639_10433165 | Ga0207639_104331652 | 148 |
| 229 | 3300026041 | Ga0207639_10913524 | Ga0207639_109135242 | 148 |
| 230 | 3300026078 | Ga0207702_10180608 | Ga0207702_101806083 | 148 |
| 231 | 3300026078 | Ga0207702_10268201 | Ga0207702_102682011 | 148 |
| 232 | 3300026078 | Ga0207702_10293376 | Ga0207702_102933762 | 148 |
| 233 | 3300026088 | Ga0207641_10037308 | Ga0207641_100373082 | 148 |
| 234 | 3300026095 | Ga0207676_10170649 | Ga0207676_101706492 | 148 |
| 235 | 3300026095 | Ga0207676_10210318 | Ga0207676_102103182 | 148 |
| 236 | 3300026116 | Ga0207674_10001855 | Ga0207674_1000185530 | 148 |
| 237 | 3300026116 | Ga0207674_10002269 | Ga0207674_1000226910 | 148 |
| 238 | 3300026118 | Ga0207675_100597149 | Ga0207675_1005971491 | 148 |
| 239 | 3300026142 | Ga0207698_10111663 | Ga0207698_101116631 | 148 |
| 240 | 3300026142 | Ga0207698_11886623 | Ga0207698_118866231 | 148 |
| 241 | 3300028380 | Ga0268265_10159502 | Ga0268265_101595024 | 148 |
| 242 | 3300028794 | Ga0307515_10866055 | Ga0307515_108660551 | 148 |
| 243 | 3300028800 | Ga0265338_10035467 | Ga0265338_100354673 | 148 |
| 244 | 3300030760 | Ga0265762_1012320 | Ga0265762_10123203 | 148 |
| 245 | 3300031241 | Ga0265325_10000376 | Ga0265325_1000037614 | 148 |
| 246 | 3300031249 | Ga0265339_10072680 | Ga0265339_100726802 | 148 |
| 247 | 3300031251 | Ga0265327_10228806 | Ga0265327_102288061 | 148 |
| 248 | 3300031344 | Ga0265316_10035095 | Ga0265316_100350954 | 148 |
| 249 | 3300031548 | Ga0307408_100112410 | Ga0307408_1001124103 | 148 |
| 250 | 3300031595 | Ga0265313_10107300 | Ga0265313_101073003 | 148 |
| 251 | 3300031731 | Ga0307405_10575237 | Ga0307405_105752372 | 148 |
| 252 | 3300031911 | Ga0307412_10417758 | Ga0307412_104177581 | 148 |
| 253 | 3300031911 | Ga0307412_10569068 | Ga0307412_105690682 | 148 |
| 254 | 3300032002 | Ga0307416_100024623 | Ga0307416_1000246235 | 148 |
| 255 | 3300032002 | Ga0307416_100059447 | Ga0307416_1000594474 | 148 |
| 256 | 3300032004 | Ga0307414_10633541 | Ga0307414_106335412 | 148 |
| 257 | 3300032004 | Ga0307414_11098813 | Ga0307414_110988131 | 148 |
| 258 | 3300035092 | Ga0373952_0004333 | Ga0373952_0004333_1359_1805 | 148 |
| 259 | 3300035121 | Ga0373960_0041264 | Ga0373960_0041264_265_711 | 148 |
| 260 | 3300035691 | Ga0373931_0378676 | Ga0373931_0378676_209_655 | 148 |
| 261 | 3300041404 | Ga0439436_0001739 | Ga0439436_0001739_5454_5900 | 148 |
| 262 | 3300041406 | Ga0439439_0091229 | Ga0439439_0091229_92_538 | 148 |
| 263 | 3300041997 | Ga0439431_0113142 | Ga0439431_0113142_49_495 | 148 |
| 264 | 3300042004 | Ga0439445_0031635 | Ga0439445_0031635_193_639 | 148 |
| 265 | 3300042007 | Ga0439449_0008806 | Ga0439449_0008806_162_608 | 148 |
| 266 | 3300042010 | Ga0439452_039850 | Ga0439452_039850_107_553 | 148 |
| 267 | 3300042014 | Ga0439457_073963 | Ga0439457_073963_314_760 | 148 |
| 268 | 3300042125 | Ga0450923_071263 | Ga0450923_071263_284_730 | 148 |
| 269 | 3300042127 | Ga0450890_048988 | Ga0450890_048988_44_490 | 148 |
| 270 | 3300042131 | Ga0450894_034526 | Ga0450894_034526_28_474 | 148 |
| 271 | 3300042134 | Ga0450898_014209 | Ga0450898_014209_610_1056 | 148 |
| 272 | 3300042146 | Ga0450907_006346 | Ga0450907_006346_366_812 | 148 |
| 273 | 3300042156 | Ga0439446_0005393 | Ga0439446_0005393_135_581 | 148 |
| 274 | 3300042184 | Ga0450908_002048 | Ga0450908_002048_2768_3214 | 148 |
| 275 | 3300042532 | Ga0450893_0018972 | Ga0450893_0018972_154_600 | 148 |
| 276 | 3300042876 | Ga0451577_1566095 | Ga0451577_1566095_36_494 | 148 |
| 277 | 3300046472 | Ga0495580_0298885 | Ga0495580_0298885_258_731 | 148 |
| 278 | 3300046517 | Ga0495630_1441137 | Ga0495630_1441137_41_487 | 148 |
| 279 | 3300046531 | Ga0495665_0647786 | Ga0495665_0647786_21_467 | 148 |
| 280 | 3300046535 | Ga0495586_0158723 | Ga0495586_0158723_258_704 | 148 |
| 281 | 3300046557 | Ga0495622_0376334 | Ga0495622_0376334_122_568 | 148 |
| 282 | 3300048915 | Ga0496112_0346131 | Ga0496112_0346131_739_1185 | 148 |
| 283 | 3300049575 | Ga0501039_0286584 | Ga0501039_0286584_424_885 | 148 |
| 284 | 3300049576 | Ga0501040_0079130 | Ga0501040_0079130_321_782 | 148 |
| 285 | 3300049577 | Ga0501041_0012561 | Ga0501041_0012561_2874_3335 | 148 |
| 286 | 3300049578 | Ga0501042_0216938 | Ga0501042_0216938_29_490 | 148 |
| 287 | 3300049578 | Ga0501042_0322169 | Ga0501042_0322169_56_619 | 148 |
| 288 | 3300049580 | Ga0501046_0506289 | Ga0501046_0506289_111_572 | 148 |
| 289 | 3300049584 | Ga0501068_0382640 | Ga0501068_0382640_333_794 | 148 |
| 290 | 3300049587 | Ga0501071_0466202 | Ga0501071_0466202_212_673 | 148 |
| 291 | 3300049588 | Ga0501072_0109032 | Ga0501072_0109032_1613_2074 | 148 |
| 292 | 3300049590 | Ga0501074_0069835 | Ga0501074_0069835_1790_2251 | 148 |
| 293 | 3300049591 | Ga0501075_0276219 | Ga0501075_0276219_456_917 | 148 |
| 294 | 3300049592 | Ga0501076_0496054 | Ga0501076_0496054_127_588 | 148 |
| 295 | 3300049593 | Ga0501077_0568878 | Ga0501077_0568878_26_487 | 148 |
| 296 | 3300049741 | Ga0501079_0355215 | Ga0501079_0355215_154_615 | 148 |
| 297 | 3300049742 | Ga0501080_0155143 | Ga0501080_0155143_34_495 | 148 |
| 298 | 3300049743 | Ga0501081_0188643 | Ga0501081_0188643_253_714 | 148 |
| 299 | 3300049744 | Ga0501083_0433601 | Ga0501083_0433601_103_564 | 148 |
| 300 | 3300049823 | Ga0501044_0722554 | Ga0501044_0722554_318_779 | 148 |
| 301 | 3300049824 | Ga0501045_0009817 | Ga0501045_0009817_1389_1850 | 148 |
| 302 | 3300050489 | nmdc:mga03683_51448_c1 | nmdc:mga03683_51448_c1_477_923 | 148 |
| 303 | 3300050493 | nmdc:mga0k408_24519_c1 | nmdc:mga0k408_24519_c1_1087_1533 | 148 |
| 304 | 3300050496 | nmdc:mga07m45_85508_c1 | nmdc:mga07m45_85508_c1_395_841 | 148 |
| 305 | 3300050507 | nmdc:mga05p37_60180_c1 | nmdc:mga05p37_60180_c1_4191_4637 | 148 |
| 306 | 3300050507 | nmdc:mga05p37_7761_c1 | nmdc:mga05p37_7761_c1_3252_3698 | 148 |
| 307 | 3300050508 | nmdc:mga09592_328_c1 | nmdc:mga09592_328_c1_31059_31505 | 148 |
| 308 | 3300050510 | nmdc:mga06r32_132794_c1 | nmdc:mga06r32_132794_c1_1641_2087 | 148 |
| 309 | 3300050511 | nmdc:mga08y16_999224_c1 | nmdc:mga08y16_999224_c1_356_802 | 148 |
| 310 | 3300050512 | nmdc:mga0n895_1902748_c1 | nmdc:mga0n895_1902748_c1_18_464 | 148 |
| 311 | 3300053153 | Ga0500616_0196544 | Ga0500616_0196544_112_558 | 148 |
| 312 | 3300054114 | Ga0501084_0240767 | Ga0501084_0240767_292_753 | 148 |
| 313 | 3300054114 | Ga0501084_0341043 | Ga0501084_0341043_316_762 | 148 |
| 314 | 3300060353 | Ga0501082_0028576 | Ga0501082_0028576_3231_3692 | 148 |
| 315 | 3300061734 | Ga0530510_0014998 | Ga0530510_0014998_2887_3348 | 148 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1z94-assembly2.cif.gz_E-2 | x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. | 0.9955 | 4 | 145 |
| 1z94-assembly1.cif.gz_B | x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. | 0.9954 | 4 | 145 |
| 1z94-assembly1.cif.gz_A | x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. | 0.9938 | 4 | 145 |
| 1z94-assembly2.cif.gz_E-2 | x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. | 0.9812 | 4 | 145 |
| 1z94-assembly1.cif.gz_A | x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. | 0.9798 | 4 | 145 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1z94E00 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.9954 | 4 | 145 | 3.30.530.20 |
| 1z94E00 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.9809 | 4 | 145 | 3.30.530.20 |
| 3q64A00 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.8543 | 2 | 140 | 3.30.530.20 |
| 4fpwA00 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.8456 | 3 | 138 | 3.30.530.20 |
| 1xuvB00 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.8413 | 1 | 141 | 3.30.530.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7X8SZC2-F1-model_v4 | SRPBCC family protein | 1.001 | 2 | 148 |
|
| AF-A0A419EKS9-F1-model_v4 | Polyketide cyclase | 1.001 | 4 | 148 |
|
| AF-A0A0Q6VIA6-F1-model_v4 | Toxin | 1 | 2 | 148 |
|
| AF-A0A2A6JM80-F1-model_v4 | Toxin | 1 | 2 | 148 |
|
| AF-A0A3S1ZYZ0-F1-model_v4 | deleted | 1 | 2 | 148 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar