F403386

General Info

Members Datasets Scaffolds Average Seq Length
315 210 313 148

Family's Representative Sequence

Representative Sequence 3300049589|Ga0501073_0315172|Ga0501073_0315172_214_660
Length 130
Sequence MSTNTIRLHRVLRAAPERVYRAFLDADAKAKWLPPNGFTGKVHHLDARVPGGRFLELTPHERIRYTDEFDDPNLPGEIQVTVALKSVSCGTDLTVVQEGVPDVIPPEACYLGWQESLALLAKLVEADIPD

Samples

Sample ID Description Type Environment
1 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
2 2990196909 Pseudomonas mangrovi TC-11 Isolate Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
32 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
43 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
44 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
45 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
51 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
66 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
79 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
80 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
112 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
116 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
117 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
119 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
120 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
121 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
122 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
123 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
124 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
125 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
126 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
129 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
130 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
131 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
132 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
135 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
136 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
137 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
138 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
139 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
140 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
141 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
142 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
143 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
144 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
145 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
146 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
147 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
148 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
149 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
150 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
151 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
152 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
153 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
154 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
155 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
156 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
157 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
158 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
159 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
160 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
161 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
162 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
163 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
164 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
165 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
166 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
167 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
180 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
181 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
182 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
183 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
184 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
185 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
186 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
187 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
188 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
189 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
190 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
191 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
192 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
193 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
196 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
197 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
198 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
199 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
200 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
201 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
202 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
205 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
206 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
207 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
208 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
209 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
210 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.05
Metatranscriptomes 0.32
Isolates 0.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.76
Nodule 0
Rhizoplane 0.95
Rhizosphere 93.65
Stem 0
Stem Tuber 0
Unclassified 0.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10651302 3300005290 Bacteria 567
2 Ga0065715_10324808 3300005293 Bacteria 993
3 Ga0070658_10017722 3300005327 Bacteria 5696
4 Ga0070683_100298879 3300005329 Bacteria 1531
5 Ga0070683_100393880 3300005329 Unclassified 1321
6 Ga0070670_100267590 3300005331 Bacteria 1491
7 Ga0068869_100749165 3300005334 Bacteria 836
8 Ga0070680_100158333 3300005336 Bacteria 1903
9 Ga0068868_100001832 3300005338 Bacteria 14607
10 Ga0070660_100007534 3300005339 Bacteria 7587
11 Ga0070660_100018054 3300005339 Bacteria 5147
12 Ga0070661_100414997 3300005344 Bacteria 1066
13 Ga0070668_101480822 3300005347 Bacteria 620
14 Ga0070671_100580348 3300005355 Bacteria 968
15 Ga0070673_100156223 3300005364 Bacteria 1936
16 Ga0070659_100019518 3300005366 Bacteria 5138
17 Ga0070667_100035281 3300005367 Bacteria 4189
18 Ga0070667_100216377 3300005367 Bacteria 1704
19 Ga0070667_101850613 3300005367 Bacteria 568
20 Ga0070714_100634887 3300005435 Bacteria 1027
21 Ga0070710_11090067 3300005437 Bacteria 586
22 Ga0070711_100432894 3300005439 Bacteria 1074
23 Ga0070681_10056312 3300005458 Unclassified 3913
24 Ga0070681_10210552 3300005458 Bacteria 1860
25 Ga0070681_10214489 3300005458 Unclassified 1841
26 Ga0070681_11222991 3300005458 Unclassified 673
27 Ga0068867_100384666 3300005459 Bacteria 1179
28 Ga0068867_100592656 3300005459 Bacteria 965
29 Ga0070685_11354381 3300005466 Bacteria 545
30 Ga0070679_100201707 3300005530 Bacteria 1955
31 Ga0070679_101486264 3300005530 Unclassified 624
32 Ga0070684_100019281 3300005535 Bacteria 5639
33 Ga0070684_100219149 3300005535 Bacteria 1736
34 Ga0068853_100635649 3300005539 Unclassified 1015
35 Ga0068853_101400779 3300005539 Bacteria 676
36 Ga0070693_100138157 3300005547 Bacteria 1531
37 Ga0070665_100028808 3300005548 Bacteria 5591
38 Ga0070704_101165535 3300005549 Bacteria 702
39 Ga0068855_100017876 3300005563 Bacteria 8520
40 Ga0068855_100053325 3300005563 Unclassified 4758
41 Ga0068855_100268278 3300005563 Unclassified 1899
42 Ga0068855_100436383 3300005563 Bacteria 1431
43 Ga0070664_100286300 3300005564 Bacteria 1487
44 Ga0068857_100006515 3300005577 Bacteria 10019
45 Ga0068857_100015728 3300005577 Bacteria 6618
46 Ga0068856_100024733 3300005614 Bacteria 5849
47 Ga0068856_100034151 3300005614 Bacteria 4983
48 Ga0068856_100037869 3300005614 Bacteria 4732
49 Ga0068856_100702153 3300005614 Unclassified 1032
50 Ga0068852_100028510 3300005616 Bacteria 4571
51 Ga0068852_102068297 3300005616 Bacteria 591
52 Ga0068859_100009550 3300005617 Bacteria 9793
53 Ga0068859_100188270 3300005617 Bacteria 2148
54 Ga0068859_102097736 3300005617 Bacteria 624
55 Ga0068864_100009726 3300005618 Bacteria 7933
56 Ga0068864_100077675 3300005618 Bacteria 2904
57 Ga0068864_101227062 3300005618 Bacteria 749
58 Ga0068861_101758819 3300005719 Bacteria 614
59 Ga0068863_100461408 3300005841 Bacteria 1247
60 Ga0068858_100767035 3300005842 Bacteria 940
61 Ga0068862_100153363 3300005844 Bacteria 2052
62 Ga0081455_10001105 3300005937 Bacteria 33920
63 Ga0081455_10018382 3300005937 Bacteria 6662
64 Ga0075368_10173254 3300006042 Bacteria 907
65 Ga0075363_100084719 3300006048 Bacteria 1738
66 Ga0075362_10006750 3300006177 Bacteria 4290
67 Ga0075366_10315991 3300006195 Bacteria 956
68 Ga0097621_100040785 3300006237 Bacteria 3734
69 Ga0097621_100147130 3300006237 Bacteria 2018
70 Ga0075370_10088532 3300006353 Bacteria 1785
71 Ga0075370_10100068 3300006353 Bacteria 1677
72 Ga0068871_100246156 3300006358 Bacteria 1556
73 Ga0075428_100016435 3300006844 Bacteria 8175
74 Ga0075431_100182564 3300006847 Bacteria 2153
75 Ga0075433_10343325 3300006852 Bacteria 1320
76 Ga0075429_100000901 3300006880 Bacteria 23511
77 Ga0068865_100331674 3300006881 Bacteria 1227
78 Ga0097620_100009550 3300006931 Bacteria 9793
79 Ga0097620_100188265 3300006931 Bacteria 2148
80 Ga0097620_102098514 3300006931 Bacteria 624
81 Ga0099795_10043719 3300007788 Bacteria 1604
82 Ga0105240_10069609 3300009093 Bacteria 4354
83 Ga0105240_10182660 3300009093 Bacteria 2474
84 Ga0105240_10206169 3300009093 Bacteria 2301
85 Ga0105240_10227806 3300009093 Unclassified 2168
86 Ga0105240_10242018 3300009093 Bacteria 2091
87 Ga0111539_10046058 3300009094 Bacteria 5219
88 Ga0111539_11579736 3300009094 Bacteria 761
89 Ga0105245_10029305 3300009098 Unclassified 4861
90 Ga0105245_10161847 3300009098 Bacteria 2124
91 Ga0105245_10511404 3300009098 Bacteria 1218
92 Ga0114129_10071456 3300009147 Bacteria 4839
93 Ga0114129_10078504 3300009147 Bacteria 4592
94 Ga0114129_12635389 3300009147 Bacteria 600
95 Ga0105241_10055682 3300009174 Bacteria 3030
96 Ga0105242_10272961 3300009176 Bacteria 1532
97 Ga0105242_10349242 3300009176 Bacteria 1366
98 Ga0105242_10512344 3300009176 Bacteria 1143
99 Ga0105248_11635934 3300009177 Bacteria 730
100 Ga0105237_10451504 3300009545 Bacteria 1291
101 Ga0105237_10595243 3300009545 Unclassified 1113
102 Ga0105238_10012729 3300009551 Bacteria 8492
103 Ga0105238_10241346 3300009551 Bacteria 1784
104 Ga0105238_12585403 3300009551 Unclassified 544
105 Ga0099796_10203535 3300010159 Bacteria 804
106 Ga0105239_10007005 3300010375 Bacteria 12974
107 Ga0105239_10302283 3300010375 Bacteria 1802
108 Ga0157370_10007530 3300013104 Bacteria 11828
109 Ga0157369_10019784 3300013105 Bacteria 7534
110 Ga0157369_11283936 3300013105 Bacteria 746
111 Ga0157374_10005365 3300013296 Bacteria 10771
112 Ga0157374_10667230 3300013296 Unclassified 1052
113 Ga0157374_10915172 3300013296 Bacteria 895
114 Ga0157378_10000503 3300013297 Bacteria 37108
115 Ga0157378_10002349 3300013297 Bacteria 16815
116 Ga0163162_10000247 3300013306 Bacteria 48957
117 Ga0163162_10701992 3300013306 Bacteria 1133
118 Ga0163162_10909223 3300013306 Bacteria 993
119 Ga0157372_10025305 3300013307 Bacteria 6451
120 Ga0157372_10045416 3300013307 Unclassified 4873
121 Ga0157375_10849994 3300013308 Bacteria 1059
122 Ga0157375_12949130 3300013308 Bacteria 568
123 Ga0163163_10003011 3300014325 Bacteria 14262
124 Ga0163163_10086519 3300014325 Bacteria 3144
125 Ga0163163_10697367 3300014325 Bacteria 1079
126 Ga0163163_12453102 3300014325 Bacteria 580
127 Ga0157380_11263181 3300014326 Unclassified 784
128 Ga0182008_10003941 3300014497 Bacteria 8786
129 Ga0157379_10289045 3300014968 Unclassified 1493
130 Ga0182006_1065398 3300015261 Bacteria 1361
131 Ga0207425_1038352 3300025245 Bacteria 921
132 Ga0207680_10268726 3300025903 Bacteria 1182
133 Ga0207705_10714531 3300025909 Bacteria 779
134 Ga0207654_10065288 3300025911 Bacteria 2142
135 Ga0207654_10178213 3300025911 Bacteria 1385
136 Ga0207707_10161546 3300025912 Unclassified 1958
137 Ga0207707_10240340 3300025912 Unclassified 1575
138 Ga0207707_10361577 3300025912 Bacteria 1250
139 Ga0207695_10166564 3300025913 Unclassified 2132
140 Ga0207695_10554618 3300025913 Unclassified 1031
141 Ga0207695_10600117 3300025913 Unclassified 982
142 Ga0207671_10036135 3300025914 Bacteria 3663
143 Ga0207660_10233096 3300025917 Bacteria 1448
144 Ga0207657_10013378 3300025919 Bacteria 8051
145 Ga0207657_10126170 3300025919 Bacteria 2102
146 Ga0207652_10118911 3300025921 Bacteria 2349
147 Ga0207694_10005903 3300025924 Bacteria 9387
148 Ga0207694_10023886 3300025924 Bacteria 4642
149 Ga0207694_10056482 3300025924 Bacteria 3049
150 Ga0207694_10259526 3300025924 Bacteria 1423
151 Ga0207687_10137191 3300025927 Bacteria 1851
152 Ga0207687_10236677 3300025927 Unclassified 1445
153 Ga0207687_11065805 3300025927 Bacteria 694
154 Ga0207644_10503386 3300025931 Unclassified 999
155 Ga0207690_10002276 3300025932 Bacteria 11703
156 Ga0207686_10180028 3300025934 Bacteria 1498
157 Ga0207686_10410355 3300025934 Bacteria 1034
158 Ga0207686_10447759 3300025934 Bacteria 993
159 Ga0207670_10374285 3300025936 Bacteria 1133
160 Ga0207689_10278323 3300025942 Bacteria 1385
161 Ga0207661_10460111 3300025944 Unclassified 1159
162 Ga0207661_10567811 3300025944 Unclassified 1040
163 Ga0207667_10009419 3300025949 Bacteria 11503
164 Ga0207667_10019833 3300025949 Bacteria 7493
165 Ga0207667_10408798 3300025949 Unclassified 1382
166 Ga0207667_10850455 3300025949 Bacteria 906
167 Ga0207651_10121934 3300025960 Bacteria 1978
168 Ga0207640_11288884 3300025981 Unclassified 652
169 Ga0207658_10034793 3300025986 Bacteria 3603
170 Ga0207677_10008229 3300026023 Bacteria 5812
171 Ga0207703_10859014 3300026035 Bacteria 868
172 Ga0207639_10433165 3300026041 Bacteria 1191
173 Ga0207639_10913524 3300026041 Unclassified 821
174 Ga0207702_10180608 3300026078 Unclassified 1943
175 Ga0207702_10268201 3300026078 Bacteria 1609
176 Ga0207702_10293376 3300026078 Bacteria 1541
177 Ga0207702_10692088 3300026078 Bacteria 1004
178 Ga0207641_10037308 3300026088 Bacteria 4058
179 Ga0207648_10369219 3300026089 Bacteria 1296
180 Ga0207676_10170649 3300026095 Bacteria 1895
181 Ga0207676_10210318 3300026095 Unclassified 1725
182 Ga0207676_11140269 3300026095 Bacteria 772
183 Ga0207674_10001855 3300026116 Bacteria 26925
184 Ga0207674_10002269 3300026116 Bacteria 24372
185 Ga0207675_100597149 3300026118 Bacteria 1107
186 Ga0207698_10111663 3300026142 Unclassified 2292
187 Ga0207698_11886623 3300026142 Bacteria 612
188 Ga0209813_10118813 3300027866 Bacteria 918
189 Ga0207428_10055952 3300027907 Bacteria 3135
190 Ga0268266_10019012 3300028379 Bacteria 5853
191 Ga0268265_10159502 3300028380 Bacteria 1914
192 Ga0307515_10866055 3300028794 Bacteria 531
193 Ga0265338_10035467 3300028800 Bacteria 4794
194 Ga0265762_1012320 3300030760 Bacteria 1533
195 Ga0265325_10000376 3300031241 Bacteria 31396
196 Ga0265339_10072680 3300031249 Bacteria 1830
197 Ga0265327_10228806 3300031251 Bacteria 834
198 Ga0265316_10035095 3300031344 Unclassified 4069
199 Ga0307408_100112410 3300031548 Bacteria 2094
200 Ga0265313_10107300 3300031595 Bacteria 1232
201 Ga0307405_10575237 3300031731 Bacteria 915
202 Ga0307405_11887635 3300031731 Bacteria 533
203 Ga0307410_11823076 3300031852 Bacteria 541
204 Ga0307412_10417758 3300031911 Bacteria 1096
205 Ga0307412_10569068 3300031911 Bacteria 954
206 Ga0307416_100024623 3300032002 Bacteria 4398
207 Ga0307416_100059447 3300032002 Bacteria 3106
208 Ga0307416_101983447 3300032002 Bacteria 685
209 Ga0307414_10633541 3300032004 Bacteria 962
210 Ga0307414_11098813 3300032004 Unclassified 734
211 Ga0373952_0004333 3300035092 Bacteria 2572
212 Ga0373960_0041264 3300035121 Bacteria 1335
213 Ga0373961_0275427 3300035241 Bacteria 616
214 Ga0373931_0126548 3300035691 Bacteria 1466
215 Ga0373931_0378676 3300035691 Bacteria 892
216 Ga0395900_0227576 3300037418 Bacteria 1877
217 Ga0395898_0071169 3300037466 Bacteria 3361
218 Ga0395901_1908984 3300038443 Bacteria 541
219 Ga0439436_0001739 3300041404 Bacteria 6380
220 Ga0439439_0091229 3300041406 Bacteria 832
221 Ga0451798_0944711 3300041458 Bacteria 514
222 Ga0451802_0913559 3300041460 Bacteria 515
223 Ga0439431_0113142 3300041997 Bacteria 753
224 Ga0439445_0031635 3300042004 Bacteria 1376
225 Ga0439449_0008806 3300042007 Bacteria 3827
226 Ga0439452_039850 3300042010 Bacteria 1110
227 Ga0439457_073963 3300042014 Bacteria 779
228 Ga0450923_071263 3300042125 Bacteria 771
229 Ga0450890_048988 3300042127 Bacteria 641
230 Ga0450894_034526 3300042131 Bacteria 713
231 Ga0450898_014209 3300042134 Bacteria 1336
232 Ga0450907_006346 3300042146 Bacteria 1975
233 Ga0439446_0005393 3300042156 Bacteria 3287
234 Ga0450908_002048 3300042184 Bacteria 3935
235 Ga0450893_0018972 3300042532 Bacteria 1174
236 Ga0451577_0358483 3300042876 Bacteria 1323
237 Ga0451577_1566095 3300042876 Bacteria 582
238 Ga0453684_0176977 3300044712 Bacteria 2508
239 Ga0495651_0201296 3300046462 Bacteria 1393
240 Ga0495580_0298885 3300046472 Bacteria 1096
241 Ga0495594_0215122 3300046499 Bacteria 1096
242 Ga0495630_1441137 3300046517 Bacteria 517
243 Ga0495665_0647786 3300046531 Bacteria 526
244 Ga0495586_0158723 3300046535 Bacteria 1275
245 Ga0495622_0376334 3300046557 Bacteria 613
246 Ga0495669_0087087 3300046684 Unclassified 1439
247 Ga0495600_0821351 3300046809 Bacteria 553
248 Ga0495636_0082162 3300047318 Bacteria 1389
249 Ga0495593_0240101 3300047673 Bacteria 908
250 Ga0496112_0346131 3300048915 Unclassified 1429
251 Ga0501031_0294319 3300049568 Bacteria 1052
252 Ga0501034_0055005 3300049571 Bacteria 4005
253 Ga0501034_0058376 3300049571 Bacteria 3878
254 Ga0501034_0310851 3300049571 Bacteria 1510
255 Ga0501036_0055728 3300049572 Bacteria 3349
256 Ga0501036_0214611 3300049572 Bacteria 1616
257 Ga0501037_0289976 3300049573 Bacteria 1139
258 Ga0501038_0061860 3300049574 Bacteria 3201
259 Ga0501039_0286584 3300049575 Bacteria 1295
260 Ga0501040_0079130 3300049576 Bacteria 2275
261 Ga0501041_0012561 3300049577 Bacteria 5017
262 Ga0501042_0216938 3300049578 Bacteria 1380
263 Ga0501042_0322169 3300049578 Bacteria 1117
264 Ga0501043_0000953 3300049579 Bacteria 25644
265 Ga0501046_0506289 3300049580 Bacteria 864
266 Ga0501047_0001877 3300049581 Bacteria 20227
267 Ga0501047_0061653 3300049581 Bacteria 3618
268 Ga0501047_0074775 3300049581 Bacteria 3261
269 Ga0501047_0207957 3300049581 Unclassified 1816
270 Ga0501068_0382640 3300049584 Bacteria 906
271 Ga0501069_0001771 3300049585 Bacteria 10789
272 Ga0501070_0225293 3300049586 Bacteria 1537
273 Ga0501071_0466202 3300049587 Bacteria 967
274 Ga0501072_0109032 3300049588 Bacteria 2203
275 Ga0501073_0078084 3300049589 Bacteria 2303
276 Ga0501073_0137001 3300049589 Bacteria 1696
277 Ga0501073_0315172 3300049589 Bacteria 1079
278 Ga0501074_0069835 3300049590 Bacteria 2526
279 Ga0501075_0276219 3300049591 Bacteria 1280
280 Ga0501076_0496054 3300049592 Bacteria 1006
281 Ga0501077_0165513 3300049593 Bacteria 1405
282 Ga0501077_0568878 3300049593 Bacteria 728
283 Ga0501079_0355215 3300049741 Bacteria 1148
284 Ga0501080_0155143 3300049742 Bacteria 2115
285 Ga0501080_0394442 3300049742 Bacteria 1246
286 Ga0501081_0188643 3300049743 Bacteria 1492
287 Ga0501083_0063661 3300049744 Bacteria 2459
288 Ga0501083_0433601 3300049744 Bacteria 855
289 Ga0501035_0267432 3300049822 Bacteria 1448
290 Ga0501035_0428858 3300049822 Bacteria 1097
291 Ga0501044_0053528 3300049823 Bacteria 4152
292 Ga0501044_0722554 3300049823 Bacteria 880
293 Ga0501045_0009817 3300049824 Bacteria 6698
294 nmdc:mga03683_51448_c1 3300050489 Bacteria 1719
295 nmdc:mga0k408_24519_c1 3300050493 Bacteria 3410
296 nmdc:mga0k408_297009_c1 3300050493 Bacteria 964
297 nmdc:mga04h51_109847_c1 3300050495 Bacteria 1015
298 nmdc:mga07m45_85508_c1 3300050496 Bacteria 1803
299 nmdc:mga05p37_60180_c1 3300050507 Bacteria 4677
300 nmdc:mga05p37_7761_c1 3300050507 Bacteria 12667
301 nmdc:mga09592_328_c1 3300050508 Bacteria 34777
302 nmdc:mga06r32_132794_c1 3300050510 Bacteria 2463
303 nmdc:mga08y16_999224_c1 3300050511 Bacteria 817
304 nmdc:mga0n895_1902748_c1 3300050512 Bacteria 554
305 Ga0495619_0525322 3300053085 Unclassified 813
306 Ga0500643_001044 3300053087 Bacteria 16807
307 Ga0500616_0196544 3300053153 Bacteria 897
308 Ga0501084_0127779 3300054114 Bacteria 2139
309 Ga0501084_0240767 3300054114 Bacteria 1527
310 Ga0501084_0341043 3300054114 Bacteria 1266
311 Ga0501082_0001227 3300060353 Bacteria 22546
312 Ga0501082_0028576 3300060353 Bacteria 4804
313 Ga0530510_0014998 3300061734 Bacteria 5474

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009551 Ga0105238_12585403 Ga0105238_125854031 127
2 3300035241 Ga0373961_0275427 Ga0373961_0275427_15_407 130
3 3300046809 Ga0495600_0821351 Ga0495600_0821351_126_518 130
4 3300049589 Ga0501073_0315172 Ga0501073_0315172_214_660 130
5 3300047673 Ga0495593_0240101 Ga0495593_0240101_430_846 138
6 3300053085 Ga0495619_0525322 Ga0495619_0525322_387_803 138
7 iso_pu_bacteria 2990196909 2990200101 143
8 iso_pu_bacteria 2945909444 2945909631 144
9 3300005530 Ga0070679_101486264 Ga0070679_1014862641 145
10 3300025912 Ga0207707_10361577 Ga0207707_103615772 145
11 3300049742 Ga0501080_0394442 Ga0501080_0394442_256_696 146
12 3300005293 Ga0065715_10324808 Ga0065715_103248082 147
13 3300005331 Ga0070670_100267590 Ga0070670_1002675902 147
14 3300005338 Ga0068868_100001832 Ga0068868_1000018329 147
15 3300005347 Ga0070668_101480822 Ga0070668_1014808221 147
16 3300005364 Ga0070673_100156223 Ga0070673_1001562232 147
17 3300005367 Ga0070667_100035281 Ga0070667_1000352813 147
18 3300005367 Ga0070667_100216377 Ga0070667_1002163773 147
19 3300005367 Ga0070667_101850613 Ga0070667_1018506131 147
20 3300005458 Ga0070681_10210552 Ga0070681_102105522 147
21 3300005459 Ga0068867_100384666 Ga0068867_1003846662 147
22 3300005459 Ga0068867_100592656 Ga0068867_1005926562 147
23 3300005466 Ga0070685_11354381 Ga0070685_113543811 147
24 3300005535 Ga0070684_100219149 Ga0070684_1002191492 147
25 3300005548 Ga0070665_100028808 Ga0070665_1000288086 147
26 3300005564 Ga0070664_100286300 Ga0070664_1002863003 147
27 3300005617 Ga0068859_100009550 Ga0068859_1000095507 147
28 3300005618 Ga0068864_101227062 Ga0068864_1012270622 147
29 3300005937 Ga0081455_10001105 Ga0081455_100011059 147
30 3300006042 Ga0075368_10173254 Ga0075368_101732542 147
31 3300006195 Ga0075366_10315991 Ga0075366_103159912 147
32 3300006237 Ga0097621_100040785 Ga0097621_1000407852 147
33 3300006353 Ga0075370_10100068 Ga0075370_101000683 147
34 3300006852 Ga0075433_10343325 Ga0075433_103433251 147
35 3300006881 Ga0068865_100331674 Ga0068865_1003316741 147
36 3300006931 Ga0097620_100009550 Ga0097620_1000095507 147
37 3300009093 Ga0105240_10242018 Ga0105240_102420185 147
38 3300009094 Ga0111539_11579736 Ga0111539_115797361 147
39 3300009147 Ga0114129_12635389 Ga0114129_126353891 147
40 3300009176 Ga0105242_10512344 Ga0105242_105123442 147
41 3300009177 Ga0105248_11635934 Ga0105248_116359341 147
42 3300009551 Ga0105238_10241346 Ga0105238_102413462 147
43 3300013105 Ga0157369_11283936 Ga0157369_112839361 147
44 3300013306 Ga0163162_10909223 Ga0163162_109092231 147
45 3300013308 Ga0157375_10849994 Ga0157375_108499942 147
46 3300014325 Ga0163163_10086519 Ga0163163_100865192 147
47 3300014325 Ga0163163_12453102 Ga0163163_124531022 147
48 3300025903 Ga0207680_10268726 Ga0207680_102687261 147
49 3300025909 Ga0207705_10714531 Ga0207705_107145311 147
50 3300025913 Ga0207695_10600117 Ga0207695_106001171 147
51 3300025924 Ga0207694_10259526 Ga0207694_102595262 147
52 3300025934 Ga0207686_10447759 Ga0207686_104477592 147
53 3300025960 Ga0207651_10121934 Ga0207651_101219343 147
54 3300025986 Ga0207658_10034793 Ga0207658_100347933 147
55 3300026023 Ga0207677_10008229 Ga0207677_100082296 147
56 3300026078 Ga0207702_10692088 Ga0207702_106920881 147
57 3300026089 Ga0207648_10369219 Ga0207648_103692192 147
58 3300026095 Ga0207676_11140269 Ga0207676_111402692 147
59 3300027866 Ga0209813_10118813 Ga0209813_101188131 147
60 3300027907 Ga0207428_10055952 Ga0207428_100559522 147
61 3300028379 Ga0268266_10019012 Ga0268266_100190122 147
62 3300031731 Ga0307405_11887635 Ga0307405_118876351 147
63 3300031852 Ga0307410_11823076 Ga0307410_118230761 147
64 3300032002 Ga0307416_101983447 Ga0307416_1019834471 147
65 3300035691 Ga0373931_0126548 Ga0373931_0126548_292_735 147
66 3300037418 Ga0395900_0227576 Ga0395900_0227576_855_1298 147
67 3300037466 Ga0395898_0071169 Ga0395898_0071169_22_465 147
68 3300038443 Ga0395901_1908984 Ga0395901_1908984_45_488 147
69 3300041458 Ga0451798_0944711 Ga0451798_0944711_54_497 147
70 3300041460 Ga0451802_0913559 Ga0451802_0913559_34_477 147
71 3300042876 Ga0451577_0358483 Ga0451577_0358483_631_1083 147
72 3300044712 Ga0453684_0176977 Ga0453684_0176977_1488_1934 147
73 3300046462 Ga0495651_0201296 Ga0495651_0201296_25_468 147
74 3300046499 Ga0495594_0215122 Ga0495594_0215122_299_742 147
75 3300046684 Ga0495669_0087087 Ga0495669_0087087_730_1173 147
76 3300047318 Ga0495636_0082162 Ga0495636_0082162_676_1119 147
77 3300049568 Ga0501031_0294319 Ga0501031_0294319_287_730 147
78 3300049571 Ga0501034_0055005 Ga0501034_0055005_579_1022 147
79 3300049571 Ga0501034_0058376 Ga0501034_0058376_1517_1960 147
80 3300049571 Ga0501034_0310851 Ga0501034_0310851_71_514 147
81 3300049572 Ga0501036_0055728 Ga0501036_0055728_2407_2850 147
82 3300049572 Ga0501036_0214611 Ga0501036_0214611_229_672 147
83 3300049573 Ga0501037_0289976 Ga0501037_0289976_206_649 147
84 3300049574 Ga0501038_0061860 Ga0501038_0061860_2094_2537 147
85 3300049579 Ga0501043_0000953 Ga0501043_0000953_19998_20441 147
86 3300049581 Ga0501047_0001877 Ga0501047_0001877_15583_16026 147
87 3300049581 Ga0501047_0061653 Ga0501047_0061653_411_854 147
88 3300049581 Ga0501047_0074775 Ga0501047_0074775_2440_2883 147
89 3300049581 Ga0501047_0207957 Ga0501047_0207957_936_1379 147
90 3300049585 Ga0501069_0001771 Ga0501069_0001771_176_619 147
91 3300049586 Ga0501070_0225293 Ga0501070_0225293_139_582 147
92 3300049589 Ga0501073_0078084 Ga0501073_0078084_142_585 147
93 3300049589 Ga0501073_0137001 Ga0501073_0137001_714_1157 147
94 3300049593 Ga0501077_0165513 Ga0501077_0165513_48_491 147
95 3300049744 Ga0501083_0063661 Ga0501083_0063661_1639_2082 147
96 3300049822 Ga0501035_0267432 Ga0501035_0267432_262_705 147
97 3300049822 Ga0501035_0428858 Ga0501035_0428858_98_541 147
98 3300049823 Ga0501044_0053528 Ga0501044_0053528_2808_3251 147
99 3300050493 nmdc:mga0k408_297009_c1 nmdc:mga0k408_297009_c1_213_656 147
100 3300050495 nmdc:mga04h51_109847_c1 nmdc:mga04h51_109847_c1_293_736 147
101 3300053087 Ga0500643_001044 Ga0500643_001044_10142_10585 147
102 3300054114 Ga0501084_0127779 Ga0501084_0127779_1618_2061 147
103 3300060353 Ga0501082_0001227 Ga0501082_0001227_12892_13335 147
104 3300005290 Ga0065712_10651302 Ga0065712_106513021 148
105 3300005327 Ga0070658_10017722 Ga0070658_100177222 148
106 3300005329 Ga0070683_100298879 Ga0070683_1002988792 148
107 3300005329 Ga0070683_100393880 Ga0070683_1003938802 148
108 3300005334 Ga0068869_100749165 Ga0068869_1007491652 148
109 3300005336 Ga0070680_100158333 Ga0070680_1001583332 148
110 3300005339 Ga0070660_100007534 Ga0070660_10000753411 148
111 3300005339 Ga0070660_100018054 Ga0070660_1000180545 148
112 3300005344 Ga0070661_100414997 Ga0070661_1004149972 148
113 3300005355 Ga0070671_100580348 Ga0070671_1005803481 148
114 3300005366 Ga0070659_100019518 Ga0070659_1000195184 148
115 3300005435 Ga0070714_100634887 Ga0070714_1006348872 148
116 3300005437 Ga0070710_11090067 Ga0070710_110900671 148
117 3300005439 Ga0070711_100432894 Ga0070711_1004328942 148
118 3300005458 Ga0070681_10056312 Ga0070681_100563128 148
119 3300005458 Ga0070681_10214489 Ga0070681_102144892 148
120 3300005458 Ga0070681_11222991 Ga0070681_112229912 148
121 3300005530 Ga0070679_100201707 Ga0070679_1002017073 148
122 3300005535 Ga0070684_100019281 Ga0070684_1000192816 148
123 3300005539 Ga0068853_100635649 Ga0068853_1006356491 148
124 3300005539 Ga0068853_101400779 Ga0068853_1014007791 148
125 3300005547 Ga0070693_100138157 Ga0070693_1001381571 148
126 3300005549 Ga0070704_101165535 Ga0070704_1011655351 148
127 3300005563 Ga0068855_100017876 Ga0068855_1000178764 148
128 3300005563 Ga0068855_100053325 Ga0068855_1000533258 148
129 3300005563 Ga0068855_100268278 Ga0068855_1002682783 148
130 3300005563 Ga0068855_100436383 Ga0068855_1004363832 148
131 3300005577 Ga0068857_100006515 Ga0068857_1000065159 148
132 3300005577 Ga0068857_100015728 Ga0068857_1000157284 148
133 3300005614 Ga0068856_100024733 Ga0068856_1000247336 148
134 3300005614 Ga0068856_100034151 Ga0068856_1000341512 148
135 3300005614 Ga0068856_100037869 Ga0068856_1000378691 148
136 3300005614 Ga0068856_100702153 Ga0068856_1007021531 148
137 3300005616 Ga0068852_100028510 Ga0068852_1000285103 148
138 3300005616 Ga0068852_102068297 Ga0068852_1020682971 148
139 3300005617 Ga0068859_100188270 Ga0068859_1001882703 148
140 3300005617 Ga0068859_102097736 Ga0068859_1020977362 148
141 3300005618 Ga0068864_100009726 Ga0068864_10000972614 148
142 3300005618 Ga0068864_100077675 Ga0068864_1000776752 148
143 3300005719 Ga0068861_101758819 Ga0068861_1017588191 148
144 3300005841 Ga0068863_100461408 Ga0068863_1004614082 148
145 3300005842 Ga0068858_100767035 Ga0068858_1007670352 148
146 3300005844 Ga0068862_100153363 Ga0068862_1001533632 148
147 3300005937 Ga0081455_10018382 Ga0081455_100183828 148
148 3300006048 Ga0075363_100084719 Ga0075363_1000847192 148
149 3300006177 Ga0075362_10006750 Ga0075362_100067505 148
150 3300006237 Ga0097621_100147130 Ga0097621_1001471303 148
151 3300006353 Ga0075370_10088532 Ga0075370_100885323 148
152 3300006358 Ga0068871_100246156 Ga0068871_1002461562 148
153 3300006844 Ga0075428_100016435 Ga0075428_1000164358 148
154 3300006847 Ga0075431_100182564 Ga0075431_1001825643 148
155 3300006880 Ga0075429_100000901 Ga0075429_1000009016 148
156 3300006931 Ga0097620_100188265 Ga0097620_1001882653 148
157 3300006931 Ga0097620_102098514 Ga0097620_1020985142 148
158 3300007788 Ga0099795_10043719 Ga0099795_100437192 148
159 3300009093 Ga0105240_10069609 Ga0105240_100696091 148
160 3300009093 Ga0105240_10182660 Ga0105240_101826602 148
161 3300009093 Ga0105240_10206169 Ga0105240_102061691 148
162 3300009093 Ga0105240_10227806 Ga0105240_102278063 148
163 3300009094 Ga0111539_10046058 Ga0111539_100460582 148
164 3300009098 Ga0105245_10029305 Ga0105245_100293054 148
165 3300009098 Ga0105245_10161847 Ga0105245_101618471 148
166 3300009098 Ga0105245_10511404 Ga0105245_105114042 148
167 3300009147 Ga0114129_10071456 Ga0114129_100714563 148
168 3300009147 Ga0114129_10078504 Ga0114129_100785047 148
169 3300009174 Ga0105241_10055682 Ga0105241_100556822 148
170 3300009176 Ga0105242_10272961 Ga0105242_102729612 148
171 3300009176 Ga0105242_10349242 Ga0105242_103492421 148
172 3300009545 Ga0105237_10451504 Ga0105237_104515041 148
173 3300009545 Ga0105237_10595243 Ga0105237_105952431 148
174 3300009551 Ga0105238_10012729 Ga0105238_1001272910 148
175 3300010159 Ga0099796_10203535 Ga0099796_102035351 148
176 3300010375 Ga0105239_10007005 Ga0105239_100070059 148
177 3300010375 Ga0105239_10302283 Ga0105239_103022832 148
178 3300013104 Ga0157370_10007530 Ga0157370_100075307 148
179 3300013105 Ga0157369_10019784 Ga0157369_100197841 148
180 3300013296 Ga0157374_10005365 Ga0157374_100053654 148
181 3300013296 Ga0157374_10667230 Ga0157374_106672301 148
182 3300013296 Ga0157374_10915172 Ga0157374_109151722 148
183 3300013297 Ga0157378_10000503 Ga0157378_100005038 148
184 3300013297 Ga0157378_10002349 Ga0157378_100023499 148
185 3300013306 Ga0163162_10000247 Ga0163162_1000024726 148
186 3300013306 Ga0163162_10701992 Ga0163162_107019921 148
187 3300013307 Ga0157372_10025305 Ga0157372_100253053 148
188 3300013307 Ga0157372_10045416 Ga0157372_100454168 148
189 3300013308 Ga0157375_12949130 Ga0157375_129491301 148
190 3300014325 Ga0163163_10003011 Ga0163163_1000301118 148
191 3300014325 Ga0163163_10697367 Ga0163163_106973671 148
192 3300014326 Ga0157380_11263181 Ga0157380_112631812 148
193 3300014497 Ga0182008_10003941 Ga0182008_100039413 148
194 3300014968 Ga0157379_10289045 Ga0157379_102890452 148
195 3300015261 Ga0182006_1065398 Ga0182006_10653981 148
196 3300025245 Ga0207425_1038352 Ga0207425_10383522 148
197 3300025911 Ga0207654_10065288 Ga0207654_100652882 148
198 3300025911 Ga0207654_10178213 Ga0207654_101782131 148
199 3300025912 Ga0207707_10161546 Ga0207707_101615464 148
200 3300025912 Ga0207707_10240340 Ga0207707_102403403 148
201 3300025913 Ga0207695_10166564 Ga0207695_101665644 148
202 3300025913 Ga0207695_10554618 Ga0207695_105546181 148
203 3300025914 Ga0207671_10036135 Ga0207671_100361353 148
204 3300025917 Ga0207660_10233096 Ga0207660_102330961 148
205 3300025919 Ga0207657_10013378 Ga0207657_1001337810 148
206 3300025919 Ga0207657_10126170 Ga0207657_101261704 148
207 3300025921 Ga0207652_10118911 Ga0207652_101189112 148
208 3300025924 Ga0207694_10005903 Ga0207694_100059035 148
209 3300025924 Ga0207694_10023886 Ga0207694_100238864 148
210 3300025924 Ga0207694_10056482 Ga0207694_100564823 148
211 3300025927 Ga0207687_10137191 Ga0207687_101371911 148
212 3300025927 Ga0207687_10236677 Ga0207687_102366772 148
213 3300025927 Ga0207687_11065805 Ga0207687_110658051 148
214 3300025931 Ga0207644_10503386 Ga0207644_105033863 148
215 3300025932 Ga0207690_10002276 Ga0207690_1000227611 148
216 3300025934 Ga0207686_10180028 Ga0207686_101800282 148
217 3300025934 Ga0207686_10410355 Ga0207686_104103551 148
218 3300025936 Ga0207670_10374285 Ga0207670_103742852 148
219 3300025942 Ga0207689_10278323 Ga0207689_102783232 148
220 3300025944 Ga0207661_10460111 Ga0207661_104601112 148
221 3300025944 Ga0207661_10567811 Ga0207661_105678112 148
222 3300025949 Ga0207667_10009419 Ga0207667_1000941912 148
223 3300025949 Ga0207667_10019833 Ga0207667_100198336 148
224 3300025949 Ga0207667_10408798 Ga0207667_104087982 148
225 3300025949 Ga0207667_10850455 Ga0207667_108504552 148
226 3300025981 Ga0207640_11288884 Ga0207640_112888841 148
227 3300026035 Ga0207703_10859014 Ga0207703_108590142 148
228 3300026041 Ga0207639_10433165 Ga0207639_104331652 148
229 3300026041 Ga0207639_10913524 Ga0207639_109135242 148
230 3300026078 Ga0207702_10180608 Ga0207702_101806083 148
231 3300026078 Ga0207702_10268201 Ga0207702_102682011 148
232 3300026078 Ga0207702_10293376 Ga0207702_102933762 148
233 3300026088 Ga0207641_10037308 Ga0207641_100373082 148
234 3300026095 Ga0207676_10170649 Ga0207676_101706492 148
235 3300026095 Ga0207676_10210318 Ga0207676_102103182 148
236 3300026116 Ga0207674_10001855 Ga0207674_1000185530 148
237 3300026116 Ga0207674_10002269 Ga0207674_1000226910 148
238 3300026118 Ga0207675_100597149 Ga0207675_1005971491 148
239 3300026142 Ga0207698_10111663 Ga0207698_101116631 148
240 3300026142 Ga0207698_11886623 Ga0207698_118866231 148
241 3300028380 Ga0268265_10159502 Ga0268265_101595024 148
242 3300028794 Ga0307515_10866055 Ga0307515_108660551 148
243 3300028800 Ga0265338_10035467 Ga0265338_100354673 148
244 3300030760 Ga0265762_1012320 Ga0265762_10123203 148
245 3300031241 Ga0265325_10000376 Ga0265325_1000037614 148
246 3300031249 Ga0265339_10072680 Ga0265339_100726802 148
247 3300031251 Ga0265327_10228806 Ga0265327_102288061 148
248 3300031344 Ga0265316_10035095 Ga0265316_100350954 148
249 3300031548 Ga0307408_100112410 Ga0307408_1001124103 148
250 3300031595 Ga0265313_10107300 Ga0265313_101073003 148
251 3300031731 Ga0307405_10575237 Ga0307405_105752372 148
252 3300031911 Ga0307412_10417758 Ga0307412_104177581 148
253 3300031911 Ga0307412_10569068 Ga0307412_105690682 148
254 3300032002 Ga0307416_100024623 Ga0307416_1000246235 148
255 3300032002 Ga0307416_100059447 Ga0307416_1000594474 148
256 3300032004 Ga0307414_10633541 Ga0307414_106335412 148
257 3300032004 Ga0307414_11098813 Ga0307414_110988131 148
258 3300035092 Ga0373952_0004333 Ga0373952_0004333_1359_1805 148
259 3300035121 Ga0373960_0041264 Ga0373960_0041264_265_711 148
260 3300035691 Ga0373931_0378676 Ga0373931_0378676_209_655 148
261 3300041404 Ga0439436_0001739 Ga0439436_0001739_5454_5900 148
262 3300041406 Ga0439439_0091229 Ga0439439_0091229_92_538 148
263 3300041997 Ga0439431_0113142 Ga0439431_0113142_49_495 148
264 3300042004 Ga0439445_0031635 Ga0439445_0031635_193_639 148
265 3300042007 Ga0439449_0008806 Ga0439449_0008806_162_608 148
266 3300042010 Ga0439452_039850 Ga0439452_039850_107_553 148
267 3300042014 Ga0439457_073963 Ga0439457_073963_314_760 148
268 3300042125 Ga0450923_071263 Ga0450923_071263_284_730 148
269 3300042127 Ga0450890_048988 Ga0450890_048988_44_490 148
270 3300042131 Ga0450894_034526 Ga0450894_034526_28_474 148
271 3300042134 Ga0450898_014209 Ga0450898_014209_610_1056 148
272 3300042146 Ga0450907_006346 Ga0450907_006346_366_812 148
273 3300042156 Ga0439446_0005393 Ga0439446_0005393_135_581 148
274 3300042184 Ga0450908_002048 Ga0450908_002048_2768_3214 148
275 3300042532 Ga0450893_0018972 Ga0450893_0018972_154_600 148
276 3300042876 Ga0451577_1566095 Ga0451577_1566095_36_494 148
277 3300046472 Ga0495580_0298885 Ga0495580_0298885_258_731 148
278 3300046517 Ga0495630_1441137 Ga0495630_1441137_41_487 148
279 3300046531 Ga0495665_0647786 Ga0495665_0647786_21_467 148
280 3300046535 Ga0495586_0158723 Ga0495586_0158723_258_704 148
281 3300046557 Ga0495622_0376334 Ga0495622_0376334_122_568 148
282 3300048915 Ga0496112_0346131 Ga0496112_0346131_739_1185 148
283 3300049575 Ga0501039_0286584 Ga0501039_0286584_424_885 148
284 3300049576 Ga0501040_0079130 Ga0501040_0079130_321_782 148
285 3300049577 Ga0501041_0012561 Ga0501041_0012561_2874_3335 148
286 3300049578 Ga0501042_0216938 Ga0501042_0216938_29_490 148
287 3300049578 Ga0501042_0322169 Ga0501042_0322169_56_619 148
288 3300049580 Ga0501046_0506289 Ga0501046_0506289_111_572 148
289 3300049584 Ga0501068_0382640 Ga0501068_0382640_333_794 148
290 3300049587 Ga0501071_0466202 Ga0501071_0466202_212_673 148
291 3300049588 Ga0501072_0109032 Ga0501072_0109032_1613_2074 148
292 3300049590 Ga0501074_0069835 Ga0501074_0069835_1790_2251 148
293 3300049591 Ga0501075_0276219 Ga0501075_0276219_456_917 148
294 3300049592 Ga0501076_0496054 Ga0501076_0496054_127_588 148
295 3300049593 Ga0501077_0568878 Ga0501077_0568878_26_487 148
296 3300049741 Ga0501079_0355215 Ga0501079_0355215_154_615 148
297 3300049742 Ga0501080_0155143 Ga0501080_0155143_34_495 148
298 3300049743 Ga0501081_0188643 Ga0501081_0188643_253_714 148
299 3300049744 Ga0501083_0433601 Ga0501083_0433601_103_564 148
300 3300049823 Ga0501044_0722554 Ga0501044_0722554_318_779 148
301 3300049824 Ga0501045_0009817 Ga0501045_0009817_1389_1850 148
302 3300050489 nmdc:mga03683_51448_c1 nmdc:mga03683_51448_c1_477_923 148
303 3300050493 nmdc:mga0k408_24519_c1 nmdc:mga0k408_24519_c1_1087_1533 148
304 3300050496 nmdc:mga07m45_85508_c1 nmdc:mga07m45_85508_c1_395_841 148
305 3300050507 nmdc:mga05p37_60180_c1 nmdc:mga05p37_60180_c1_4191_4637 148
306 3300050507 nmdc:mga05p37_7761_c1 nmdc:mga05p37_7761_c1_3252_3698 148
307 3300050508 nmdc:mga09592_328_c1 nmdc:mga09592_328_c1_31059_31505 148
308 3300050510 nmdc:mga06r32_132794_c1 nmdc:mga06r32_132794_c1_1641_2087 148
309 3300050511 nmdc:mga08y16_999224_c1 nmdc:mga08y16_999224_c1_356_802 148
310 3300050512 nmdc:mga0n895_1902748_c1 nmdc:mga0n895_1902748_c1_18_464 148
311 3300053153 Ga0500616_0196544 Ga0500616_0196544_112_558 148
312 3300054114 Ga0501084_0240767 Ga0501084_0240767_292_753 148
313 3300054114 Ga0501084_0341043 Ga0501084_0341043_316_762 148
314 3300060353 Ga0501082_0028576 Ga0501082_0028576_3231_3692 148
315 3300061734 Ga0530510_0014998 Ga0530510_0014998_2887_3348 148

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

13

125

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1z94-assembly2.cif.gz_E-2 x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9955 4 145
1z94-assembly1.cif.gz_B x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9954 4 145
1z94-assembly1.cif.gz_A x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9938 4 145
1z94-assembly2.cif.gz_E-2 x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9812 4 145
1z94-assembly1.cif.gz_A x-ray crystal structure of protein cv1439 from chromobacterium violaceum. northeast structural genomics consortium target cvr12. 0.9798 4 145
ID Description Score Start End Superfamily
1z94E00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9954 4 145 3.30.530.20
1z94E00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.9809 4 145 3.30.530.20
3q64A00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8543 2 140 3.30.530.20
4fpwA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8456 3 138 3.30.530.20
1xuvB00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8413 1 141 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A7X8SZC2-F1-model_v4 SRPBCC family protein 1.001 2 148
AF-A0A419EKS9-F1-model_v4 Polyketide cyclase 1.001 4 148
AF-A0A0Q6VIA6-F1-model_v4 Toxin 1 2 148
AF-A0A2A6JM80-F1-model_v4 Toxin 1 2 148
AF-A0A3S1ZYZ0-F1-model_v4 deleted 1 2 148

Feature Viewer

pLDDT pTM Quality
95.13 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map