F403376

General Info

Members Datasets Scaffolds Average Seq Length
315 195 630 404

Family's Representative Sequence

Representative Sequence 3300049577|Ga0501041_0163661|Ga0501041_0163661_54_1346
Length 420
Sequence LLRRLEALSGMASQYDLTIIGGGILGLATALKITAAHPNVRLLILEKEAALARHQTGNNSGVIHSGLYYRPGSLKAKSCVSGRKELMAFCDENSVPYEICGKVVVATSPAELPRLDELHRRGLANGLQGLEIIGPERLKEIEPHAVGIKGLFVPETGIVDYRKVAAAYADKVRDANGDIRMGQRVVGIIDGSDEVVLQTSGGDYRTKYLINCCGLQSDIVAQMMGPSSQQNDEEEHRIIPFRGEYYKIAPEREYLVKNLIYPVPDPTFPFLGVHFTRMARGGVEAGPNAVFAYAREGYRHSDINLSDLWRTVSFKGFWAITAKYWRTGFGELYRSLSKAAFVRALQKLLPEIREQDLVPGGAGVRAQAVSASGALVDDFIIKQSQRAIHILNAPSPGATASLAIGQQIREMAEKNFQLQR

Samples

Sample ID Description Type Environment
1 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
44 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
53 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
71 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
106 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
107 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
108 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
111 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
112 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
113 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
114 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
115 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
116 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
117 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
118 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
119 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
120 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
121 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
122 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
123 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
124 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
125 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
128 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
129 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
130 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
131 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
132 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
133 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
134 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
135 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
136 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
137 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
138 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
139 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
140 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
141 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
142 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
143 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
144 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
145 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
146 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
147 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
148 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
149 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
150 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
151 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
152 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
153 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
154 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
155 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
156 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
157 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
160 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
161 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
165 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
167 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
168 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
169 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
170 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
171 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
172 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
173 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
174 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
175 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
176 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
177 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
178 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
179 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
180 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
182 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
183 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
184 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
185 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
186 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
187 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
188 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
189 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
190 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
191 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
192 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
193 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
194 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
195 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.41
Metatranscriptomes 1.27
Isolates 0.32

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.63
Nodule 0
Rhizoplane 0.63
Rhizosphere 96.83
Stem 0
Stem Tuber 0
Unclassified 16.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501041_0163661 3300049577 Bacteria 1391
2 MRS1b_contig_8406260 2162886011 Unclassified 1962
3 rootH1_10049181 3300003316 Unclassified 2550
4 rootH1_10160943 3300003323 Bacteria 2877
5 rootH1_10348355 3300003323 Bacteria 2131
6 Ga0055531_10000223 3300003794 Bacteria 62728
7 Ga0065712_10067961 3300005290 Bacteria 18984
8 Ga0065712_10072278 3300005290 Bacteria 4822
9 Ga0065712_10080302 3300005290 Unclassified 3122
10 Ga0065715_10089289 3300005293 Bacteria 11516
11 Ga0065707_10011453 3300005295 Bacteria 4131
12 Ga0070658_10040280 3300005327 Bacteria 3769
13 Ga0070690_100008275 3300005330 Bacteria 5983
14 Ga0070690_100064035 3300005330 Unclassified 2374
15 Ga0070670_100000626 3300005331 Bacteria 27664
16 Ga0070670_100002060 3300005331 Bacteria 16463
17 Ga0070670_100165367 3300005331 Bacteria 1918
18 Ga0070677_10077213 3300005333 Bacteria 1416
19 Ga0070666_10022123 3300005335 Bacteria 4126
20 Ga0068868_100001940 3300005338 Bacteria 14191
21 Ga0068868_100025608 3300005338 Unclassified 4489
22 Ga0070689_100076280 3300005340 Bacteria 2626
23 Ga0070661_100032225 3300005344 Unclassified 3793
24 Ga0070661_100044930 3300005344 Bacteria 3228
25 Ga0070669_100000033 3300005353 Bacteria 144544
26 Ga0070669_100027583 3300005353 Bacteria 4087
27 Ga0070671_100013890 3300005355 Bacteria 6496
28 Ga0070673_100089948 3300005364 Bacteria 2507
29 Ga0070667_100007130 3300005367 Bacteria 9291
30 Ga0070667_100018086 3300005367 Bacteria 5842
31 Ga0070713_100250436 3300005436 Bacteria 1615
32 Ga0070711_100116246 3300005439 Unclassified 1971
33 Ga0070678_100018591 3300005456 Unclassified 4506
34 Ga0070662_100013796 3300005457 Bacteria 5382
35 Ga0070707_100032504 3300005468 Bacteria 4972
36 Ga0070698_100012583 3300005471 Bacteria 8959
37 Ga0070699_100090399 3300005518 Bacteria 2676
38 Ga0070699_100202092 3300005518 Bacteria 1767
39 Ga0070679_100004386 3300005530 Bacteria 13043
40 Ga0070684_100166857 3300005535 Unclassified 1999
41 Ga0070697_100017687 3300005536 Bacteria 5616
42 Ga0070697_100054127 3300005536 Unclassified 3261
43 Ga0070672_100009601 3300005543 Bacteria 6676
44 Ga0070672_100062037 3300005543 Unclassified 2949
45 Ga0070695_100010331 3300005545 Bacteria 5571
46 Ga0070696_100032704 3300005546 Unclassified 3569
47 Ga0070665_100060639 3300005548 Bacteria 3792
48 Ga0068855_100345244 3300005563 Bacteria 1640
49 Ga0070664_100001356 3300005564 Bacteria 19539
50 Ga0070664_100137623 3300005564 Bacteria 2148
51 Ga0068856_100051671 3300005614 Bacteria 4052
52 Ga0070702_100015763 3300005615 Bacteria 3865
53 Ga0068859_100328834 3300005617 Unclassified 1623
54 Ga0068864_100038988 3300005618 Bacteria 4059
55 Ga0068863_100078893 3300005841 Bacteria 3118
56 Ga0068858_100063183 3300005842 Unclassified 3426
57 Ga0081455_10000672 3300005937 Bacteria 44265
58 Ga0081538_10005506 3300005981 Bacteria 11374
59 Ga0070717_10000264 3300006028 Bacteria 35633
60 Ga0070717_10022858 3300006028 Bacteria 4947
61 Ga0070717_10026804 3300006028 Bacteria 4602
62 Ga0070717_10220267 3300006028 Bacteria 1668
63 Ga0070716_100052995 3300006173 Bacteria 2311
64 Ga0070712_100104334 3300006175 Bacteria 2103
65 Ga0068871_100124660 3300006358 Unclassified 2179
66 Ga0075428_100003705 3300006844 Bacteria 16737
67 Ga0075428_100026931 3300006844 Bacteria 6367
68 Ga0075430_100046277 3300006846 Bacteria 3675
69 Ga0075430_100159999 3300006846 Bacteria 1874
70 Ga0075431_100000620 3300006847 Bacteria 29968
71 Ga0075433_10002439 3300006852 Bacteria 14152
72 Ga0075433_10025618 3300006852 Bacteria 4988
73 Ga0075433_10032184 3300006852 Unclassified 4491
74 Ga0075433_10287876 3300006852 Bacteria 1455
75 Ga0075434_100007676 3300006871 Bacteria 9983
76 Ga0075434_100041208 3300006871 Bacteria 4574
77 Ga0075434_100061504 3300006871 Unclassified 3736
78 Ga0075434_100089916 3300006871 Bacteria 3071
79 Ga0068865_100048707 3300006881 Bacteria 2917
80 Ga0075436_100002400 3300006914 Bacteria 12917
81 Ga0075436_100029309 3300006914 Bacteria 3785
82 Ga0075436_100034351 3300006914 Unclassified 3497
83 Ga0097620_100328827 3300006931 Unclassified 1623
84 Ga0075435_100024079 3300007076 Bacteria 4719
85 Ga0075435_100044992 3300007076 Bacteria 3537
86 Ga0075435_100079976 3300007076 Bacteria 2683
87 Ga0075435_100215542 3300007076 Bacteria 1629
88 Ga0105240_10050348 3300009093 Bacteria 5252
89 Ga0105240_10271775 3300009093 Bacteria 1951
90 Ga0111539_10062143 3300009094 Bacteria 4422
91 Ga0114129_10014989 3300009147 Bacteria 11040
92 Ga0114129_10026195 3300009147 Bacteria 8257
93 Ga0114129_10047504 3300009147 Bacteria 6031
94 Ga0114129_10062678 3300009147 Bacteria 5193
95 Ga0114129_10075769 3300009147 Bacteria 4684
96 Ga0114129_10160424 3300009147 Bacteria 3072
97 Ga0114129_10499913 3300009147 Bacteria 1588
98 Ga0114129_10603487 3300009147 Bacteria 1422
99 Ga0105248_10252790 3300009177 Unclassified 1984
100 Ga0105237_10192021 3300009545 Bacteria 2042
101 Ga0105237_10232136 3300009545 Unclassified 1846
102 Ga0105238_10150401 3300009551 Bacteria 2303
103 Ga0105239_10020639 3300010375 Bacteria 7269
104 Ga0157369_10000176 3300013105 Bacteria 89387
105 Ga0157374_10018643 3300013296 Bacteria 6128
106 Ga0157378_10007068 3300013297 Bacteria 9801
107 Ga0163162_10000713 3300013306 Bacteria 30827
108 Ga0163162_10024085 3300013306 Bacteria 6008
109 Ga0157372_10082647 3300013307 Bacteria 3637
110 Ga0157372_10088212 3300013307 Bacteria 3522
111 Ga0157375_10141284 3300013308 Unclassified 2535
112 Ga0163163_10016087 3300014325 Bacteria 6938
113 Ga0163163_10102318 3300014325 Unclassified 2888
114 Ga0157376_10050329 3300014969 Unclassified 3456
115 Ga0157376_10386426 3300014969 Bacteria 1350
116 Ga0209257_1000005 3300025304 Bacteria 1592528
117 Ga0207697_10026983 3300025315 Bacteria 2349
118 Ga0207682_10079348 3300025893 Bacteria 1404
119 Ga0207688_10007623 3300025901 Bacteria 5892
120 Ga0207645_10000938 3300025907 Bacteria 24220
121 Ga0207684_10035071 3300025910 Bacteria 4260
122 Ga0207654_10136907 3300025911 Bacteria 1557
123 Ga0207707_10004153 3300025912 Bacteria 12830
124 Ga0207707_10227956 3300025912 Unclassified 1621
125 Ga0207695_10112609 3300025913 Bacteria 2698
126 Ga0207695_10218464 3300025913 Bacteria 1814
127 Ga0207693_10097339 3300025915 Unclassified 2307
128 Ga0207693_10129330 3300025915 Unclassified 1985
129 Ga0207660_10007810 3300025917 Bacteria 6925
130 Ga0207657_10005277 3300025919 Bacteria 13540
131 Ga0207646_10007451 3300025922 Bacteria 11120
132 Ga0207681_10000011 3300025923 Bacteria 366878
133 Ga0207659_10068754 3300025926 Bacteria 2577
134 Ga0207659_10116939 3300025926 Unclassified 2037
135 Ga0207644_10018584 3300025931 Unclassified 4706
136 Ga0207706_10004414 3300025933 Bacteria 13216
137 Ga0207706_10033794 3300025933 Bacteria 4551
138 Ga0207665_10024934 3300025939 Bacteria 3944
139 Ga0207665_10104759 3300025939 Bacteria 1980
140 Ga0207691_10005407 3300025940 Bacteria 12326
141 Ga0207711_10125617 3300025941 Unclassified 2294
142 Ga0207711_10147460 3300025941 Unclassified 2121
143 Ga0207679_10002958 3300025945 Bacteria 10532
144 Ga0207679_10055561 3300025945 Unclassified 2919
145 Ga0207651_10047190 3300025960 Unclassified 2902
146 Ga0207658_10016849 3300025986 Bacteria 5028
147 Ga0207677_10003388 3300026023 Bacteria 8438
148 Ga0207703_10140390 3300026035 Unclassified 2096
149 Ga0207703_10339340 3300026035 Bacteria 1380
150 Ga0207708_10033868 3300026075 Unclassified 3884
151 Ga0207641_10044013 3300026088 Bacteria 3752
152 Ga0207648_10021013 3300026089 Bacteria 5876
153 Ga0207676_10060889 3300026095 Unclassified 2987
154 Ga0207683_10000522 3300026121 Bacteria 35582
155 Ga0209982_1003539 3300027552 Bacteria 2221
156 Ga0209974_10006118 3300027876 Bacteria 4215
157 Ga0265318_10000669 3300028577 Bacteria 23360
158 Ga0307515_10000394 3300028794 Bacteria 105754
159 Ga0316176_1040524 3300030732 Bacteria 32090
160 Ga0265762_1000041 3300030760 Bacteria 15201
161 Ga0265762_1001238 3300030760 Unclassified 4635
162 Ga0265760_10017764 3300031090 Unclassified 2044
163 Ga0265760_10026517 3300031090 Bacteria 1696
164 Ga0265332_10000097 3300031238 Bacteria 76386
165 Ga0265328_10017205 3300031239 Bacteria 2801
166 Ga0265340_10002580 3300031247 Bacteria 10290
167 Ga0265331_10000137 3300031250 Bacteria 96088
168 Ga0265316_10001179 3300031344 Bacteria 28330
169 Ga0307408_100042508 3300031548 Bacteria 3229
170 Ga0265313_10000092 3300031595 Bacteria 90025
171 Ga0307514_10021081 3300031649 Bacteria 5312
172 Ga0316579_10020383 3300031691 Bacteria 2940
173 Ga0316579_10052878 3300031691 Bacteria 1902
174 Ga0265342_10000086 3300031712 Bacteria 100053
175 Ga0307405_10059157 3300031731 Bacteria 2414
176 Ga0316577_10003162 3300031733 Bacteria 8279
177 Ga0316577_10004795 3300031733 Bacteria 7032
178 Ga0316577_10011079 3300031733 Bacteria 4878
179 Ga0316577_10039605 3300031733 Bacteria 2636
180 Ga0307413_10001482 3300031824 Bacteria 8942
181 Ga0307410_10003756 3300031852 Bacteria 7695
182 Ga0307410_10127705 3300031852 Bacteria 1864
183 Ga0307407_10018882 3300031903 Bacteria 3499
184 Ga0307412_10000001 3300031911 Bacteria 822691
185 Ga0307412_10011528 3300031911 Bacteria 5126
186 Ga0307409_100003950 3300031995 Bacteria 8215
187 Ga0307416_100002076 3300032002 Bacteria 11295
188 Ga0307416_100011040 3300032002 Bacteria 6001
189 Ga0307414_10008285 3300032004 Bacteria 5885
190 Ga0307411_10003952 3300032005 Bacteria 7000
191 Ga0316585_10018561 3300032137 Bacteria 2112
192 Ga0373926_0021876 3300035083 Unclassified 2216
193 Ga0373929_0000017 3300035085 Bacteria 128486
194 Ga0316574_0012258 3300035398 Bacteria 4902
195 Ga0373924_0041516 3300035410 Unclassified 1885
196 Ga0373931_0005086 3300035691 Bacteria 6051
197 Ga0373935_0016110 3300035692 Bacteria 4523
198 Ga0373937_0119980 3300036401 Bacteria 2450
199 Ga0316582_0000891 3300036647 Bacteria 12237
200 Ga0316582_0001919 3300036647 Bacteria 9485
201 Ga0316582_0019954 3300036647 Bacteria 3933
202 Ga0316582_0054204 3300036647 Bacteria 2552
203 Ga0316582_0069612 3300036647 Bacteria 2275
204 Ga0316584_0001667 3300036712 Bacteria 13563
205 Ga0316584_0007645 3300036712 Bacteria 7417
206 Ga0316584_0031640 3300036712 Bacteria 3912
207 Ga0316584_0059650 3300036712 Bacteria 2857
208 Ga0316584_0152015 3300036712 Bacteria 1723
209 Ga0373925_0004818 3300037068 Bacteria 10164
210 Ga0316581_0001230 3300037588 Bacteria 5649
211 Ga0316581_0011936 3300037588 Bacteria 2438
212 Ga0316581_0020722 3300037588 Bacteria 1926
213 Ga0316581_0038299 3300037588 Bacteria 1458
214 Ga0436362_0697101 3300039453 Bacteria 1474
215 Ga0451577_0051863 3300042876 Bacteria 3663
216 Ga0451577_0099736 3300042876 Bacteria 2594
217 Ga0451577_0187491 3300042876 Bacteria 1865
218 Ga0451577_0352290 3300042876 Bacteria 1335
219 Ga0453683_0011446 3300044673 Bacteria 5844
220 Ga0453684_0000289 3300044712 Bacteria 215476
221 Ga0453684_0026892 3300044712 Bacteria 8287
222 Ga0453684_0042071 3300044712 Bacteria 6165
223 Ga0453684_0105332 3300044712 Bacteria 3440
224 Ga0453684_0421361 3300044712 Bacteria 1491
225 Ga0451576_0002858 3300045051 Bacteria 24784
226 Ga0451576_0009447 3300045051 Bacteria 11304
227 Ga0451576_0097137 3300045051 Bacteria 3064
228 Ga0495629_0010386 3300046459 Bacteria 6777
229 Ga0495580_0000074 3300046472 Bacteria 62279
230 Ga0495580_0000808 3300046472 Bacteria 27100
231 Ga0495580_0010914 3300046472 Bacteria 7047
232 Ga0495582_0006195 3300046473 Bacteria 6661
233 Ga0495669_0058506 3300046684 Unclassified 1739
234 Ga0495613_0101036 3300046689 Unclassified 2083
235 Ga0495624_0108592 3300046690 Unclassified 1707
236 Ga0495581_0141941 3300047315 Bacteria 1401
237 Ga0496106_0071503 3300048909 Unclassified 2652
238 Ga0496112_0031676 3300048915 Bacteria 5130
239 Ga0496126_0026021 3300048929 Bacteria 5618
240 Ga0501032_0013355 3300049569 Bacteria 5845
241 Ga0501036_0016390 3300049572 Bacteria 6190
242 Ga0501036_0074531 3300049572 Bacteria 2870
243 Ga0501038_0001283 3300049574 Bacteria 22832
244 Ga0501039_0000497 3300049575 Bacteria 28501
245 Ga0501040_0003120 3300049576 Bacteria 10747
246 Ga0501041_0000099 3300049577 Bacteria 35733
247 Ga0501041_0029825 3300049577 Bacteria 3291
248 Ga0501041_0163018 3300049577 Unclassified 1394
249 Ga0501042_0000526 3300049578 Bacteria 19980
250 Ga0501043_0178605 3300049579 Bacteria 1654
251 Ga0501046_0002289 3300049580 Bacteria 18056
252 Ga0501046_0039253 3300049580 Bacteria 3792
253 Ga0501048_0030723 3300049582 Unclassified 3887
254 Ga0501068_0006057 3300049584 Bacteria 6647
255 Ga0501068_0012412 3300049584 Unclassified 4831
256 Ga0501069_0074679 3300049585 Bacteria 1903
257 Ga0501070_0007309 3300049586 Bacteria 9381
258 Ga0501071_0000575 3300049587 Bacteria 19031
259 Ga0501071_0057554 3300049587 Bacteria 2810
260 Ga0501072_0000109 3300049588 Bacteria 61031
261 Ga0501073_0028855 3300049589 Bacteria 3964
262 Ga0501073_0084136 3300049589 Unclassified 2214
263 Ga0501074_0005533 3300049590 Bacteria 9086
264 Ga0501074_0032965 3300049590 Bacteria 3753
265 Ga0501075_0000256 3300049591 Bacteria 28898
266 Ga0501075_0034250 3300049591 Unclassified 3781
267 Ga0501076_0000635 3300049592 Bacteria 22398
268 Ga0501076_0124605 3300049592 Bacteria 2087
269 Ga0501077_0001225 3300049593 Bacteria 15495
270 Ga0501077_0001771 3300049593 Bacteria 13037
271 Ga0501077_0005415 3300049593 Bacteria 7761
272 Ga0501079_0000395 3300049741 Bacteria 28073
273 Ga0501079_0060286 3300049741 Bacteria 2927
274 Ga0501080_0001737 3300049742 Bacteria 18656
275 Ga0501080_0010412 3300049742 Bacteria 8512
276 Ga0501080_0115921 3300049742 Bacteria 2483
277 Ga0501081_0008749 3300049743 Bacteria 6579
278 Ga0501081_0018932 3300049743 Bacteria 4577
279 Ga0501083_0046795 3300049744 Unclassified 2924
280 Ga0501035_0020580 3300049822 Bacteria 6059
281 Ga0501035_0037187 3300049822 Bacteria 4410
282 Ga0501045_0000209 3300049824 Bacteria 33671
283 nmdc:mga05p37_120801_c1 3300050507 Unclassified 3219
284 nmdc:mga05p37_185516_c1 3300050507 Bacteria 2529
285 nmdc:mga05p37_196970_c1 3300050507 Bacteria 2442
286 nmdc:mga05p37_25217_c1 3300050507 Bacteria 7231
287 nmdc:mga05p37_266163_c1 3300050507 Bacteria 2050
288 nmdc:mga09592_357654_c1 3300050508 Bacteria 1263
289 nmdc:mga0qj67_13763_c1 3300050509 Bacteria 6106
290 nmdc:mga0qj67_279649_c1 3300050509 Bacteria 1353
291 nmdc:mga06r32_16530_c1 3300050510 Bacteria 6726
292 nmdc:mga06r32_218090_c1 3300050510 Bacteria 1896
293 nmdc:mga08y16_105532_c1 3300050511 Bacteria 2933
294 nmdc:mga0n895_1841_c1 3300050512 Bacteria 16181
295 nmdc:mga0n895_19954_c1 3300050512 Bacteria 6241
296 nmdc:mga0n895_46852_c1 3300050512 Bacteria 4225
297 nmdc:mga0n895_51067_c1 3300050512 Bacteria 4056
298 nmdc:mga0rr50_41947_c1 3300050513 Bacteria 3338
299 nmdc:mga0rr50_81028_c1 3300050513 Unclassified 2504
300 nmdc:mga08x19_10266_c1 3300050514 Bacteria 5619
301 nmdc:mga08x19_38791_c1 3300050514 Bacteria 3026
302 nmdc:mga0a205_151942_c1 3300050515 Bacteria 2214
303 nmdc:mga0a205_1857_c1 3300050515 Bacteria 18274
304 nmdc:mga0a205_40875_c1 3300050515 Bacteria 4466
305 nmdc:mga0a205_5088_c1 3300050515 Bacteria 11825
306 nmdc:mga0a205_698_c1 3300050515 Bacteria 26929
307 Ga0501084_0000143 3300054114 Bacteria 54042
308 Ga0501084_0444874 3300054114 Unclassified 1096
309 Ga0590077_002807 3300059426 Bacteria 3667
310 Ga0501082_0002378 3300060353 Bacteria 16483
311 Ga0501082_0036219 3300060353 Bacteria 4251
312 Ga0501082_0065666 3300060353 Bacteria 3125
313 Ga0530510_0049119 3300061734 Bacteria 3049
314 Ga0530510_0069143 3300061734 Bacteria 2562
315 2884216333 2884215851 Bacteria 4554841
316 Ga0501041_0163661
317 MRS1b_contig_8406260
318 rootH1_10049181
319 rootH1_10160943
320 rootH1_10348355
321 Ga0055531_10000223
322 Ga0065712_10067961
323 Ga0065712_10072278
324 Ga0065712_10080302
325 Ga0065715_10089289
326 Ga0065707_10011453
327 Ga0070658_10040280
328 Ga0070690_100008275
329 Ga0070690_100064035
330 Ga0070670_100000626
331 Ga0070670_100002060
332 Ga0070670_100165367
333 Ga0070677_10077213
334 Ga0070666_10022123
335 Ga0068868_100001940
336 Ga0068868_100025608
337 Ga0070689_100076280
338 Ga0070661_100032225
339 Ga0070661_100044930
340 Ga0070669_100000033
341 Ga0070669_100027583
342 Ga0070671_100013890
343 Ga0070673_100089948
344 Ga0070667_100007130
345 Ga0070667_100018086
346 Ga0070713_100250436
347 Ga0070711_100116246
348 Ga0070678_100018591
349 Ga0070662_100013796
350 Ga0070707_100032504
351 Ga0070698_100012583
352 Ga0070699_100090399
353 Ga0070699_100202092
354 Ga0070679_100004386
355 Ga0070684_100166857
356 Ga0070697_100017687
357 Ga0070697_100054127
358 Ga0070672_100009601
359 Ga0070672_100062037
360 Ga0070695_100010331
361 Ga0070696_100032704
362 Ga0070665_100060639
363 Ga0068855_100345244
364 Ga0070664_100001356
365 Ga0070664_100137623
366 Ga0068856_100051671
367 Ga0070702_100015763
368 Ga0068859_100328834
369 Ga0068864_100038988
370 Ga0068863_100078893
371 Ga0068858_100063183
372 Ga0081455_10000672
373 Ga0081538_10005506
374 Ga0070717_10000264
375 Ga0070717_10022858
376 Ga0070717_10026804
377 Ga0070717_10220267
378 Ga0070716_100052995
379 Ga0070712_100104334
380 Ga0068871_100124660
381 Ga0075428_100003705
382 Ga0075428_100026931
383 Ga0075430_100046277
384 Ga0075430_100159999
385 Ga0075431_100000620
386 Ga0075433_10002439
387 Ga0075433_10025618
388 Ga0075433_10032184
389 Ga0075433_10287876
390 Ga0075434_100007676
391 Ga0075434_100041208
392 Ga0075434_100061504
393 Ga0075434_100089916
394 Ga0068865_100048707
395 Ga0075436_100002400
396 Ga0075436_100029309
397 Ga0075436_100034351
398 Ga0097620_100328827
399 Ga0075435_100024079
400 Ga0075435_100044992
401 Ga0075435_100079976
402 Ga0075435_100215542
403 Ga0105240_10050348
404 Ga0105240_10271775
405 Ga0111539_10062143
406 Ga0114129_10014989
407 Ga0114129_10026195
408 Ga0114129_10047504
409 Ga0114129_10062678
410 Ga0114129_10075769
411 Ga0114129_10160424
412 Ga0114129_10499913
413 Ga0114129_10603487
414 Ga0105248_10252790
415 Ga0105237_10192021
416 Ga0105237_10232136
417 Ga0105238_10150401
418 Ga0105239_10020639
419 Ga0157369_10000176
420 Ga0157374_10018643
421 Ga0157378_10007068
422 Ga0163162_10000713
423 Ga0163162_10024085
424 Ga0157372_10082647
425 Ga0157372_10088212
426 Ga0157375_10141284
427 Ga0163163_10016087
428 Ga0163163_10102318
429 Ga0157376_10050329
430 Ga0157376_10386426
431 Ga0209257_1000005
432 Ga0207697_10026983
433 Ga0207682_10079348
434 Ga0207688_10007623
435 Ga0207645_10000938
436 Ga0207684_10035071
437 Ga0207654_10136907
438 Ga0207707_10004153
439 Ga0207707_10227956
440 Ga0207695_10112609
441 Ga0207695_10218464
442 Ga0207693_10097339
443 Ga0207693_10129330
444 Ga0207660_10007810
445 Ga0207657_10005277
446 Ga0207646_10007451
447 Ga0207681_10000011
448 Ga0207659_10068754
449 Ga0207659_10116939
450 Ga0207644_10018584
451 Ga0207706_10004414
452 Ga0207706_10033794
453 Ga0207665_10024934
454 Ga0207665_10104759
455 Ga0207691_10005407
456 Ga0207711_10125617
457 Ga0207711_10147460
458 Ga0207679_10002958
459 Ga0207679_10055561
460 Ga0207651_10047190
461 Ga0207658_10016849
462 Ga0207677_10003388
463 Ga0207703_10140390
464 Ga0207703_10339340
465 Ga0207708_10033868
466 Ga0207641_10044013
467 Ga0207648_10021013
468 Ga0207676_10060889
469 Ga0207683_10000522
470 Ga0209982_1003539
471 Ga0209974_10006118
472 Ga0265318_10000669
473 Ga0307515_10000394
474 Ga0316176_1040524
475 Ga0265762_1000041
476 Ga0265762_1001238
477 Ga0265760_10017764
478 Ga0265760_10026517
479 Ga0265332_10000097
480 Ga0265328_10017205
481 Ga0265340_10002580
482 Ga0265331_10000137
483 Ga0265316_10001179
484 Ga0307408_100042508
485 Ga0265313_10000092
486 Ga0307514_10021081
487 Ga0316579_10020383
488 Ga0316579_10052878
489 Ga0265342_10000086
490 Ga0307405_10059157
491 Ga0316577_10003162
492 Ga0316577_10004795
493 Ga0316577_10011079
494 Ga0316577_10039605
495 Ga0307413_10001482
496 Ga0307410_10003756
497 Ga0307410_10127705
498 Ga0307407_10018882
499 Ga0307412_10000001
500 Ga0307412_10011528
501 Ga0307409_100003950
502 Ga0307416_100002076
503 Ga0307416_100011040
504 Ga0307414_10008285
505 Ga0307411_10003952
506 Ga0316585_10018561
507 Ga0373926_0021876
508 Ga0373929_0000017
509 Ga0316574_0012258
510 Ga0373924_0041516
511 Ga0373931_0005086
512 Ga0373935_0016110
513 Ga0373937_0119980
514 Ga0316582_0000891
515 Ga0316582_0001919
516 Ga0316582_0019954
517 Ga0316582_0054204
518 Ga0316582_0069612
519 Ga0316584_0001667
520 Ga0316584_0007645
521 Ga0316584_0031640
522 Ga0316584_0059650
523 Ga0316584_0152015
524 Ga0373925_0004818
525 Ga0316581_0001230
526 Ga0316581_0011936
527 Ga0316581_0020722
528 Ga0316581_0038299
529 Ga0436362_0697101
530 Ga0451577_0051863
531 Ga0451577_0099736
532 Ga0451577_0187491
533 Ga0451577_0352290
534 Ga0453683_0011446
535 Ga0453684_0000289
536 Ga0453684_0026892
537 Ga0453684_0042071
538 Ga0453684_0105332
539 Ga0453684_0421361
540 Ga0451576_0002858
541 Ga0451576_0009447
542 Ga0451576_0097137
543 Ga0495629_0010386
544 Ga0495580_0000074
545 Ga0495580_0000808
546 Ga0495580_0010914
547 Ga0495582_0006195
548 Ga0495669_0058506
549 Ga0495613_0101036
550 Ga0495624_0108592
551 Ga0495581_0141941
552 Ga0496106_0071503
553 Ga0496112_0031676
554 Ga0496126_0026021
555 Ga0501032_0013355
556 Ga0501036_0016390
557 Ga0501036_0074531
558 Ga0501038_0001283
559 Ga0501039_0000497
560 Ga0501040_0003120
561 Ga0501041_0000099
562 Ga0501041_0029825
563 Ga0501041_0163018
564 Ga0501042_0000526
565 Ga0501043_0178605
566 Ga0501046_0002289
567 Ga0501046_0039253
568 Ga0501048_0030723
569 Ga0501068_0006057
570 Ga0501068_0012412
571 Ga0501069_0074679
572 Ga0501070_0007309
573 Ga0501071_0000575
574 Ga0501071_0057554
575 Ga0501072_0000109
576 Ga0501073_0028855
577 Ga0501073_0084136
578 Ga0501074_0005533
579 Ga0501074_0032965
580 Ga0501075_0000256
581 Ga0501075_0034250
582 Ga0501076_0000635
583 Ga0501076_0124605
584 Ga0501077_0001225
585 Ga0501077_0001771
586 Ga0501077_0005415
587 Ga0501079_0000395
588 Ga0501079_0060286
589 Ga0501080_0001737
590 Ga0501080_0010412
591 Ga0501080_0115921
592 Ga0501081_0008749
593 Ga0501081_0018932
594 Ga0501083_0046795
595 Ga0501035_0020580
596 Ga0501035_0037187
597 Ga0501045_0000209
598 nmdc:mga05p37_120801_c1
599 nmdc:mga05p37_185516_c1
600 nmdc:mga05p37_196970_c1
601 nmdc:mga05p37_25217_c1
602 nmdc:mga05p37_266163_c1
603 nmdc:mga09592_357654_c1
604 nmdc:mga0qj67_13763_c1
605 nmdc:mga0qj67_279649_c1
606 nmdc:mga06r32_16530_c1
607 nmdc:mga06r32_218090_c1
608 nmdc:mga08y16_105532_c1
609 nmdc:mga0n895_1841_c1
610 nmdc:mga0n895_19954_c1
611 nmdc:mga0n895_46852_c1
612 nmdc:mga0n895_51067_c1
613 nmdc:mga0rr50_41947_c1
614 nmdc:mga0rr50_81028_c1
615 nmdc:mga08x19_10266_c1
616 nmdc:mga08x19_38791_c1
617 nmdc:mga0a205_151942_c1
618 nmdc:mga0a205_1857_c1
619 nmdc:mga0a205_40875_c1
620 nmdc:mga0a205_5088_c1
621 nmdc:mga0a205_698_c1
622 Ga0501084_0000143
623 Ga0501084_0444874
624 Ga0590077_002807
625 Ga0501082_0002378
626 Ga0501082_0036219
627 Ga0501082_0065666
628 Ga0530510_0049119
629 Ga0530510_0069143
630 2884216333

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01266

DAO

FAD dependent oxidoreductase

16

411

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
8w75-assembly1.cif.gz_B structure of drosophila melanogaster l-2-hydroxyglutarate dehydrogenase 0.9669 4 397
8w78-assembly1.cif.gz_D structure of drosophila melanogaster l-2-hydroxyglutarate dehydrogenase in complex with fad and 2-oxoglutarate 0.9634 4 397
8w7f-assembly1.cif.gz_B structure of drosophila melanogaster l-2-hydroxyglutarate dehydrogenase bound with fad and a sulfate ion 0.9633 2 397
8w7f-assembly1.cif.gz_C structure of drosophila melanogaster l-2-hydroxyglutarate dehydrogenase bound with fad and a sulfate ion 0.9631 2 397
8w7f-assembly1.cif.gz_A structure of drosophila melanogaster l-2-hydroxyglutarate dehydrogenase bound with fad and a sulfate ion 0.9611 4 397
ID Description Score Start End Superfamily
af_P37339_4_262_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9726 7 263 3.50.50.60
af_Q9H9P8_51_315_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9646 7 258 3.50.50.60
af_Q9VJ28_45_268_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9644 7 216 3.50.50.60
af_Q9N4Z0_28_425_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.962 7 392 3.50.50.60
af_P37339_4_262_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9616 7 263 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A6N8G019-F1-model_v4 Hydroxyglutarate oxidase 0.991 4 393 GO:0005737
GO:0047545
AF-A0A355B5L0-F1-model_v4 L-2-hydroxyglutarate oxidase 0.9896 43 397 GO:0005737
GO:0047545
AF-W8A4Z8-F1-model_v4 deleted 0.9877 4 397
AF-A0A5N8YGV3-F1-model_v4 L-2-hydroxyglutarate oxidase (EC 1.1.3.-) 0.9877 2 397 GO:0005737
GO:0047545
AF-A0A2E5KJ30-F1-model_v4 L-2-hydroxyglutarate oxidase 0.987 1 397 GO:0005737
GO:0047545

Map